HHsearch alignment for GI: 254780903 and conserved domain: KOG3560

>KOG3560 consensus.
Probab=94.27  E-value=0.39  Score=26.08  Aligned_cols=71  Identities=11%  Similarity=0.088  Sum_probs=53.1

Q ss_pred             CCCCEEEEECHHHHHHHCCCHHHHCCCCCHHHHCCCHHHHHH--HHHHHCCCCCCCEEEEEEECCCEEEEECC
Q ss_conf             349969970178988839997894289717881652013789--99852112456405899916962874223
Q gi|254780903|r  399 DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII--EYRTSDPERSQDMSKEIKLADSRWLQINE  469 (766)
Q Consensus       399 D~~g~i~~~N~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~e~~~~dg~~~~i~~  469 (766)
T Consensus       290 klDfa~vs~Dak~k~~lgy~eaEL~~m~gY~lvH~~D~~y~Aeah~e~iktgeSGmlvyR~qtk~grw~wvqs  362 (712)
T KOG3560         290 KLDFALVSMDAKVKATLGYCEAELHGMPGYNLVHVEDKVYMAEAHSEGIKTGESGMLVYREQTKAGRWAWVQS  362 (712)
T ss_pred             CCCCCEECCCHHHHHHHCCCHHHCCCCCCCCEEEHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCEEEEEC
T ss_conf             2565400321335554320154405787633123223455358899986358764489998604783798534