BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780903|ref|YP_003065316.1| two-component sensor histidine
kinase protein [Candidatus Liberibacter asiaticus str. psy62]
         (766 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040580|gb|ACT57376.1| two-component sensor histidine kinase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 766

 Score =  684 bits (1765), Expect = 0.0,   Method: Composition-based stats.
 Identities = 766/766 (100%), Positives = 766/766 (100%)

Query: 1   MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFL 60
           MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFL
Sbjct: 1   MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFL 60

Query: 61  VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL 120
           VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL
Sbjct: 61  VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL 120

Query: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
           AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD
Sbjct: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180

Query: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
           QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA
Sbjct: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240

Query: 241 KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR 300
           KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR
Sbjct: 241 KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR 300

Query: 301 AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI 360
           AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI
Sbjct: 301 AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI 360

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
           IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH
Sbjct: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV 480
           VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV
Sbjct: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV 480

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN
Sbjct: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
           KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN
Sbjct: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRI 660
           NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRI
Sbjct: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRI 660

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH 720
           IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH
Sbjct: 661 IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH 720

Query: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
Sbjct: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766


>gi|150395865|ref|YP_001326332.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           medicae WSM419]
 gi|150027380|gb|ABR59497.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           medicae WSM419]
          Length = 772

 Score =  678 bits (1749), Expect = 0.0,   Method: Composition-based stats.
 Identities = 351/757 (46%), Positives = 507/757 (66%), Gaps = 10/757 (1%)

Query: 19  RQKITVSSKQAFKRAY--------TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           R ++        +R +              L        ++IP++ + FL+ +A S +  
Sbjct: 13  RLRLKFPGLSGLEREFIEQAKIFAEPASQKLAMAEPMLKRSIPVLIIAFLLIVAISRMSG 72

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQ-NNNIKFDLASQKKAESMLGQLLAKTRFLSES 129
           +   +A+ E  + +T  +   A     Q +    F    + + E  L + L      +  
Sbjct: 73  MMDEHARMEASSRRTVSLTAAAAAGALQPDGPEIFTDVRRWEIEQRLTEFLPADMLDAGI 132

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
            +L  + +  VFAS+   +H +G+ +  + PE++  +   +   +  AS+D   + +   
Sbjct: 133 ILLTVRRDGRVFASTQDGAHLVGRTLSAVAPEVATLQYYGEGAGIVRASVDGVDHFIALR 192

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
            LPH+ G++L   S       WR+E++L V  F+ +SA+L+ +L++YY QAK+ ++ D I
Sbjct: 193 QLPHSGGAVLAATSIASFEAAWRDEISLNVTLFAGVSAILMVVLYAYYIQAKRARDADAI 252

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
             E+N+ VETALSRGRCGLW+F+ DN++   SRSMYE++G+P +   LSF   ARL+H D
Sbjct: 253 FAESNLRVETALSRGRCGLWDFDLDNRRLFWSRSMYEMLGMPGDASVLSFGDAARLMHVD 312

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
           ++ I  +AR++     +Q+DQ+F MRHA G  +W++ RAQ++RT+SG  ++IGIAMD+TE
Sbjct: 313 DRGIYRVARAIARGSERQIDQVFRMRHADGHYVWLRARAQVIRTVSGRTHLIGIAMDVTE 372

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           ++ L +RYAEADQRL+ AIECTSEA VLWDK+DRLVMCN ++Q+A+ LPDHVLVPG  R+
Sbjct: 373 QHRLAQRYAEADQRLADAIECTSEAFVLWDKHDRLVMCNTHFQQAWQLPDHVLVPGTERT 432

Query: 430 IIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
           I+Q A  RP++E R +DP+RS    + E++LAD RWLQINE  T DGG +SVGTDITLLK
Sbjct: 433 IVQAAAARPVVERRIADPDRSNHSQTSEVQLADERWLQINERRTRDGGLVSVGTDITLLK 492

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLA 548
            +Q +LRES+RRL ATI DLS SR  LE+QK ELS+ANA YQ EKERAE AN+ KSEFLA
Sbjct: 493 RHQVRLRESERRLMATIGDLSASRITLEQQKAELSVANANYQAEKERAEAANRAKSEFLA 552

Query: 549 KMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKI 608
            MSHELRTPLNAILGFSE+++ ++FG LGS KY+EY++DI  SG+HLLN+IN+IL+MSKI
Sbjct: 553 NMSHELRTPLNAILGFSEILQDQMFGPLGSEKYHEYSRDIFESGKHLLNVINDILDMSKI 612

Query: 609 ETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPI 668
           E   + I ++  DL P+I E +R     A+ KNI++ +++ S L   AD+R +K++L  +
Sbjct: 613 EAGHMRITRERIDLAPLIEETLRFTTIPAEQKNIRVVQQVSSGLTMFADRRAMKQVLLNL 672

Query: 669 LSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
           LSN++KFTN  G++ +R  K+   V +TIAD+GIGIP+ AL+KIGQPFE + +QY +S G
Sbjct: 673 LSNAVKFTNEGGRISLRARKVRGAVTLTIADSGIGIPRDALQKIGQPFEQVQSQYAKSKG 732

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           G GLGLAIS +LT LHGG +KI S E  GTI+++ +P
Sbjct: 733 GSGLGLAISRSLTRLHGGSIKIHSTENVGTIISVRIP 769


>gi|307309665|ref|ZP_07589317.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           meliloti BL225C]
 gi|307319462|ref|ZP_07598889.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           meliloti AK83]
 gi|306894834|gb|EFN25593.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           meliloti AK83]
 gi|306899877|gb|EFN30500.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           meliloti BL225C]
          Length = 775

 Score =  676 bits (1745), Expect = 0.0,   Method: Composition-based stats.
 Identities = 352/757 (46%), Positives = 505/757 (66%), Gaps = 10/757 (1%)

Query: 19  RQKITVSSKQAFKRAY--------TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           R ++        +R +              L        ++IP++ + FL+ +A S +  
Sbjct: 16  RLRLKFPGFSGLEREFIEQAKIFAEPASQKLAMAEPMLKRSIPVLIIAFLLIVAISRMSG 75

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA-SQKKAESMLGQLLAKTRFLSES 129
           +   +A+ E  + +T  +   A   +FQ    +      + + E  L + L      +  
Sbjct: 76  IMDEHARMEASSRRTVSLAAAAAAGVFQTGGSELFAEGRRWEVERRLTEFLPAEILDAGI 135

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
           F+L  + +  VFA +    H IG+ +  I PE++  +   +   +  AS+D   + +   
Sbjct: 136 FLLTVRRDGRVFAGTQDGVHLIGRTLSAIAPEVATLQYYGEGASVVRASIDGTEHFIALR 195

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
            LP + G++L   S       WR+E++L V  F+ +SA+L+ +L++YY QAK+ ++ D +
Sbjct: 196 QLPDSGGAVLAATSIARFEAAWRDEISLNVTLFAGVSAILMVVLYAYYIQAKRTRDADAV 255

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
             E+N+ VETALSRGRCGLW+F+ DN++   SRSMYE++G+  +   LSF   ARL+H +
Sbjct: 256 FAESNLRVETALSRGRCGLWDFDLDNRRLFWSRSMYEMLGMQGDASVLSFGDAARLMHVE 315

