HHsearch alignment for GI: 254780903 and conserved domain: PRK09959

>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional.
Probab=100.00  E-value=0  Score=549.70  Aligned_cols=358  Identities=23%  Similarity=0.319  Sum_probs=276.2

Q ss_pred             ECCCHHHHHHHHHHHHHHHHHHHHHHHHHHEEEECCCCEEEEECHHHHHHHCCCHHH--HCCCCCHHHHCCC--HHHHHH
Q ss_conf             446179999999999999999999854455158834996997017898883999789--4289717881652--013789
Q gi|254780903|r  365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHV--LVPGNARSIIQDA--QTRPII  440 (766)
Q Consensus       365 ~DITErK~ae~~l~ese~rlr~~ie~~~~~i~~~D~~g~i~~~N~~~~~~~g~~~~~--~~~~~~~~~~~~~--~~~~~~  440 (766)
T Consensus       559 r~ir~R~~ae~~L~~ql~f~~~L~d~iP~pi~v~d~~g~~i~~N~a~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~  638 (1197)
T PRK09959        559 RSVRRRKVIQGDLENQISFRKALSDSLPNPTYVVNWQGNVISHNSAFEHYFTADYYKNAMLPLENSESPFKDVFSNTHEV  638 (1197)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCHHHHCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99999999999999889999999836998769982556122411888987523144421356532222156777777899


Q ss_pred             HHHHHCCCCCCCEEEEEEECCC-------EEEEECCEECCCC-CEEEEEEEEEHHHCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             9985211245640589991696-------2874223245699-7899988620100011223222222211000017889
Q gi|254780903|r  441 EYRTSDPERSQDMSKEIKLADS-------RWLQINEWCTHDG-GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR  512 (766)
Q Consensus       441 ~~~~~~~~~~~~~~~e~~~~dg-------~~~~i~~~~~~dg-~~v~v~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~  512 (766)
T Consensus       639 ~~~~~~~~~~~~~~~~--~~~g~~~~~i~~w~~~~~~~~~~~~~~i~gw~DI----------------------------  688 (1197)
T PRK09959        639 TAETKENRTIYTQVFE--IDNGIEKRCINHWHTLCNLPASDHAVYICGWQDI----------------------------  688 (1197)
T ss_pred             HHHHHHCCCCCCEEEE--CCCCCCCEEEEEEEEEECCCCCCCEEEECCEEEH----------------------------
T ss_conf             8753101210001453--0577542367753100037644440101154641----------------------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             98644457999999999999999988789999999987675222478999999998603468899389999999999999
Q gi|254780903|r  513 QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG  592 (766)
Q Consensus       513 ~~~~~~~~~L~~~~~~l~~~~~~ae~an~~k~efla~isHelrtPL~aI~g~~ell~~~~~~~~~~e~~~~~l~~I~~~~  592 (766)
T Consensus       689 -------Terk~~e~~L~~Ak~~Ae~An~AKS~FLA~MSHEIRTPLn~IiG~~eLL~~~---~l~~~q~~~~l~~~~~Sa  758 (1197)
T PRK09959        689 -------TETRDLIHALEVERNKAINATVAKSQFLATMSHEIRTPISSIMGFLELLSGS---GLSKEQRVEAISLAYATG  758 (1197)
T ss_pred             -------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCHHHHHHHHHHHHHCC---CCCHHHHHHHHHHHHHHH
T ss_conf             -------2899999999999999999988888888747353165689999999998468---999899999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEECHHHHHHHHHHHHHHHHHHCCCEEEEEECCC--CEEEECHHHHHHHHHHHHH
Q ss_conf             99999977767788874198301203316999999999999999984795899980899--7899868999999999886
Q gi|254780903|r  593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE--LFFNADKRIIKKILFPILS  670 (766)
Q Consensus       593 ~~l~~lI~diLd~srieag~~~~~~~~~dl~~~i~~~~~~~~~~~~~k~i~l~~~~~~~--l~v~~D~~~l~QVl~NLi~  670 (766)
T Consensus       759 ~~LL~LInDILD~SKIEaG~l~l~~~~~~l~~li~~v~~~~~~~A~~K~l~l~~~~~~p~~~~v~~D~~Rl~QIL~NLls  838 (1197)
T PRK09959        759 QSLLGLIGEILDVDKIESGNYQLQPQWVDIPTLVQNTCHSFGAIAASKSIALSCSSTFPEHYLVKIDPQAFKQVLSNLLS  838 (1197)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCEECCCHHHHHHHHHHHHH
T ss_conf             99999888889998985388621452017999999999999999996796899955898751352678899999999987


Q ss_pred             HHHHCCCCCCEEEEEEEEE--C---CEEEEEEEECCCCCCHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             5653468988899999997--9---9899999978897897785430465053146755677887616899999999629
Q gi|254780903|r  671 NSIKFTNNNGKMMIRTSKI--G---QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG  745 (766)
Q Consensus       671 NAik~t~~~g~I~i~~~~~--~---~~v~i~V~D~G~GI~~e~~~~iF~pF~q~~~~~t~~~~GtGLGLaI~k~iVe~hg  745 (766)
T Consensus       839 NAIKFT~~-G~V~i~~~~~~~~~~~~~l~~~V~DTGiGI~~~~~~~iF~pF~Q~s--~~r~~~GTGLGLaI~k~LvelMg  915 (1197)
T PRK09959        839 NALKFTTE-GAVKITTSLGHIDDNHAVIKMTIMDSGSGLSQEEQQQLFKRYSQTS--AGRQQTGSGLGLMICKELIKNMQ  915 (1197)
T ss_pred             HHCCCCCC-CEEEEEEEEEECCCCEEEEEEEEEECCCCCCHHHHHHHCCCCCCCC--CCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             53746879-7899999986517980699999997787889889975367862477--88788984835999999999879


Q ss_pred             CEEEEEEECCCCEEEEEECC
Q ss_conf             86999979899529999735
Q gi|254780903|r  746 GRLKIISQEGKGTIVTICMP  765 (766)
Q Consensus       746 G~I~v~S~~g~Gttf~i~LP  765 (766)
T Consensus       916 G~I~v~S~~G~GS~F~~~lp  935 (1197)
T PRK09959        916 GDLSLESHPGIGTTFTITIP  935 (1197)
T ss_pred             CEEEEEECCCCCEEEEEEEE
T ss_conf             92899935999449999997