HHsearch alignment for GI: 254780903 and conserved domain: PRK10490

>PRK10490 sensor protein KdpD; Provisional.
Probab=100.00  E-value=0  Score=430.24  Aligned_cols=225  Identities=23%  Similarity=0.465  Sum_probs=206.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             98878999999998767522247899999999860346889938999999999999999999977767788874198301
Q gi|254780903|r  536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISI  615 (766)
Q Consensus       536 ae~an~~k~efla~isHelrtPL~aI~g~~ell~~~~~~~~~~e~~~~~l~~I~~~~~~l~~lI~diLd~srieag~~~~  615 (766)
T Consensus       657 ~aE~ErLRsalLssVSHDLRTPLtsI~G~a~~L~~~~~~--~~~~~~~~~~~I~~e~~rL~rLV~nLLdmsRle~G~l~l  734 (895)
T PRK10490        657 ASEREQLRNALLAALSHDLRTPLTVLFGQAEILTLDLAS--EGSPHARQASEIRQHVLNTTRLVNNLLDMARIQSGGFNL  734 (895)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             777778999999860343578699999999998547778--828899999999999999999999999998763699766


Q ss_pred             CEEEECHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCE-EEECHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEECCEEE
Q ss_conf             20331699999999999999998479589998089978-99868999999999886565346898889999999799899
Q gi|254780903|r  616 DKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI  694 (766)
Q Consensus       616 ~~~~~dl~~~i~~~~~~~~~~~~~k~i~l~~~~~~~l~-v~~D~~~l~QVl~NLi~NAik~t~~~g~I~i~~~~~~~~v~  694 (766)
T Consensus       735 ~~~~~~l~evv~~al~~~~~~~~~~~i~v--~~~~~~~~v~~D~~lleQVL~NLl~NAiKytp~~~~I~v~a~~~~~~v~  812 (895)
T PRK10490        735 KKEWLTLEEVVGSALQMLEPGLSQHPINL--SLPEPLTLIHVDGPLFERVLINLLENAVKYAGAQAEIGIDAHVEGENLQ  812 (895)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCEEE--EECCCCCEEEECHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCEEE
T ss_conf             46420699999999999986612696799--9569870698789999999999999999858999709999999799999


Q ss_pred             EEEEECCCCCCHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEECCC
Q ss_conf             999978897897785430465053146755677887616899999999629869999798995299997359
Q gi|254780903|r  695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ  766 (766)
Q Consensus       695 i~V~D~G~GI~~e~~~~iF~pF~q~~~~~t~~~~GtGLGLaI~k~iVe~hgG~I~v~S~~g~Gttf~i~LP~  766 (766)
T Consensus       813 i~V~D~G~GIp~~~~~~IFe~F~R~~~~--~~~~GtGLGLaI~k~IveAhGG~I~~~s~~ggGa~F~~~LPl  882 (895)
T PRK10490        813 LDVWDNGPGIPPGQEQLIFDKFARGNKE--SAVPGVGLGLAICRAIVDVHGGTITAENRPEGGACFRVTLPQ  882 (895)
T ss_pred             EEEEEECCCCCHHHHHHHCCCCCCCCCC--CCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCEEEEEEEECC
T ss_conf             9999808987979999755687128999--999974478999999999879989999569980699998329