HHsearch alignment for GI: 254780903 and conserved domain: KOG3560

>KOG3560 consensus.
Probab=97.52  E-value=0.00024  Score=49.27  Aligned_cols=222  Identities=16%  Similarity=0.140  Sum_probs=122.3

Q ss_pred             CCEEEEECCCCCEEEECCCHHHHCCCCHHHHCCCCHHHHCCCCCCCHHHHHCC----CCHHEE-EEEECCCCCCEEEEEE
Q ss_conf             97899996998089971420555199788960761043205443320232115----310000-1233157782599997
Q gi|254780903|r  128 ESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD----QQPYHV-LSVNLPHNSGSILIIN  202 (766)
Q Consensus       128 ~~~i~i~d~~g~i~~~n~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~l~----~~~~~~-~~~~~~~~~~~~~~~~  202 (766)
T Consensus       121 nGF~lVvt~eg~ifyAS~tIedYLGFhQSDV~HQsVYdlIHseDR~dfqrQLhwa~~ppq~~~s~q~~~e~~~~~~~~~~  200 (712)
T KOG3560         121 NGFALVVTAEGEIFYASATIEDYLGFHQSDVMHQSVYDLIHSEDRQDFQRQLHWAMDPPQVVFSQQPPLETGDDAILRAQ  200 (712)
T ss_pred             CCEEEEEECCCEEEEEHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCCCEEEE
T ss_conf             77599995383699740017765352300101045887742220999999876425874332057873113664100110


Q ss_pred             ECC----CCHHH--HHHHHHHHHHHHHHHHHHHHH--------------------------HHHHHH-----HHHHHHHH
Q ss_conf             423----21012--345565545687887899999--------------------------999888-----89999999
Q gi|254780903|r  203 SRV----PLLRL--WREEVTLEVVFFSIISALLLF--------------------------ILFSYY-----RQAKKNKE  245 (766)
Q Consensus       203 ~~~----~~~~~--~r~~~~~~~~~~~~~~~~~~~--------------------------~~~a~~-----~dit~~r~  245 (766)
T Consensus       201 ~~~d~~ppens~yleRcficR~RCLLDnTsGFLamdfqGklk~LhGqkkk~~~g~~lpP~LaLf~iatP~~pPS~lEi~-  279 (712)
T KOG3560         201 EWGDGTPPENSAYLERCFICRFRCLLDNTSGFLAMDFQGKLKFLHGQKKKAPSGAMLPPRLALFCIATPFLPPSALEIK-  279 (712)
T ss_pred             CCCCCCCCCCCHHHHHHHEEEEEEEECCCCCEEEEECCCCEEEECCCCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHH-
T ss_conf             1676678651057764220267776538755056621232100027744488876478850478985377893165410-


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEECHHHHHHCCCCHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCC
Q ss_conf             99999999999999972259745989768978999788997729994330589889997608120589999999972489
Q gi|254780903|r  246 NDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHV  325 (766)
Q Consensus       246 ae~~l~ese~rl~~al~~a~~GiWd~D~~~~~i~ws~~~~~llG~~~~e~~~s~~~~~~~vHPdDr~~~~~a~~~~~~~~  325 (766)
T Consensus       280 ~k~~i~rtKhkl----------------Dfa~vs~Dak~k~~lgy~eaEL~~--m~gY~lvH~~D~~y~Aeah~e~iktg  341 (712)
T KOG3560         280 MKSAILRTKHKL----------------DFALVSMDAKVKATLGYCEAELHG--MPGYNLVHVEDKVYMAEAHSEGIKTG  341 (712)
T ss_pred             HHHHHHHCCCCC----------------CCCEECCCHHHHHHHCCCHHHCCC--CCCCCEEEHHHHHHHHHHHHHHHHCC
T ss_conf             366665200225----------------654003213355543201544057--87633123223455358899986358


Q ss_pred             CEEEEEEEEECCCCCEEEEEEEEEEEEECCCEEE-EEEEEECCCH
Q ss_conf             8489999988698988998899999983796069-9999844617
Q gi|254780903|r  326 KQLDQIFHMRHASGADIWIQVRAQMMRTISGGMN-IIGIAMDLTE  369 (766)
Q Consensus       326 ~~~~~e~Ri~~~DG~~~Wi~~r~~~i~d~~G~~~-~iGi~~DITE  369 (766)
T Consensus       342 eSGmlvyR~qtk~grw~wvqssarlly-kngkPD~vi~thr~l~D  385 (712)
T KOG3560         342 ESGMLVYREQTKAGRWAWVQSSARLLY-KNGKPDLVIDTHRGLGD  385 (712)
T ss_pred             CCCEEEEEEEECCCCEEEEECCCEEEE-ECCCCCEEEECCCCCCC
T ss_conf             764489998604783798534662434-16888888845877651