HHsearch alignment for GI: 254780903 and conserved domain: pfam08448

>pfam08448 PAS_4 PAS fold. The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.
Probab=98.61  E-value=2e-07  Score=71.56  Aligned_cols=102  Identities=20%  Similarity=0.298  Sum_probs=70.7

Q ss_pred             HHHHHHHEEEECCCCEEEEECHHHHHHHCCCHHHHCCCCCHHHHCCCHHHHHHHHHHHCCCCCCCEE-EEEEECCC--EE
Q ss_conf             9854455158834996997017898883999789428971788165201378999852112456405-89991696--28
Q gi|254780903|r  388 IECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMS-KEIKLADS--RW  464 (766)
Q Consensus       388 ie~~~~~i~~~D~~g~i~~~N~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~e~~~~dg--~~  464 (766)
T Consensus         1 ~d~~p~~i~~~D~~g~i~~~N~a~~~~~g~~~~~~iG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~   80 (110)
T pfam08448         1 LDSLPDALAVLDPDGRVRYANAAAAELFGLPPEELLGKTLAELLPPEDAARLERALRRALEGEEPIDFLEELLLNGEERH   80 (110)
T ss_pred             CCCCCHHHEEECCCCCEEEEEHHHHHHCCCCHHHHCCCCCHHCCCCHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCEE
T ss_conf             99857353799499969999347466709898998095121006803456677789999738955886643025885200


Q ss_pred             EEECCEECCC--C---CEEEEEEEEEHHHC
Q ss_conf             7422324569--9---78999886201000
Q gi|254780903|r  465 LQINEWCTHD--G---GTISVGTDITLLKH  489 (766)
Q Consensus       465 ~~i~~~~~~d--g---~~v~v~~~i~~~~~  489 (766)
T Consensus        81 ~~~~~~pi~d~~G~~~g~v~~~~DITerKq  110 (110)
T pfam08448        81 YELRLTPLRDPDGEVIGVLVISRDITERRR  110 (110)
T ss_pred             EEEEEEEEECCCCCEEEEEEEEEECCHHCC
T ss_conf             043576689899999999999998833129