HHsearch alignment for GI: 254780903 and conserved domain: cd00130

>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.
Probab=98.96  E-value=2.3e-08  Score=78.29  Aligned_cols=101  Identities=16%  Similarity=0.274  Sum_probs=87.6

Q ss_pred             CCCEEEEECCCCEEEECHHHHHHCCCCHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEEEEECCCCCEEEE
Q ss_conf             97459897689789997889977299943305898899976081205899999999724898489999988698988998
Q gi|254780903|r  265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWI  344 (766)
Q Consensus       265 ~~GiWd~D~~~~~i~ws~~~~~llG~~~~e~~~s~~~~~~~vHPdDr~~~~~a~~~~~~~~~~~~~e~Ri~~~DG~~~Wi  344 (766)
T Consensus         2 ~~~i~~~d~~g~i~~~N~~~~~~~g~~~~e~~g~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~   79 (103)
T cd00130           2 PDGVIVLDLDGRILYANPAAEQLLGYSPEELIGK--SLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWV   79 (103)
T ss_pred             CEEEEEECCCCCEEEECHHHHHHHCCCHHHHCCC--CHHHEECCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCEEEE
T ss_conf             6289999798989999889999879887891699--65424552116999999999997499852489999999999999


Q ss_pred             EEEEEEEEECCCEE-EEEEEEECC
Q ss_conf             89999998379606-999998446
Q gi|254780903|r  345 QVRAQMMRTISGGM-NIIGIAMDL  367 (766)
Q Consensus       345 ~~r~~~i~d~~G~~-~~iGi~~DI  367 (766)
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~di  103 (103)
T cd00130          80 LVSLTPIRDEGGEVIGLLGVVRDI  103 (103)
T ss_pred             EEEEEEEECCCCCEEEEEEEEECC
T ss_conf             999999999998999999999829