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
           ++ I  +AR++   + +Q+DQ+F MRHA G  +W++ RAQ++RT+SG  ++IGIAMD+TE
Sbjct: 316 DRGIYRVARAIAKGNERQIDQVFRMRHADGHYVWLRARAQVIRTVSGRTHLIGIAMDVTE 375

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           ++ L +RYAEADQRL+ AIECTSEA VLWDK+DRLVMCN +YQ+A+ LPDHVLVPG  R+
Sbjct: 376 QHRLAQRYAEADQRLADAIECTSEAFVLWDKHDRLVMCNTHYQQAWQLPDHVLVPGTERT 435

Query: 430 IIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
           I+  A  RP++E R +DP+RS    + E++LAD RWLQINE  T DGG +SVGTDITLLK
Sbjct: 436 IVHAAAARPVVERRIADPDRSNHSQTSEVQLADERWLQINERRTRDGGLVSVGTDITLLK 495

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLA 548
            +Q +LRES+RRL ATI DLS SR  LE+QK ELSIANA YQ EKERAE AN+ KSEFLA
Sbjct: 496 RHQVRLRESERRLMATIGDLSASRVTLEQQKAELSIANANYQAEKERAEAANRAKSEFLA 555

Query: 549 KMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKI 608
            MSHELRTPLNAILGFSE+++ ++FG LGS KY+EY++DI  SG+HLLN+IN+IL+MSKI
Sbjct: 556 NMSHELRTPLNAILGFSEILQDQMFGPLGSEKYHEYSRDIFESGKHLLNVINDILDMSKI 615

Query: 609 ETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPI 668
           E   + I ++  DL P+I E +R     A+ KNI++ ++I S L   AD+R +K++L  +
Sbjct: 616 EAGHMRITRERIDLAPLIEETLRFTTIPAERKNIRVVQQISSGLTMFADRRAMKQVLLNL 675

Query: 669 LSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
           LSN++KFTN  G++ +R  K+   V +TIAD+GIGIPK AL+KIGQPFE + +QY +S G
Sbjct: 676 LSNAVKFTNEGGRISLRARKVRGAVTLTIADSGIGIPKGALQKIGQPFEQVQSQYAKSKG 735

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           G GLGLAIS +LT LHGG +KI S E  GTI+++ +P
Sbjct: 736 GSGLGLAISRSLTRLHGGTMKIHSAENVGTIISVRIP 772


>gi|15964778|ref|NP_385131.1| putative sensor histidine kinase transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|15073956|emb|CAC45597.1| Putative sensor histidine kinase transmembrane protein
           [Sinorhizobium meliloti 1021]
          Length = 772

 Score =  676 bits (1744), Expect = 0.0,   Method: Composition-based stats.
 Identities = 352/757 (46%), Positives = 505/757 (66%), Gaps = 10/757 (1%)

Query: 19  RQKITVSSKQAFKRAY--------TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           R ++        +R +              L        ++IP++ + FL+ +A S +  
Sbjct: 13  RLRLKFPGFSGLEREFIEQAKIFAEPASQKLAMAEPMLKRSIPVLIIAFLLIVAISRMSG 72

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA-SQKKAESMLGQLLAKTRFLSES 129
           +   +A+ E  + +T  +   A   +FQ    +      + + E  L + L      +  
Sbjct: 73  IMDEHARMEASSRRTVSLAAAAAAGVFQTGGSELFAEGRRWEVERRLTEFLPAEILDAGI 132

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
           F+L  + +  VFA +    H IG+ +  I PE++  +   +   +  AS+D   + +   
Sbjct: 133 FLLTVRRDGRVFAGTQDGVHLIGRTLSAIAPEVATLQYYGEGASVVRASIDGTEHFIALR 192

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
            LP + G++L   S       WR+E++L V  F+ +SA+L+ +L++YY QAK+ ++ D +
Sbjct: 193 QLPDSGGAVLAATSIARFEAAWRDEISLNVTLFAGVSAILMVVLYAYYIQAKRTRDADAV 252

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
             E+N+ VETALSRGRCGLW+F+ DN++   SRSMYE++G+  +   LSF   ARL+H +
Sbjct: 253 FAESNLRVETALSRGRCGLWDFDLDNRRLFWSRSMYEMLGMQGDASVLSFGDAARLMHVE 312

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
           ++ I  +AR++   + +Q+DQ+F MRHA G  +W++ RAQ++RT+SG  ++IGIAMD+TE
Sbjct: 313 DRGIYRVARAIAKGNERQIDQVFRMRHADGHYVWLRARAQVIRTVSGRTHLIGIAMDVTE 372

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           ++ L +RYAEADQRL+ AIECTSEA VLWDK+DRLVMCN +YQ+A+ LPDHVLVPG  R+
Sbjct: 373 QHRLAQRYAEADQRLADAIECTSEAFVLWDKHDRLVMCNTHYQQAWQLPDHVLVPGTERT 432

Query: 430 IIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
           I+  A  RP++E R +DP+RS    + E++LAD RWLQINE  T DGG +SVGTDITLLK
Sbjct: 433 IVHAAAARPVVERRIADPDRSNHSQTSEVQLADERWLQINERRTRDGGLVSVGTDITLLK 492

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLA 548
            +Q +LRES+RRL ATI DLS SR  LE+QK ELSIANA YQ EKERAE AN+ KSEFLA
Sbjct: 493 RHQVRLRESERRLMATIGDLSASRVTLEQQKAELSIANANYQAEKERAEAANRAKSEFLA 552

Query: 549 KMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKI 608
            MSHELRTPLNAILGFSE+++ ++FG LGS KY+EY++DI  SG+HLLN+IN+IL+MSKI
Sbjct: 553 NMSHELRTPLNAILGFSEILQDQMFGPLGSEKYHEYSRDIFESGKHLLNVINDILDMSKI 612

Query: 609 ETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPI 668
           E   + I ++  DL P+I E +R     A+ KNI++ ++I S L   AD+R +K++L  +
Sbjct: 613 EAGHMRITRERIDLAPLIEETLRFTTIPAERKNIRVVQQISSGLTMFADRRAMKQVLLNL 672

Query: 669 LSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
           LSN++KFTN  G++ +R  K+   V +TIAD+GIGIPK AL+KIGQPFE + +QY +S G
Sbjct: 673 LSNAVKFTNEGGRISLRARKVRGAVTLTIADSGIGIPKGALQKIGQPFEQVQSQYAKSKG 732

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           G GLGLAIS +LT LHGG +KI S E  GTI+++ +P
Sbjct: 733 GSGLGLAISRSLTRLHGGTMKIHSAENVGTIISVRIP 769


>gi|86356937|ref|YP_468829.1| two-component sensor histidine kinase protein [Rhizobium etli CFN
           42]
 gi|86281039|gb|ABC90102.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli CFN 42]
          Length = 767

 Score =  672 bits (1734), Expect = 0.0,   Method: Composition-based stats.
 Identities = 371/755 (49%), Positives = 519/755 (68%), Gaps = 7/755 (0%)

Query: 17  GNRQKITVSSKQAFKRAY------TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           G R ++     +A++ +         ++ HL        +TIP + + FL  +A S    
Sbjct: 11  GGRLRVDFDGLKAWRNSLSGHAASEPLLRHLPKAELILKRTIPALIVAFLSVVAASHFFG 70

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           +   YA+ E      + +       +F + +  FD     +A++ L + L + R  S +F
Sbjct: 71  MMNEYARLEASARHATALSAATASAVFADASQIFDSGDIGQAQTRLAKYLPQDRLDSGAF 130

