>pfam01842 ACT ACT domain. This family of domains generally have a regulatory role. ACT domains are linked to a wide range of metabolic enzymes that are regulated by amino acid concentration. Pairs of ACT domains bind specifically to a particular amino acid leading to regulation of the linked enzyme. The ACT domain is found in: D-3-phosphoglycerate dehydrogenase EC:1.1.1.95, which is inhibited by serine. Aspartokinase EC:2.7.2.4, which is regulated by lysine. Acetolactate synthase small regulatory subunit, which is inhibited by valine. Phenylalanine-4-hydroxylase EC:1.14.16.1, which is regulated by phenylalanine. Prephenate dehydrogenase EC:4.2.1.51. formyltetrahydrofolate deformylase EC:3.5.1.10, which is activated by methionine and inhibited by glycine. GTP pyrophosphokinase EC:2.7.6.5.

Probab=98.08 E-value=2.7e-05 Score=57.23 Aligned_cols=65 Identities=14% Similarity=0.250 Sum_probs=54.0 Q ss_pred EEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEEEECCHHHHHHHHHHHHCCC Q ss_conf 27999924888748999999886699578888226778776135999921048899999999862383 Q gi|254780900|r 354 YFIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKS 421 (438) Q Consensus 354 yYLRl~v~DkpGVLa~It~ilak~~ISIesi~Q~~~~~~~~~~~IViiTh~~~e~~i~~ai~~i~~l~ 421 (438) T Consensus 1 ~~l~v~~~DrpG~l~~v~~~la~~ginI~~i~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~l~~~~ 65 (66) T pfam01842 1 TVLEVGVPDRPGLLARVFGALADRGINIESISQSTSGDK---AGIVFIVVVVDEEDLEAALEALKKLL 65 (66) T ss_pred CEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCC---CCEEEEEEECCHHHHHHHHHHHHHHC T ss_conf 969997079883799999999877999478997466787---62599999667545999999998744

HHsearch alignment for GI: 254780900 and conserved domain: pfam01842