HHsearch alignment for GI: 254780903 and conserved domain: PRK11360

>PRK11360 sensory histidine kinase AtoS; Provisional.
Probab=98.64  E-value=1e-06  Score=66.41  Aligned_cols=130  Identities=15%  Similarity=0.151  Sum_probs=99.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEECHHHHHHCCCCHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCCE
Q ss_conf             99999999999997225974598976897899978899772999433058988999760812058999999997248984
Q gi|254780903|r  248 TILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ  327 (766)
Q Consensus       248 ~~l~ese~rl~~al~~a~~GiWd~D~~~~~i~ws~~~~~llG~~~~e~~~s~~~~~~~vHPdDr~~~~~a~~~~~~~~~~  327 (766)
T Consensus       254 ~~L~~~~~~~e~IL~sm~dGVIaiD~~G~I~~~N~~A~~llg~~~~e~ig~--~~~~l~~~~~--~~~~~~~~l~~~~~~  329 (607)
T PRK11360        254 QALREARTLNELIIENAADGIIAIDRQGDITTMNPAAEVITGYQRHELVGQ--PYSMLFDNTQ--FYSPVLDTLEHGTEH  329 (607)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCEEEECHHHHHHHCCCHHHHCCC--CHHHHCCCHH--HHHHHHHHHHCCCCC
T ss_conf             999999998999986104669999799949998389999858797898596--7999579576--779999998537742


Q ss_pred             EEEEEEEECCCCCEEEEEEEEEEEEECCCEE-EEEEEEECCCHHHHHHHHHHHHHH
Q ss_conf             8999998869898899889999998379606-999998446179999999999999
Q gi|254780903|r  328 LDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQ  382 (766)
Q Consensus       328 ~~~e~Ri~~~DG~~~Wi~~r~~~i~d~~G~~-~~iGi~~DITErK~ae~~l~ese~  382 (766)
T Consensus       330 ~~~~~~~~~~~~-~~~l~~~~s~~~~~~g~~~G~v~~~~DiTe~~~le~~l~~~er  384 (607)
T PRK11360        330 VALEISFPGRDR-TIELSVTTSRLHDTHGEMIGAVVIFSDLTARKRLQRRMARAER  384 (607)
T ss_pred             CCEEEEECCCCC-EEEEEEEEEEEECCCCCEEEEEEEEEECCHHHHHHHHHHHHHH
T ss_conf             124899605883-4999999853576898588999999957789999999999999