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VFA++T    ++G  +G+  PE+S  R       + E ++   P++     
Sbjct: 131 VLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFGDRAGVIETTIGGVPHYAEITL 190

Query: 191 LPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTIL 250
           + +  G I+   S   + ++WREE+ L V  F+ IS++LL IL++YY Q K+ ++ D I 
Sbjct: 191 MGNAGGYIVAATSLEEISQVWREELALNVTLFAGISSILLVILYAYYTQVKRARDADDIF 250

Query: 251 LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
           LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++G+P  +KTL F   ARL+H D+
Sbjct: 251 LESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDMLGLPGSDKTLGFGEAARLMHPDD 310

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEK 370
             + EIAR++   H  Q+DQIF MRHA G  +W++ RAQ++R+ SG M++IGIAMD+TE+
Sbjct: 311 GGLYEIARAIANGHSGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRMHLIGIAMDVTEQ 370

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
           + L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RSI
Sbjct: 371 HRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQEAYGLPDSVLVPGTERSI 430

Query: 431 IQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHN 490
           +  A  RP+IE R +D + S   + E++LAD RWLQINE  T DGG +SVGTDITL+K +
Sbjct: 431 VNAAAARPVIERRVADADGSG-RTTEVQLADERWLQINERRTRDGGRVSVGTDITLMKRH 489

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKM 550
           Q +LRES+RRL ATI DLS SRQ LE QK ELS ANA YQ EKERAE ANK KSEFLA M
Sbjct: 490 QERLRESERRLMATIGDLSASRQTLELQKAELSTANANYQAEKERAEAANKAKSEFLANM 549

Query: 551 SHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIET 610
           SHELRTPLNAILGFSE+++ ++FG LGS+KY EYA+DIH SG+HLLN+IN+IL+MSKIE 
Sbjct: 550 SHELRTPLNAILGFSEILQNQMFGPLGSLKYDEYARDIHDSGKHLLNVINDILDMSKIEA 609

Query: 611 EKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILS 670
             + + ++  DL+P+I E +R     A  KNI IE++I S L   AD+R +K++L  +LS
Sbjct: 610 GHLKLHRERIDLVPLIEESLRFTAIPAAEKNIVIEQRISSGLTLTADRRAMKQVLLNLLS 669

Query: 671 NSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGF 730
           N++KFT++ G++ +RT ++   V +TIADTGIGIP+SAL KIGQPFE + +QY +S GG 
Sbjct: 670 NAVKFTDDGGRIAVRTRRVDGAVFVTIADTGIGIPRSALSKIGQPFEQVQSQYAKSKGGS 729

Query: 731 GLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GLGLAIS +LT+LHGGR+KI S+E  GT++++ +P
Sbjct: 730 GLGLAISRSLTSLHGGRMKIRSREAVGTVISLRIP 764


>gi|190891008|ref|YP_001977550.1| two-component sensor histidine kinase [Rhizobium etli CIAT 652]
 gi|190696287|gb|ACE90372.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli CIAT 652]
          Length = 761

 Score =  668 bits (1724), Expect = 0.0,   Method: Composition-based stats.
 Identities = 366/756 (48%), Positives = 516/756 (68%), Gaps = 7/756 (0%)

Query: 17  GNRQKITVSSKQAFKRAY------TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           G R ++     +A++ +         ++ HL        + IP + + FL  +A S    
Sbjct: 3   GGRLRVDFDGLKAWRDSLSGHPTSEPLLRHLPKAELILKRAIPALIVAFLSVVAASHFFG 62

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           + + Y++ E      + +       +F + +  FD     +A++ L + L + R    +F
Sbjct: 63  MMSEYSRLEASARHATALSAATASAVFADASDIFDSGDITQAQARLARYLPQDRLDDGAF 122

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VFA++T    ++G  +G+  PE+S  R       + E ++   P++     
Sbjct: 123 VLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFGDRAGVIETTIGGVPHYAEITL 182

Query: 191 LPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTIL 250
           + +  G ++   S   + RLWREE+ L V  F+ IS++LL IL++YY Q K+ ++ D I 
Sbjct: 183 MGNAGGFVVAATSLEEVGRLWREELALNVTLFAGISSILLVILYAYYTQVKRARDADDIF 242

Query: 251 LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
           LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++G+P  +KT+ F   ARL+H D+
Sbjct: 243 LESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDMLGLPGSDKTMGFGEAARLMHPDD 302

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEK 370
             + EIAR++   H  Q+DQIF MRHA G  +W++ RAQ++R+ SG M++IGIAMD+TE+
Sbjct: 303 GGLYEIARAIAKGHSGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRMHLIGIAMDVTEQ 362

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
           + L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RSI
Sbjct: 363 HRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQQAYGLPDSVLVPGTERSI 422

Query: 431 IQDAQTRPIIEYRTSDPER-SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
           +  A  RP+IE R +D +      + E++LAD RWLQINE  T DGG +SVGTDITL+K 
Sbjct: 423 VNAAAARPVIERRIADADGSGYSRTTEVQLADERWLQINERRTRDGGRVSVGTDITLMKR 482

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
           +Q +LRES+RRL ATI DLS SRQ LE QK+ELS ANA YQ EKERAE ANK KSEFLA 
Sbjct: 483 HQERLRESERRLMATIGDLSASRQTLEIQKSELSTANANYQAEKERAEAANKAKSEFLAN 542

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           MSHELRTPLNAILGFSE+++ ++FG LGS KY EYA+DIH SG+HLLN+I++IL+MSKIE
Sbjct: 543 MSHELRTPLNAILGFSEILQNQMFGPLGSAKYDEYARDIHDSGKHLLNVISDILDMSKIE 602

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPIL 669
              + + ++  DL+P+I E +R     A  KNI I+++I S L   AD+R +K++L  +L
Sbjct: 603 AGHLKLHRERIDLVPLIEESLRFTAIPAAEKNILIDQRISSGLTLTADRRAMKQVLLNLL 662

Query: 670 SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           SN++KFT+N G++ +RT ++   V +TIADTGIGIP+SAL KIGQPFE + +QY +S GG
Sbjct: 663 SNAVKFTDNGGRIAVRTRRVDGAVTVTIADTGIGIPRSALSKIGQPFEQVQSQYAKSKGG 722

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GLGLAIS +LT LHGGR+KI S+E  GT++++ +P
Sbjct: 723 SGLGLAISRSLTALHGGRMKIRSREAVGTVISLRIP 758


>gi|327193951|gb|EGE60826.1| putative two-component sensor histidine kinase protein [Rhizobium
           etli CNPAF512]
          Length = 769

 Score =  666 bits (1718), Expect = 0.0,   Method: Composition-based stats.
 Identities = 367/756 (48%), Positives = 515/756 (68%), Gaps = 7/756 (0%)

Query: 17  GNRQKITVSSKQAFKRAY------TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           G R ++     +A++ +         ++ HL        + IP + + FL  +A S    
Sbjct: 11  GGRLRVDFDGLKAWRDSLSGHPTSEPLLRHLPKAELILKRAIPALIIAFLSVVAASHFFG 70

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           + + Y++ E      + +       +F +    FD     +A++ L + L + R    +F
Sbjct: 71  MMSEYSRLEASARHATALSAATASAVFADAADIFDSGDITQAQARLARYLPQDRLDDGAF 130

