HHsearch alignment for GI: 254780903 and conserved domain: PRK13558

>PRK13558 bacterio-opsin activator; Provisional.
Probab=99.57  E-value=2e-13  Score=114.85  Aligned_cols=138  Identities=14%  Similarity=0.164  Sum_probs=111.0

Q ss_pred             HHHHHHHHCCCCCEEEE---ECCCCEEEECHHHHHHCCCCHHHCCCCHHHHHHHHCCC-CHHHHHHHHHHHHCCCCEEEE
Q ss_conf             99999972259745989---76897899978899772999433058988999760812-058999999997248984899
Q gi|254780903|r  255 ICVETALSRGRCGLWNF---NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD-NKKICEIARSVTGKHVKQLDQ  330 (766)
Q Consensus       255 ~rl~~al~~a~~GiWd~---D~~~~~i~ws~~~~~llG~~~~e~~~s~~~~~~~vHPd-Dr~~~~~a~~~~~~~~~~~~~  330 (766)
T Consensus       158 ~~~~ra~d~a~v~i~~a~~~~p~~~i~~~n~a~~eitGy~~~e~~g~~~r~lq~--~~~~~e~~~~~~~-ai~~~~~~~v  234 (674)
T PRK13558        158 RLKEQALDEAPIGITISDATDPEEPIIYINDSFEDITGYSPDEVVGANHRFLQG--PKTNEDRVAEFWT-AITEDHDTQV  234 (674)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCEEEEEHHHHHHCCCCHHHHCCCCHHHHCC--CCCCHHHHHHHHH-HHHCCCCCEE
T ss_conf             988756640572599846888887438860123653189817864974012106--8888057999999-9755886334


Q ss_pred             EEEEECCCCCEEEEEEEEEEEEECCCEE-EEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHE
Q ss_conf             9998869898899889999998379606-9999984461799999999999999999998544551
Q gi|254780903|r  331 IFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL  395 (766)
Q Consensus       331 e~Ri~~~DG~~~Wi~~r~~~i~d~~G~~-~~iGi~~DITErK~ae~~l~ese~rlr~~ie~~~~~i  395 (766)
T Consensus       235 e~r~~r~dG~~~w~~~~i~pi~Dedg~v~~~Vg~~~DiteRke~E~~L~~~~~~l~~~L~RiN~LI  300 (674)
T PRK13558        235 VLRNYRRDGSLFWNQVDISPIYDEDGTVSHYVGFQMDVSERMAAQQELQGERQSLDRLLDRVNGLM  300 (674)
T ss_pred             EEEEECCCCCEEEEECCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             533314688378741245521057885899986214477889999999986889999999999999