HHsearch alignment for GI: 254780903 and conserved domain: pfam10090

>pfam10090 DUF2328 Uncharacterized protein conserved in bacteria (DUF2328). Members of this family of hypothetical bacterial proteins have no known function.
Probab=97.57  E-value=0.0079  Score=38.34  Aligned_cols=177  Identities=14%  Similarity=0.110  Sum_probs=115.4

Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECHHHHHHHHHHHHHHHHH
Q ss_conf             89999999986034688993899999999999999999997776778887419830120331699999999999999998
Q gi|254780903|r  559 NAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ  638 (766)
Q Consensus       559 ~aI~g~~ell~~~~~~~~~~e~~~~~l~~I~~~~~~l~~lI~diLd~srieag~~~~~~~~~dl~~~i~~~~~~~~~~~~  638 (766)
T Consensus         2 GAI~NGLELL~~~~--~---~~~~~~m~LI~~Sa~~A~aR----l~F~RlAfGaag-~~~~i~~~e~~~~~~~~~~----   67 (181)
T pfam10090         2 GAIVNGLELLDDEG--D---PEMGPEMALIRESARNASAR----LRFFRLAFGAAG-AGQQIDLAEAKSVLEGYLA----   67 (181)
T ss_pred             CCHHHHHHHHCCCC--C---CCCHHHHHHHHHHHHHHHHH----HHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHH----
T ss_conf             31255588870789--8---64168999999999999999----999999808468-8885699999999999983----


Q ss_pred             HCCCEEEEEECCCCEEEECHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEE-CCEEEEEEEECCCCCCHHHHHHHCCCEE
Q ss_conf             479589998089978998689999999998865653468988899999997-9989999997889789778543046505
Q gi|254780903|r  639 SKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI-GQCVIITIADTGIGIPKSALEKIGQPFE  717 (766)
Q Consensus       639 ~k~i~l~~~~~~~l~v~~D~~~l~QVl~NLi~NAik~t~~~g~I~i~~~~~-~~~v~i~V~D~G~GI~~e~~~~iF~pF~  717 (766)
T Consensus        68 ~~r~~l~W~~~~~~---~-~k~~vklllnl~l~~~~AlprGG~i~V~~~~~~~~~~~v~a~g~r~~~~~~~~~~L~g~~-  142 (181)
T pfam10090        68 GGRITLDWQLERDL---L-PKPEVKLLLNLLLIAEDALPRGGEIDVGEGSDGAGGWRVTAEGERLRIDPDLWAALAGGA-  142 (181)
T ss_pred             CCCEEEEECCCCCC---C-CHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCEEEEEEEECCCCCCHHHHHHHCCCC-
T ss_conf             88538983587454---8-879999999999999975477877899984178975999997046789978999856999-


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEE
Q ss_conf             3146755677887616899999999629869999798995299
Q gi|254780903|r  718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIV  760 (766)
Q Consensus       718 q~~~~~t~~~~GtGLGLaI~k~iVe~hgG~I~v~S~~g~Gttf  760 (766)
T Consensus       143 -----~~~~l~~~~VQ~~~l~~la~~~G~~l~~~~~~~-~i~l  179 (181)
T pfam10090       143 -----PEEELDARNVQFYLLPLLAREAGGTLSYEITED-GIVL  179 (181)
T ss_pred             -----CCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC-EEEE
T ss_conf             -----877899876499999999998699117886497-7998