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VFA++T    ++G  +G+  PE+S  R       + E ++   P++     
Sbjct: 131 VLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFGDRAGVIETTIGGVPHYAEITL 190

Query: 191 LPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTIL 250
           + +  G ++   S   + RLWREE+ L V  F+ IS++LL IL++YY Q K+ ++ D I 
Sbjct: 191 MGNAGGFVVAATSLEEVGRLWREELALNVTLFAGISSILLVILYAYYTQVKRARDADDIF 250

Query: 251 LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
           LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++G+P  +KT+ F   ARL+H D+
Sbjct: 251 LESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDMLGLPGSDKTMGFGEAARLMHPDD 310

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEK 370
             + EIAR++   H  Q+DQIF MRHA G  +W++ RAQ++R+ SG M++IGIAMD+TE+
Sbjct: 311 GGLYEIARAIAKGHSGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRMHLIGIAMDVTEQ 370

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
           + L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RSI
Sbjct: 371 HRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQQAYGLPDSVLVPGTERSI 430

Query: 431 IQDAQTRPIIEYRTSDPER-SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
           +  A  RP+IE R +D +      + E++LAD RWLQINE  T DGG +SVGTDITL+K 
Sbjct: 431 VNAAAARPVIERRIADADGSGYSRTTEVQLADERWLQINERRTRDGGRVSVGTDITLMKR 490

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
           +Q +LRES+RRL ATI DLS SRQ LE QK ELS ANA YQ EKERAE ANK KSEFLA 
Sbjct: 491 HQERLRESERRLMATIGDLSASRQTLELQKAELSTANANYQAEKERAEAANKAKSEFLAN 550

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           MSHELRTPLNAILGFSE+++ ++FG LGS+KY EYA+DIH SG+HLLN+IN+IL+MSKIE
Sbjct: 551 MSHELRTPLNAILGFSEILQNQMFGPLGSLKYDEYARDIHDSGKHLLNVINDILDMSKIE 610

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPIL 669
              + + ++  DL+P+I E +R     A  KNI IE++I S +   AD+R +K++L  +L
Sbjct: 611 AGHLRLHRERIDLVPLIEESLRFTAIPAAEKNIVIEQRICSGMALMADRRAMKQVLLNLL 670

Query: 670 SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           SN++KFT+N G++ +RT ++   V +TIADTGIGIP+SAL KIGQPFE + +QY +S GG
Sbjct: 671 SNAVKFTDNGGRIAVRTRRVDGAVTVTIADTGIGIPRSALSKIGQPFEQVQSQYAKSKGG 730

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GLGLAIS +LT LHGGR+KI S+E  GT++++ +P
Sbjct: 731 SGLGLAISRSLTALHGGRMKIRSREAVGTVISLRIP 766


>gi|209548532|ref|YP_002280449.1| multi-sensor signal transduction histidine kinase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534288|gb|ACI54223.1| multi-sensor signal transduction histidine kinase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 769

 Score =  665 bits (1717), Expect = 0.0,   Method: Composition-based stats.
 Identities = 368/756 (48%), Positives = 518/756 (68%), Gaps = 7/756 (0%)

Query: 17  GNRQKITVSSKQAFKRAY------TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           G R ++     +A++ +         ++ HL        + IP + + FL  +A S    
Sbjct: 11  GGRLRVDFDGLKAWRDSLSGHATSEPLLRHLPKAELLLKRAIPALIVAFLFVVAASHFFG 70

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           + + Y++ E      + +       +F + +  FD     +A++ L + L + R  S +F
Sbjct: 71  MVSEYSRLEASARHATALSAATASAVFADTSEIFDSGDIAEAQARLARFLPQDRLDSGAF 130

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VFA++T    ++G  +G+  PE+S  R       + E ++   P++     
Sbjct: 131 VLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFGDRAGVIETTIGGVPHYAEITL 190

Query: 191 LPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTIL 250
           + +  G I+   S   + RLWRE++ L V  F+ IS++LL IL++YY Q K+ ++ D I 
Sbjct: 191 MGNAGGYIVAATSLDEISRLWREQLALNVTLFAGISSILLVILYAYYTQVKRARDADDIF 250

Query: 251 LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
           LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++G+P  +KT+ F   ARL+H D+
Sbjct: 251 LESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDMLGLPGSDKTMGFGEAARLMHPDD 310

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEK 370
             + EIAR++   H  Q+DQIF MRHA G  +W++ RAQ++R+ SG +++IGIAMD+TE+
Sbjct: 311 GGLYEIARAIAKGHSGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRVHLIGIAMDVTEQ 370

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
           + L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RSI
Sbjct: 371 HRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQQAYGLPDSVLVPGTERSI 430

Query: 431 IQDAQTRPIIEYRTSDPER-SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
           +  A  RP+IE R +D +      + E++LAD RWLQINE  T DGG +SVGTDITL+K 
Sbjct: 431 VNAAAARPVIERRIADADGPGYSRTTEVQLADERWLQINERRTRDGGRVSVGTDITLMKR 490

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
           +Q +LRES+RRL ATI DLS SRQ LE QK+ELS ANA YQ EKERAE ANK KSEFLA 
Sbjct: 491 HQERLRESERRLMATIGDLSASRQTLEIQKSELSTANANYQAEKERAEAANKAKSEFLAN 550

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           MSHELRTPLNAILGFSE+++ ++FG LGS+KY EYA+DIH SG+HLLN+IN+IL+MSKIE
Sbjct: 551 MSHELRTPLNAILGFSEILQNQMFGPLGSLKYDEYARDIHDSGKHLLNVINDILDMSKIE 610

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPIL 669
              + +  +  DL+P+I E +R     A  KNI I+++I S L   AD+R +K++L  +L
Sbjct: 611 AGHLRLHCERIDLVPLIEESLRFTAIPAAEKNIVIDQRISSGLTLTADRRAMKQVLLNLL 670

Query: 670 SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           SN++KFT+N G++ +RT +I   V++TIADTGIGIP+SAL KIGQPFE + +QY +S GG
Sbjct: 671 SNAVKFTDNGGRIAVRTRRIDGAVLVTIADTGIGIPRSALSKIGQPFEQVQSQYAKSKGG 730

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GLGLAIS +LT LHGGR+KI S+E  GT++++ +P
Sbjct: 731 SGLGLAISRSLTALHGGRMKIRSREAVGTVISLRIP 766


>gi|241203816|ref|YP_002974912.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857706|gb|ACS55373.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 769

 Score =  665 bits (1715), Expect = 0.0,   Method: Composition-based stats.
 Identities = 367/756 (48%), Positives = 514/756 (67%), Gaps = 7/756 (0%)

Query: 17  GNRQKITVSSKQAFKRAY------TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           G R ++      A++ +         ++ +L        + IP + + FL  +A S    
Sbjct: 11  GGRLRVDFDGLNAWRDSLSGHATSEPLLRYLPKAELVLKRAIPALIVAFLSVVAASHFFG 70

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           + + Y + E      + +       +F + +  FD      A++ L + L + R  S +F
Sbjct: 71  MMSEYGRLEASARHATALSAATASAVFADASDIFDSGDITGAQARLAKYLPQDRLDSGAF 130

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VFA++T    ++G  +G+  PE+S  R       + E ++   P++     
Sbjct: 131 VLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFGDRAGVIETTIGGVPHYAEITL 190

