HHsearch alignment for GI: 254780903 and conserved domain: PRK05559

>PRK05559 DNA topoisomerase IV subunit B; Reviewed.
Probab=92.28  E-value=0.015  Score=36.29  Aligned_cols=39  Identities=18%  Similarity=0.215  Sum_probs=17.3

Q ss_pred             EEEEEECCCCCEEEEEEEEEEEEECCCEEEEEEEEECCC
Q ss_conf             999988698988998899999983796069999984461
Q gi|254780903|r  330 QIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLT  368 (766)
Q Consensus       330 ~e~Ri~~~DG~~~Wi~~r~~~i~d~~G~~~~iGi~~DIT  368 (766)
T Consensus       252 veval~~~~~~~~~~~SFVN~I~T~~GGTHv~g~~~al~  290 (633)
T PRK05559        252 VEWALAWLEGGSENIESYVNLIPTPDGGTHENGFREGLL  290 (633)
T ss_pred             EEEEEEECCCCCCEEEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             999999447888447656887057999876788998999