HHsearch alignment for GI: 254780903 and conserved domain: PRK09776

>PRK09776 putative sensor protein; Provisional.
Probab=100.00  E-value=4.1e-43  Score=329.22  Aligned_cols=369  Identities=15%  Similarity=0.164  Sum_probs=273.8

Q ss_pred             HHHHHHHHHHHHHHCC---CCCEEEEECCCCCEEEECCCHHHHCCCCHHHHCCCCHHHHCCCCCCCHHHH----HCCCCH
Q ss_conf             9999999988531017---897899996998089971420555199788960761043205443320232----115310
Q gi|254780903|r  111 KAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEA----SLDQQP  183 (766)
Q Consensus       111 ~ae~~L~~~~~~~~~~---~~~~i~i~d~~g~i~~~n~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~----~l~~~~  183 (766)
T Consensus       294 ~~~~~l~~SE~rfR~~~e~saiGmAlV~~dGr~l~VN~alc~mlGYs~~ELl~ltf~diThPdDl~~dl~~~~~LlaGei  373 (1116)
T PRK09776        294 AERKHISESETRFRNAMEYSAIGMALVGTEGQWLQVNKALCQFLGYSQEELRGLTFQQLTWPEDLNKDLQQVEKLLSGEI  373 (1116)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCEEEECHHHHHHHCCCHHHHHHCCHHHHCCCCCHHHHHHHHHHHHCCCC
T ss_conf             88888776799999998746664699868981898169999884989999852989881696217778999999976996


Q ss_pred             -HEEEE-EECCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -00012-3315778259999742321012345565545687887899999999888899999999999999999999997
Q gi|254780903|r  184 -YHVLS-VNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETAL  261 (766)
Q Consensus       184 -~~~~~-~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~a~~~dit~~r~ae~~l~ese~rl~~al  261 (766)
T Consensus       374 ~~y~lEKRyirkDG~~vW~~ltvSlvRd~~G----~p~------------~fI~~v~DIterK~aE~~lr~l~erl~la~  437 (1116)
T PRK09776        374 NSYSMEKRYYNRDGDVVWALLAVSLVRDTDG----TPL------------YFIAQIEDINELKRTEQVNERLMERITLAN  437 (1116)
T ss_pred             CCCCCEEEEECCCCCEEEEEEEEEEEECCCC----CEE------------EEEEEEEECHHHHHHHHHHHHHHHHHHHHH
T ss_conf             6454112467369979999989999976999----844------------899999733377999999999999999998


Q ss_pred             HCCCCCEEEEECCCCEEEECHHHHHHCCCCHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEEEEECCCCCE
Q ss_conf             22597459897689789997889977299943305898899976081205899999999724898489999988698988
Q gi|254780903|r  262 SRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGAD  341 (766)
Q Consensus       262 ~~a~~GiWd~D~~~~~i~ws~~~~~llG~~~~e~~~s~~~~~~~vHPdDr~~~~~a~~~~~~~~~~~~~e~Ri~~~DG~~  341 (766)
T Consensus       438 ea~~iGiwe~d~~~~~i~~~~r~~~l~g~~~~~-~~~~~~w~~~ihPdD~~~v~~~~~~~l~~~~~~d~E~Rl~~~dG~~  516 (1116)
T PRK09776        438 EAGGIGIWEWDLKPNIISWDKRMFELYEIPPHI-KPNWQVWYACLHPEDRQRVEKEIRDALQGRSPFKLEFRIVVPDGEI  516 (1116)
T ss_pred             HHCCCCEEEEECCCCCEECCHHHHHHHCCCCCC-CCCHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCE
T ss_conf             624766355205665021137899984888222-6688999872391568999999999971588756046788479978


Q ss_pred             EEEEEEEEEEEECCCEE-EEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHEEEECCCCEEEEECHHHHHHHCCCHH
Q ss_conf             99889999998379606-99999844617999999999999999999985445515883499699701789888399978
Q gi|254780903|r  342 IWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH  420 (766)
Q Consensus       342 ~Wi~~r~~~i~d~~G~~-~~iGi~~DITErK~ae~~l~ese~rlr~~ie~~~~~i~~~D~~g~i~~~N~~~~~~~g~~~~  420 (766)
T Consensus       517 r~i~~~a~~~~d~~G~~~r~~G~~~DITe~K~~eeaL~e~~erl~~~l~si~d~vi~tD~~~ri~~~Npaae~~tG~~~~  596 (1116)
T PRK09776        517 RHIRALANRVLNKDGEVERLLGINMDMTEVRQLNEALFEEKERLHITLDSIGEAVVCTDAAMKVTFMNPVAEKMTGWTQE  596 (1116)
T ss_pred             EEEEEEEEEEECCCCCEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCEEEECHHHHHHHCCCHH
T ss_conf             99986214898689988988731323207789999999999999999834022489973788678886999998298879


Q ss_pred             HHCCCCCHHHHC--CCHHHHH----HHHHHHCCCCC-CCEEEEEEECCCEEE--E--ECCEECCCC---CEEEEEEEEEH
Q ss_conf             942897178816--5201378----99985211245-640589991696287--4--223245699---78999886201
Q gi|254780903|r  421 VLVPGNARSIIQ--DAQTRPI----IEYRTSDPERS-QDMSKEIKLADSRWL--Q--INEWCTHDG---GTISVGTDITL  486 (766)
Q Consensus       421 ~~~~~~~~~~~~--~~~~~~~----~~~~~~~~~~~-~~~~~e~~~~dg~~~--~--i~~~~~~dg---~~v~v~~~i~~  486 (766)
T Consensus       597 e~~G~~~~~v~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~G~~~~v~~s~~pi~~~~g~~~g~V~v~~Dit~  676 (1116)
T PRK09776        597 EALGVPLLTVLHITFGDNGPLMENPVEICLADTSRSYLEQDVVLHSRSGGSYDVQYSIAPLSTLDGENIGSVLVFQDVTE  676 (1116)
T ss_pred             HHCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCEEEEEEEECCCCCCCCCEEEEEEEECCHHH
T ss_conf             98499878970036644211112199999740787331235368826996899997304513477855447985201229


Q ss_pred             HHCCCCCCCC
Q ss_conf             0001122322
Q gi|254780903|r  487 LKHNQAQLRE  496 (766)
Q Consensus       487 ~~~~~~~~~~  496 (766)
T Consensus       677 ~k~~~~~l~~  686 (1116)
T PRK09776        677 SRAMLRQLSY  686 (1116)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999987