Query: 191 LPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTIL 250
           + +  G I+   S   + RLWREE+ L V  F+ IS++LL IL++YY Q K+ ++ D I 
Sbjct: 191 MGNAGGYIVAATSLDEIGRLWREELALNVTLFAGISSILLVILYAYYTQVKRARDADDIF 250

Query: 251 LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
           LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++G+P  +KT+ F   ARL+H D+
Sbjct: 251 LESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDMLGLPGSDKTMGFGEAARLMHPDD 310

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEK 370
             + EIAR++      Q+DQIF MRHA G  +W++ RAQ++R+ SG M++IGIAMD+TE+
Sbjct: 311 GGLYEIARAIGKGASGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRMHLIGIAMDVTEQ 370

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
           + L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RS 
Sbjct: 371 HRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQQAYGLPDSVLVPGTERST 430

Query: 431 IQDAQTRPIIEYRTSDPER-SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
           +  A  RP+IE R SD +      + E++LAD RWLQINE  T DGG +SVGTDITL+K 
Sbjct: 431 VNAAAARPVIERRISDADGSGYSRTTEVQLADERWLQINERRTRDGGRVSVGTDITLMKR 490

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
           +Q +LRES+RRL ATI DLS SRQ LE QK+ELS AN+ YQ EKERAE ANK KSEFLA 
Sbjct: 491 HQERLRESERRLMATIGDLSASRQTLEIQKSELSTANSNYQAEKERAEAANKAKSEFLAN 550

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           MSHELRTPLNAILGFSE+++ ++FG LGS+KY EYA+DIH SG+HLLN+IN+IL+MSKIE
Sbjct: 551 MSHELRTPLNAILGFSEILQNQMFGPLGSLKYDEYARDIHDSGKHLLNVINDILDMSKIE 610

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPIL 669
              + +  +  DL+P+I E +R     A  KNI IE++I S L   AD+R +K++L  +L
Sbjct: 611 AGHVRLHCERIDLVPLIEESLRFTAMPAAEKNIVIEQRICSGLTLMADRRAMKQVLLNLL 670

Query: 670 SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           SN++KFT+N G++ +RT ++   V++TIADTGIGIP+SAL KIGQPFE + +QY +S GG
Sbjct: 671 SNAVKFTDNGGRIAVRTRRVDGAVVVTIADTGIGIPRSALSKIGQPFEQVQSQYAKSKGG 730

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GLGLAIS +LT+LHGGR+KI S+E  GT++++ +P
Sbjct: 731 SGLGLAISRSLTSLHGGRMKIRSREAVGTVISLRIP 766


>gi|227821363|ref|YP_002825333.1| two component sensor kinase [Sinorhizobium fredii NGR234]
 gi|227340362|gb|ACP24580.1| two component sensor kinase [Sinorhizobium fredii NGR234]
          Length = 775

 Score =  663 bits (1712), Expect = 0.0,   Method: Composition-based stats.
 Identities = 349/757 (46%), Positives = 507/757 (66%), Gaps = 10/757 (1%)

Query: 19  RQKITVSSKQAFKRAY--------TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           R ++        +R                L        ++IP++ + FL+ +A S +  
Sbjct: 16  RLRLKSPGFSGLERELIDRARRFAEPASRRLARAEPVLKRSIPVLIIAFLLIVALSRMSG 75

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDL-ASQKKAESMLGQLLAKTRFLSES 129
           +   +A+ E  + +T  +   A    FQ +  +      + + E  L + L      +  
Sbjct: 76  IMDEHARMEASSRRTVSLAATAATAAFQADGSELFADGQRWETERRLAEYLPAELLDTGM 135

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
           F+L  + +  +FAS+   +H+IG+ +  I P+++  +   +      A++D   + V  +
Sbjct: 136 FLLTVRRDGRIFASTQDGAHFIGRTLTSIAPDIASLQYCGEGSGAIRATIDGVEHLVALM 195

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
            +P ++G +L           WR++V+L V  F+ ISA+LL +L++YY QAK+ ++ D++
Sbjct: 196 QVPASAGVVLAATPVAQFEAAWRDDVSLNVTLFAGISAILLVVLYAYYIQAKRARDADSV 255

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
             E+N+ VETALSRGRCGLW+F+  N++   SRSMYE++G+P ++  LSF   ARL+H +
Sbjct: 256 FAESNLRVETALSRGRCGLWDFDLANRRLFWSRSMYEMLGMPGDSSVLSFGDAARLMHPE 315

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
           ++ +  +AR++     +Q+DQ+F MRHA G  +W++ RAQ++RT+SG  ++IGIAMD+TE
Sbjct: 316 DRGVYRVARAIAKGSERQIDQVFRMRHADGHYVWLRARAQVIRTVSGKTHLIGIAMDVTE 375

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           ++ L +RYAEADQRL+ AIECTSEA VLWDK+DRLVMCN +YQ+AY LPDHVLVPG  R+
Sbjct: 376 QHRLAQRYAEADQRLTDAIECTSEAFVLWDKHDRLVMCNTHYQQAYQLPDHVLVPGTERA 435

Query: 430 IIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
           ++  A  RP++E R +DP+RS    + E++LAD RWLQIN+  T DGG +SVGTDITLLK
Sbjct: 436 VVHAAAARPVVERRVADPDRSNHSQTSEVQLADERWLQINDRRTRDGGLVSVGTDITLLK 495

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLA 548
            +Q +LRES+RRL ATI DLS SR  LERQK ELS+ANA YQ EKERAE AN+ KSEFLA
Sbjct: 496 RHQVRLRESERRLMATIGDLSASRITLERQKAELSVANANYQAEKERAEAANRAKSEFLA 555

Query: 549 KMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKI 608
            MSHELRTPLNAILGFSE+++ ++FG LGS KY EY++DIH SG+HLLN+IN+IL+MSKI
Sbjct: 556 NMSHELRTPLNAILGFSEILQNQMFGPLGSEKYDEYSRDIHESGKHLLNVINDILDMSKI 615

Query: 609 ETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPI 668
           E   + I ++  DL P+I E +R     A+ KNI++ ++I S L   AD+R +K++L  +
Sbjct: 616 EAGHMRITRERIDLAPLIEETLRFTTIPAEQKNIRVVQEISSGLTMFADRRAMKQVLLNL 675

Query: 669 LSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
           LSN++KFTN  G++ +R  K+   V +TIAD+GIGIP+ AL+KIG PFE + +QY +S G
Sbjct: 676 LSNAVKFTNEGGRISLRARKVRGAVTLTIADSGIGIPRYALQKIGHPFEQVQSQYAKSKG 735

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           G GLGLAIS +LT LHGGR+KI S E  GTI+++ +P
Sbjct: 736 GSGLGLAISRSLTRLHGGRMKIHSAEKVGTIISVRIP 772


>gi|116251211|ref|YP_767049.1| two component sensor histidine kinase transcriptional regulatory
           protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255859|emb|CAK06940.1| putative two component sensor histidine kinase transcriptional
           regulatory protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 769

 Score =  662 bits (1708), Expect = 0.0,   Method: Composition-based stats.
 Identities = 368/756 (48%), Positives = 513/756 (67%), Gaps = 7/756 (0%)

Query: 17  GNRQKITVSSKQAFKRAY------TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           G R ++     +A++ +         ++ +L        + IP + + FL  +A S    
Sbjct: 11  GGRLRVDFDGLKAWRDSLSGHATSEPLLRYLPKAELVLKRAIPALIVAFLSVVAASHFFG 70

