HHsearch alignment for GI: 254780903 and conserved domain: PRK09467

>PRK09467 envZ osmolarity sensor protein; Provisional.
Probab=100.00  E-value=1.4e-45  Score=347.63  Aligned_cols=225  Identities=22%  Similarity=0.347  Sum_probs=186.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999998878999999998767522247899999999860346889938999999999999999999977
Q gi|254780903|r  521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN  600 (766)
Q Consensus       521 ~L~~~~~~l~~~~~~ae~an~~k~efla~isHelrtPL~aI~g~~ell~~~~~~~~~~e~~~~~l~~I~~~~~~l~~lI~  600 (766)
T Consensus       209 Ev~~l~~aFN~M~~~l~~~~~~r~~~la~vSHeLRTPLT~irl~~e~l~~~------~~---~~~~~i~~~i~~m~~li~  279 (437)
T PRK09467        209 EVRSVTRAFNQMSAGIKQLEDDRALLMAGVSHDLRTPLTRIRLATEMMSEE------DG---YLAESINKDIEECNAIIE  279 (437)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCC------HH---HHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999999753444327899999998746753------18---999999999999999999


Q ss_pred             HHHHHHHHHCCCCCCCEEEECHHHHHHHHHHHHHHHHHHCCCEEEEEECCC-CEEEECHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             767788874198301203316999999999999999984795899980899-7899868999999999886565346898
Q gi|254780903|r  601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNN  679 (766)
Q Consensus       601 diLd~srieag~~~~~~~~~dl~~~i~~~~~~~~~~~~~k~i~l~~~~~~~-l~v~~D~~~l~QVl~NLi~NAik~t~~~  679 (766)
T Consensus       280 ~~L~~~r~~~---~~~~~~~dl~~l~~~~~~~~~----~~~~~i~~~~~~~~~~v~~d~~~l~r~l~NLi~NA~ky~--~  350 (437)
T PRK09467        280 QFIDYLRTDQ---EMPMEMADLNALLGEVIAAES----GYEREIETALYPGPIEVPMNPIAIKRALANLVVNAARYG--N  350 (437)
T ss_pred             HHHHHHHHCC---CCCCCCCCHHHHHHHHHHHHH----CCCCEEEEECCCCCEEEEECHHHHHHHHHHHHHHHHHCC--C
T ss_conf             9999986215---566751159999999999875----549838996288764898579999999999999887607--9


Q ss_pred             CEEEEEEEEECCEEEEEEEECCCCCCHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEE
Q ss_conf             88999999979989999997889789778543046505314675567788761689999999962986999979899529
Q gi|254780903|r  680 GKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTI  759 (766)
Q Consensus       680 g~I~i~~~~~~~~v~i~V~D~G~GI~~e~~~~iF~pF~q~~~~~t~~~~GtGLGLaI~k~iVe~hgG~I~v~S~~g~Gtt  759 (766)
T Consensus       351 ~~i~V~~~~~~~~~~i~V~D~GpGI~~e~l~~if~pF~R~d~sR--~~~GsGLGLaIv~~Iv~~HgG~i~l~~~~~gGl~  428 (437)
T PRK09467        351 GWIKVSSGTEGNRAWFQVEDNGPGIPEEQIKHLFQPFTRGDSAR--GSSGTGLGLAIVKRIVDQHQGKVELGNREEGGLS  428 (437)
T ss_pred             CEEEEEEEEECCEEEEEEEECCCCCCHHHHHHHCCCCCCCCCCC--CCCCEEHHHHHHHHHHHHCCCEEEEEECCCCCEE
T ss_conf             83999999868999999997599999899987616852188899--9997728899999999986998999977999459


Q ss_pred             EEEECC
Q ss_conf             999735
Q gi|254780903|r  760 VTICMP  765 (766)
Q Consensus       760 f~i~LP  765 (766)
T Consensus       429 ~~i~lP  434 (437)
T PRK09467        429 ARAWLP  434 (437)
T ss_pred             EEEEEC
T ss_conf             999971