HHsearch alignment for GI: 254780903 and conserved domain: COG4251

>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms].
Probab=100.00  E-value=2.4e-43  Score=330.91  Aligned_cols=231  Identities=23%  Similarity=0.353  Sum_probs=209.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999998878999999998767522247899999999860346889938999999999999999999977767788
Q gi|254780903|r  527 AKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS  606 (766)
Q Consensus       527 ~~l~~~~~~ae~an~~k~efla~isHelrtPL~aI~g~~ell~~~~~~~~~~e~~~~~l~~I~~~~~~l~~lI~diLd~s  606 (766)
T Consensus       508 eela~l~r~lersn~el~~f~yv~sHdlqePl~~I~~~a~lL~~~~~~~~-d~~~~~~i~~~~~~~~~~~~lidd~l~~s  586 (750)
T COG4251         508 EELAQLRRELERSNAELRAFAYVASHDLQEPLRQISNYAQLLSERYSDAL-DEEAKEFITFISRLTSLMQQLIDDLLTYS  586 (750)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998998876515899999998610466799999999976663436665-75889999999999999999999774231


Q ss_pred             HHHCCCCCCCEEEECHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCE-EEECHHHHHHHHHHHHHHHHHCC-CCCCEEEE
Q ss_conf             87419830120331699999999999999998479589998089978-99868999999999886565346-89888999
Q gi|254780903|r  607 KIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFT-NNNGKMMI  684 (766)
Q Consensus       607 rieag~~~~~~~~~dl~~~i~~~~~~~~~~~~~k~i~l~~~~~~~l~-v~~D~~~l~QVl~NLi~NAik~t-~~~g~I~i  684 (766)
T Consensus       587 ~l--~~~~~~l~~td~~~vv~~vl~~l~~ri~dtgaei~i~--~-lp~v~~d~~~l~qv~~NLi~Naik~~~~e~~~i~I  661 (750)
T COG4251         587 KL--GLTEAPLQPTDVQKVVDKVLLELSQRIADTGAEIRIA--P-LPVVAADATQLGQVFQNLIANAIKFGGPENPDIEI  661 (750)
T ss_pred             HH--CCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCEEEEC--C-CCEEECCHHHHHHHHHHHHHHHEECCCCCCCCEEE
T ss_conf             20--5545777775267899999973453112565247862--5-64464088899999999876552107888981588


Q ss_pred             EEEEECCEEEEEEEECCCCCCHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEEC
Q ss_conf             99997998999999788978977854304650531467556778876168999999996298699997989952999973
Q gi|254780903|r  685 RTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM  764 (766)
Q Consensus       685 ~~~~~~~~v~i~V~D~G~GI~~e~~~~iF~pF~q~~~~~t~~~~GtGLGLaI~k~iVe~hgG~I~v~S~~g~Gttf~i~L  764 (766)
T Consensus       662 ~~~r~ed~~t~sV~dng~Gi~~a~~~riF~iFqRl~s--~~~y~gtG~GL~I~kkI~e~H~G~i~vEs~~gEgsTF~f~l  739 (750)
T COG4251         662 SAERQEDEWTFSVRDNGIGIDPAYFERIFVIFQRLHS--RDEYLGTGLGLAICKKIAERHQGRIWVESTPGEGSTFYFTL  739 (750)
T ss_pred             EEECCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCC--HHHHCCCCCCHHHHHHHHHHHCCEEEEEECCCCCEEEEEEE
T ss_conf             5332587307985478777698999888998870375--65514777338999999998484588860478741689984


Q ss_pred             C
Q ss_conf             5
Q gi|254780903|r  765 P  765 (766)
Q Consensus       765 P  765 (766)
T Consensus       740 p  740 (750)
T COG4251         740 P  740 (750)
T ss_pred             E
T ss_conf             0