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           + + Y + E      + +       +F +    FD      A++ L + L + R  S +F
Sbjct: 71  MMSEYGRLEASARHATALSAATASAVFADAADIFDSGDITGAQARLAKYLPQDRLDSGAF 130

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VFA++T    ++G  +G+  PE+S  R       + E ++   P++     
Sbjct: 131 VLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFGDRADVIETTIGGVPHYAEITL 190

Query: 191 LPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTIL 250
           + +  G I+   S   + RLWREE+ L V  F+ IS++LL IL++YY Q K+ ++ D I 
Sbjct: 191 MGNAGGYIVAATSLDEIDRLWREELALNVTLFAGISSILLVILYAYYTQVKRARDADDIF 250

Query: 251 LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
           LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++G+P  +KT+ F   ARL+H D+
Sbjct: 251 LESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDMLGLPGSDKTMGFGEAARLMHPDD 310

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEK 370
             + EIAR++      Q+DQIF MRHA G  +W++ RAQ++R+ SG M++IGIAMD+TE+
Sbjct: 311 GGLYEIARAIGKGSSGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRMHLIGIAMDVTEQ 370

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
           + L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RS 
Sbjct: 371 HRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQQAYGLPDSVLVPGTERST 430

Query: 431 IQDAQTRPIIEYRTSDPER-SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
           +  A  RP+IE R SD +      + E++LAD RWLQINE  T DGG +SVGTDITL+K 
Sbjct: 431 VNAAAARPVIERRISDADGSGYSRTTEVQLADERWLQINERRTRDGGRVSVGTDITLMKR 490

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
           +Q +LRES+RRL ATI DLS SRQ LE QK+ELS ANA YQ EKERAE ANK KSEFLA 
Sbjct: 491 HQERLRESERRLMATIGDLSASRQTLEIQKSELSTANANYQAEKERAEAANKAKSEFLAN 550

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           MSHELRTPLNAILGFSE+++ ++FG LGS+KY EYA+DIH SG+HLLN+IN+IL+MSKIE
Sbjct: 551 MSHELRTPLNAILGFSEILQNQMFGPLGSLKYDEYARDIHDSGKHLLNVINDILDMSKIE 610

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPIL 669
              + +  +  DL+P+I E +R     A  KNI IE++I S L   AD+R +K++L  +L
Sbjct: 611 AGHVRLHCERIDLVPLIEESLRFTAMPAAEKNIVIEQRICSGLTLMADRRAMKQVLLNLL 670

Query: 670 SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           SN++KFT+N G++ +RT ++   V +TIADTGIGIP+SAL KIGQPFE + +QY +S GG
Sbjct: 671 SNAVKFTDNGGRIALRTRRVDGAVFVTIADTGIGIPRSALSKIGQPFEQVQSQYAKSKGG 730

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GLGLAIS +LT+LHGGR+KI S+E  GT++++ +P
Sbjct: 731 SGLGLAISRSLTSLHGGRMKIRSREAVGTVISLRIP 766


>gi|254502393|ref|ZP_05114544.1| hypothetical protein SADFL11_2432 [Labrenzia alexandrii DFL-11]
 gi|222438464|gb|EEE45143.1| hypothetical protein SADFL11_2432 [Labrenzia alexandrii DFL-11]
          Length = 756

 Score =  661 bits (1706), Expect = 0.0,   Method: Composition-based stats.
 Identities = 245/743 (32%), Positives = 404/743 (54%), Gaps = 11/743 (1%)

Query: 34  YTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAI 93
            +S  +HL    S   + IP ++++FLVF+A     ++  ++         T  ++   +
Sbjct: 1   MSSAHNHLERSDSLMRRLIPALAILFLVFLAMYRTGELVGQHESARSDAETTLSLMASVV 60

Query: 94  EIIF-QNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
                 +         +   + +L   L           L++  N  + AS+       G
Sbjct: 61  AAPLNASGKDLPAAGYRTTLKRILADSLPTGATSKGRIFLISDTNGKIAASAPLQPSLEG 120

Query: 153 KKIGEIIPELSRSRSRSKTVQMS------EASLDQQPYHVLSVNLPHNSGSILIINSRVP 206
           + + +++          +   +             +P      +L    G I ++     
Sbjct: 121 RPLTDLLGPAQPLTVFGERAGVLSIPVNLTGRDGPEPVLATVRHLDGQLGMIAVVQPESV 180

Query: 207 LLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRC 266
           +   WR  ++  V  +  +S +LL I++ ++ QA + ++ D         ++TAL+ GRC
Sbjct: 181 VFADWRSALSANVTLYVGVSLVLLAIIYGFFSQASRAEQADENYAATRARIDTALTHGRC 240

Query: 267 GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK 326
           GL++++    +   S S+YE++G   ++  LSF  ++ L H D+  +  +A  +      
Sbjct: 241 GLFDWDLSRGRMFWSSSLYELLGREPKDDILSFSEVSDLTHPDDIDLLGLAEHLLESGET 300

Query: 327 QLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLS 385
            +D+ F MRHA G+ IW++ R ++         ++IGI +D+TE++ L ++   AD RL 
Sbjct: 301 LVDETFRMRHADGSWIWLRARGEIQVDPGRAEPHLIGICLDITEQHLLAEQSQMADLRLR 360

Query: 386 KAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR-SIIQDAQTRPIIEYRT 444
            AIE  SEA VLW+  + LV+CN+NYQ  + LP   + PG     ++  A+  P      
Sbjct: 361 DAIETISEAFVLWNTRNELVICNSNYQSLHNLPPSAVKPGTPYKDVLAAAENGPASPQPV 420

Query: 445 SDPERSQ--DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
              +R    + S E +L D RWLQI+E  T DGG +SVGTDIT LK ++ +L ES++RLK
Sbjct: 421 QLSKRQGGPEGSYEAQLEDGRWLQISERRTKDGGFVSVGTDITALKKHEERLTESEKRLK 480

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
           AT+ DL  SR+ILE Q  +LS    KYQ EK RAE AN+ KSEFLA +SHELRTPLNAI+
Sbjct: 481 ATVTDLQRSRKILEVQTRQLSEMAEKYQEEKTRAEAANQAKSEFLANISHELRTPLNAII 540

Query: 563 GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
           GFS+++ +E+FG LG+ +Y +Y +DI+ SG +LLN+IN+IL+MSKIE  ++SI+ +  + 
Sbjct: 541 GFSDIMTQEMFGPLGTDRYADYCKDIYSSGTYLLNVINDILDMSKIEAGRMSIETEVVNA 600

Query: 623 IPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKM 682
                +  R+I  +A  KNI I   +   L  + DKR +K++L  +L+N++KFT ++G +
Sbjct: 601 SEAAEDAARIITGAASEKNIVISADVADNLHVDVDKRALKQVLLNLLANAVKFTPDHGTV 660

Query: 683 MIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
            ++    G  V   + DTGIGI +  +E++ +PF  + NQ+ ++  G GLGLAI+ +L  
Sbjct: 661 TLKARPRGDKVRFEVTDTGIGISERDIERLAKPFVQVENQFTKTHQGSGLGLAIARSLVE 720

Query: 743 LHGGRLKIISQEGKGTIVTICMP 765
           LHGG+L I S+  KGT+V+  +P
Sbjct: 721 LHGGKLAIESEVKKGTVVSFSLP 743


>gi|240850171|ref|YP_002971564.1| two-component sensor histidine kinase [Bartonella grahamii as4aup]
 gi|240267294|gb|ACS50882.1| two-component sensor histidine kinase [Bartonella grahamii as4aup]
          Length = 773

