>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes. ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes. TPH catalyses the hydroxylation of L-Trp to 5-hydroxytryptophan, the rate limiting step in the biosynthesis of 5-hydroxytryptamine (serotonin) and the first reaction in the synthesis of melatonin. Very little is known about the role of the ACT domain in TPH, which appears to be regulated by phosphorylation but not by its substrate or cofactor. Members of this CD belong to the superfamily of ACT regulatory domains.

Probab=96.85 E-value=0.011 Score=38.91 Aligned_cols=66 Identities=12% Similarity=0.273 Sum_probs=51.8 Q ss_pred EEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEEEECCHHHHHHHHHHHHCCCC Q ss_conf 9999248887489999998866995788882267787761359999210488999999998623830 Q gi|254780900|r 356 IRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKSD 422 (438) Q Consensus 356 LRl~v~DkpGVLa~It~ilak~~ISIesi~Q~~~~~~~~~~~IViiTh~~~e~~i~~ai~~i~~l~~ 422 (438) T Consensus 3 lvFslk~~~GaL~~~L~~F~~~~iNlthIESRpSk~~~~~Y~-ffvD~e~~~~~l~~~l~~Lk~~~~ 68 (74) T cd04929 3 VIFSLKNEVGGLAKALKLFQELGINVVHIESRKSKRRSSEFE-IFVDCECDQRRLDELVQLLKREVA 68 (74) T ss_pred EEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEE-EEEEECCCHHHHHHHHHHHHHHCE T ss_conf 999968865679999999998697779985587878897189-999903997999999999998520

HHsearch alignment for GI: 254780900 and conserved domain: cd04929