HHsearch alignment for GI: 254780903 and conserved domain: PRK10547

>PRK10547 chemotaxis protein CheA; Provisional.
Probab=99.86  E-value=5.5e-19  Score=154.98  Aligned_cols=142  Identities=24%  Similarity=0.415  Sum_probs=115.8

Q ss_pred             EECHHHHHHHHHHHHHHHHHH--CCCEEEEEECCCCEEEECHHHHHHH---HHHHHHHHHHCC------------CCCCE
Q ss_conf             316999999999999999984--7958999808997899868999999---999886565346------------89888
Q gi|254780903|r  619 NADLIPIINEGIRLIGSSAQS--KNIKIEKKIPSELFFNADKRIIKKI---LFPILSNSIKFT------------NNNGK  681 (766)
Q Consensus       619 ~~dl~~~i~~~~~~~~~~~~~--k~i~l~~~~~~~l~v~~D~~~l~QV---l~NLi~NAik~t------------~~~g~  681 (766)
T Consensus       334 MvP~~~lf~r~~R~VRdlar~~gK~V~L~i~G~d---telDr~Ile~L~dPL~HLlRNAvDHGIE~peeR~a~GKp~~G~  410 (662)
T PRK10547        334 MMPMEYVFSRFPRLVRDLAGKLGKQVELTLVGSS---TELDKSLIERIIDPLTHLVRNSLDHGIELPEKRLAAGKNSVGN  410 (662)
T ss_pred             CEEHHHHHHHHHHHHHHHHHHHCCEEEEEEECCC---EEEHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCCEEE
T ss_conf             5218998888789999999986982599996686---7771999998887999998742430489988998759997279


Q ss_pred             EEEEEEEECCEEEEEEEECCCCCCHHHH---------------------HHHCCC-EEECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             9999999799899999978897897785---------------------430465-053146755677887616899999
Q gi|254780903|r  682 MMIRTSKIGQCVIITIADTGIGIPKSAL---------------------EKIGQP-FEPLHNQYDQSIGGFGLGLAISDA  739 (766)
Q Consensus       682 I~i~~~~~~~~v~i~V~D~G~GI~~e~~---------------------~~iF~p-F~q~~~~~t~~~~GtGLGLaI~k~  739 (766)
T Consensus       411 I~l~a~~~g~~v~I~v~DDGrGiD~e~Ir~kAv~kGL~~~e~lsd~e~~~LIF~PGFSTa~~--Vt~lSGRGVGmDVV~~  488 (662)
T PRK10547        411 LILSAEHQGGNICIEVTDDGAGLNRERILAKAASQGLAVSENMSDDEVGMLIFAPGFSTAEQ--VTDVSGRGVGMDVVKR  488 (662)
T ss_pred             EEEEEEECCCEEEEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCCCC--CCCCCCCCCCHHHHHH
T ss_conf             99999985999999998189998999999999984999853389999999971799862322--3568886646899999


Q ss_pred             HHHHCCCEEEEEEECCCCEEEEEECC
Q ss_conf             99962986999979899529999735
Q gi|254780903|r  740 LTNLHGGRLKIISQEGKGTIVTICMP  765 (766)
Q Consensus       740 iVe~hgG~I~v~S~~g~Gttf~i~LP  765 (766)
T Consensus       489 ~v~~l~G~v~v~S~~G~GT~F~l~lP  514 (662)
T PRK10547        489 NIQEMGGHVEIQSKQGTGTTIRILLP  514 (662)
T ss_pred             HHHHCCCEEEEEEECCCCEEEEEECC
T ss_conf             99982998999960898079999788