 Score =  652 bits (1682), Expect = 0.0,   Method: Composition-based stats.
 Identities = 256/737 (34%), Positives = 415/737 (56%), Gaps = 11/737 (1%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
           S    L        +++P + + FL+ +A+   I +       +K T  T  +L   I  
Sbjct: 37  SAYQKLLFIEPWLRRSLPFVILAFLIVLASIRFISLYDWRNTIDKNTRSTITLLASHITN 96

Query: 96  IFQNNNI------KFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSH 149
              +N +      K    S    +++L     +      + I +      V ASS  +  
Sbjct: 97  TINHNLLAVSQKGKVSALSHSHLQNILTTFRNQDLINPSTLIAIIDQKGNVLASS-SSEI 155

Query: 150 YIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLR 209
            +GK + + I +    +S  + V + + ++ +    + S     N    + I+ ++    
Sbjct: 156 SLGKPLQDFISDSIALQSLGQHVGIMKITIGKDAPALASFQQTENGQYGVFISEKMQDSA 215

Query: 210 -LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
             WR+ ++L +  F   S ++L +L++YY Q  + ++ D +  +    ++ A+ RGRCGL
Sbjct: 216 MEWRKILSLNITLFIGTSGVILALLYAYYNQIVRARKTDLVSEKIQNRIDMAMMRGRCGL 275

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           W++N  + + + SR+MYE++G   ++  LS   I+ +I+ ++    ++A+ +     K +
Sbjct: 276 WDWNMASGRVYWSRAMYEMLGYVPQDALLSISQISAIINPNDANFFDLAQELMSGKKKHI 335

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
           D    MRHA G  +W+++RA++  T     +++GI+ D++E+  L ++ A+AD R+  AI
Sbjct: 336 DINVPMRHADGHYVWMRIRAEV--TEEEEPHLVGISFDISEQQQLAEQTAQADLRIRDAI 393

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
           E  SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ ++      I EY   D +
Sbjct: 394 ENISESFVLWDSEGRLVMSNSKFCEYAAIPKQILQSGIQRATVEAMARPAISEYPLKD-D 452

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
            + +++   + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L
Sbjct: 453 GTGNLTSIRQTADGCWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQEL 512

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             +R   +++ +E+   N   + EKERAE+ANK KSEFLA MSHELRTPLNAILGFS+++
Sbjct: 513 KRARGSAQQRASEVEKLNKSLKAEKERAESANKAKSEFLANMSHELRTPLNAILGFSDIM 572

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
            +  FG LGS +Y EY  DI+ SG HLL +IN+IL+MSKIE  + S+D +N DL PII+E
Sbjct: 573 LQSTFGPLGSQRYKEYMHDIYNSGTHLLTLINDILDMSKIEAGRFSLDCKNTDLEPIISE 632

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            +R +   AQ KNI +   I  EL    D R +K+I   ++SN++KFT + G + +   K
Sbjct: 633 AVRTLTPQAQEKNIVVTTNITPELHAEVDGRAMKQIFLNLISNAVKFTPSGGNIDVCAFK 692

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
               +I  I DTG+GIP+SA++K+GQPFE + NQ  +S  G GLGLAIS +L  LH G+L
Sbjct: 693 KKNNLIFKITDTGVGIPQSAIKKLGQPFEQVENQLTKSHTGSGLGLAISRSLLELHKGKL 752

Query: 749 KIISQEGKGTIVTICMP 765
           +I S+E KGT VTI MP
Sbjct: 753 EITSKEMKGTTVTIIMP 769


>gi|49474041|ref|YP_032083.1| two-component sensor histidine kinase [Bartonella quintana str.
           Toulouse]
 gi|49239545|emb|CAF25902.1| Two-component sensor histidine kinase [Bartonella quintana str.
           Toulouse]
          Length = 773

 Score =  651 bits (1680), Expect = 0.0,   Method: Composition-based stats.
 Identities = 256/737 (34%), Positives = 414/737 (56%), Gaps = 11/737 (1%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
           S             + IP I +VFLV +A    + +   Y   +K T  T  +L   I  
Sbjct: 37  SAYQKFLFIEPWLRRAIPFIIVVFLVVLAAIRFVSIHDWYRAIDKNTRSTITLLAAHISN 96

Query: 96  IFQNNNI------KFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSH 149
               + +      K    S    +++L     +    + + I +   N  V ASS  +  
Sbjct: 97  TIDRDLLAATQKGKAAALSHNHLQNILTNFRNQGLIKTSTVIAIVDQNGNVLASS-SSEI 155

Query: 150 YIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPL-L 208
            +GK + +   E +  +S S+   + + ++ +    +   +   N    + I+ ++    
Sbjct: 156 ILGKPLQDFTSESTALQSLSQHAGVMQITIKKNDPALALFHQTENGQYGVFISEKIQHTY 215

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
           + WR+   L +  F   + ++L +L++YY Q  + ++ D I  +    ++ A+ RGRCGL
Sbjct: 216 KEWRKIFLLNITLFIGTTGIILSLLYAYYHQIIRARKTDLISEKIQNRIDMAMMRGRCGL 275

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           W++N  + + + SR+MYE++G   ++  LS   I  +I  ++    ++A+ +     K +
Sbjct: 276 WDWNMASGRVYWSRAMYEMLGYVPQDALLSISQITGIISPNDANFFDLAQELMSGKKKHI 335

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
           D    MRHA G  +W+++RA++  T     +++GI+ D++E++   +  A+AD R+  AI
Sbjct: 336 DINVPMRHADGHYVWMRIRAEV--TDEEEPHLVGISFDISEQHQFAEETAQADLRIRDAI 393

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
           E  SE+ VLWD   RLVM N+ + +   +P  +L PG  R  ++      I EY   D +
Sbjct: 394 ENISESFVLWDSEGRLVMSNSKFCEYAAIPKQILQPGIQRETVEAMARPAINEYPLKD-D 452

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
            + +++   + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L
Sbjct: 453 GTGNLTSIRQTADGCWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQEL 512

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             +R   +++ TE+   N   + EKERAE+ANK KSEFLA MSHELRTPLNAILGFS+++
Sbjct: 513 KRARGNAQQRATEVEKLNKSLKAEKERAESANKAKSEFLANMSHELRTPLNAILGFSDIM 572

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
            +  FG LGS +Y EY +DI+ SG HLL +IN+IL+MSKIE  + ++D +N DL PII+E
Sbjct: 573 LQSTFGPLGSKRYKEYMRDIYNSGSHLLTLINDILDMSKIEAGRFTVDCKNIDLEPIISE 632

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            +R +   AQ KNI +   I ++L    D R IK+I   ++SN++KFT + G + +   K
Sbjct: 633 ALRTLIPQAQEKNIFVTTNIATKLHAEVDGRAIKQIFLNLISNAVKFTPSGGNIDVCALK 692

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
               ++  I DTG+GIP+SA++K+GQPFE + NQ  ++  G GLGLAIS +L  LH G+L
Sbjct: 693 KKNNLVFKIKDTGVGIPQSAIKKLGQPFEQVENQLTKTYTGSGLGLAISRSLLELHKGKL 752

Query: 749 KIISQEGKGTIVTICMP 765
           +IIS+E KGT VTI +P
Sbjct: 753 EIISKEMKGTTVTITIP 769


>gi|163867966|ref|YP_001609170.1| two-component sensor histidine kinase [Bartonella tribocorum CIP
           105476]
 gi|161017617|emb|CAK01175.1| two-component sensor histidine kinase [Bartonella tribocorum CIP
           105476]
          Length = 773

 Score =  651 bits (1679), Expect = 0.0,   Method: Composition-based stats.
 Identities = 252/737 (34%), Positives = 412/737 (55%), Gaps = 11/737 (1%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
           S    L        +++P + + FL+ +A    + +       +K T  T  +L   I  
Sbjct: 37  SAYQKLLFIEPWLRRSLPFVIVAFLIVLAVIRFVSIYDWRNTVDKSTRSTLTLLASHITN 96

Query: 96  IFQNNNI------KFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSH 149
               + +      K    S    + +L     +      + I +      V ASS  +  
Sbjct: 97  TIDRDLLALSQKGKVSALSHSHLQDILATFRNQDLINPSALIAIVDQKGHVLASS-SSEI 155

Query: 150 YIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLR 209
            +GK + + I +    +S  +   + + ++ +    + S +   N    + I+ ++    
Sbjct: 156 VLGKPLQDFISDSIALQSLGQRAGIMKITIGKDTPALASFHQTENGQYGVFISEKMQDSA 215

Query: 210 -LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
             WR+  +L +  F   S ++L +L++YY Q  + ++ D +  +    ++ A+ RGRCGL
Sbjct: 216 MEWRKFFSLNITLFIGTSGIILVLLYAYYNQLLRARKTDLVSEKFQNRIDMAMMRGRCGL 275

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           W++N  + + + SR+MYE++G   ++  LS   I+ +I+ ++    ++A+ + G   K +
Sbjct: 276 WDWNMASGRVYWSRAMYEMLGYVPQDALLSISQISAIINPNDANFFDLAQELMGGKKKHI 335

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
           D    MRHA G  +W+++RA++  T     +++GI+ D++E+  L ++ A+AD R+  AI
Sbjct: 336 DINVPMRHADGHYVWMRLRAEV--TEEEEPHLVGISFDISEQQQLAEQTAQADLRIRDAI 393

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
           E  SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ ++      + EY   D +
Sbjct: 394 ENISESFVLWDAEGRLVMSNSKFCEYAAIPKQILQSGIQRATVEAMARPALSEYPLKD-D 452

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
            + +++   + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L
Sbjct: 453 GTGNLTSIRQTADGYWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQEL 512

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             +R   +++ TE+   N   + EKERAE+ANK KSEFLA MSHELRTPLNAILGFS+++
Sbjct: 513 KRTRGSAQQRATEVEKLNKSLKAEKERAESANKAKSEFLANMSHELRTPLNAILGFSDIM 572

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
            +  FG LGS +Y EY  DI+ SG HLL +IN+IL+MSKIE  + ++D +N DL PII+E
Sbjct: 573 LQSTFGPLGSQRYKEYMHDIYNSGTHLLTLINDILDMSKIEAGRFTLDCKNTDLEPIISE 632

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            +R +   AQ KNI +   I  +L    D R +K+I   ++SN++KFT + G + +   K
Sbjct: 633 AVRTLTPQAQEKNIAVTTNITPKLHAEVDGRAMKQIFLNLISNAVKFTPSGGNIDVCAFK 692

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
               +I  I DTG+GIP+SA++K+GQPFE + NQ  +S  G GLGLAIS +L  LH G+L
Sbjct: 693 KKNNLIFKITDTGVGIPQSAIKKLGQPFEQVENQLTKSHTGSGLGLAISRSLLELHKGKL 752

Query: 749 KIISQEGKGTIVTICMP 765
           +I S+E KGT VTI MP
Sbjct: 753 EITSKEMKGTTVTIIMP 769


>gi|158424746|ref|YP_001526038.1| PAS protein [Azorhizobium caulinodans ORS 571]
 gi|158331635|dbj|BAF89120.1| PAS protein [Azorhizobium caulinodans ORS 571]
          Length = 763

 Score =  650 bits (1677), Expect = 0.0,   Method: Composition-based stats.
 Identities = 256/741 (34%), Positives = 411/741 (55%), Gaps = 9/741 (1%)

Query: 29  AFKRAY-TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSL 87
              R+        L        + +P + + FLV +   ++++V T + Q      +  L
Sbjct: 18  GLARSVARPAYQRLLEAEPFLRRIVPALIITFLVVLGIGALVQVHT-HRQSVLDNAKDDL 76

Query: 88  MLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKN 147
            L         N+ +   LA+   A   L   L          I +  P+  V A++ ++
Sbjct: 77  ALQALATAEGLNHRLNGSLANTGSA---LLAALPPRATSGGRRIYVTDPSGRVIAAAPES 133

Query: 148 SHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPL 207
           +  +   + +++         ++   + E ++          NL    G I+ +      
Sbjct: 134 APRV-TSLADLMDPSQPLTVFAERAGVLEIAVGDTQMLATVRNLNPPLGQIVYLQPMNRA 192

Query: 208 LRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCG 267
           L +W +  TL +  F+   A+LL + FS++ QA + +E D I     + ++TAL+RGRCG
Sbjct: 193 LAVWSDSTTLTITLFATTGAVLLILGFSFHWQASRAREADHIYDTVRMRIDTALNRGRCG 252

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ 327
           +W+++    + + S +M+EI+G+   ++ LSF  IA+L+H D+  + E+A+ +  +    
Sbjct: 253 MWDWDMARGRMYWSDTMFEILGLERRDELLSFGEIAKLVHPDDGNLYELAQELAERPGAS 312

Query: 328 LDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
           +D++F MR A G  +W+++RA++++     G ++IGIAMD+TE   L +R   AD RL  
Sbjct: 313 VDRVFRMRTARGDFVWLRMRAEVVQQAGEDGPHLIGIAMDVTEAQRLAERTVTADMRLRD 372

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
           AIE  SEA VLWD  +RLV+CN+ +Q  + LPD  +V G     I      P+       
Sbjct: 373 AIESISEAFVLWDSQNRLVLCNSKFQTLHELPDDAIVAGTPFETIATVGRHPVTRTPLKP 432

Query: 447 PE--RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKAT 504
            +       + E +L++ RWL+I E  T DGG +SVGTDIT LK ++ +L ++++RL A 
Sbjct: 433 EDKPEEGSRAFEAQLSNGRWLKIAERRTKDGGYVSVGTDITPLKRHEERLMDNEKRLMAL 492

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
           + DL  S+Q LE Q  +L+    KY  EK RAE AN+ KSEFLA MSHELRTPLNAI+GF
Sbjct: 493 VADLRKSQQTLEHQAQQLAELAEKYSEEKTRAEDANRAKSEFLANMSHELRTPLNAIIGF 552

Query: 565 SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIP 624
           SE+++  +FG LGS KY EY  DI  SG +LL++IN+IL+MSKIE  ++ ++ ++  L  
Sbjct: 553 SEIMESGMFGPLGSDKYREYCSDIKGSGTYLLDVINDILDMSKIEAGRMQLELEDIRLDE 612

Query: 625 IINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI 684
           II + +R+       K + +  ++ +      D+R +K+IL  +LSN++KFT   G + +
Sbjct: 613 IIADAMRVTAVKGDEKQLDMTAQVGAGQVMRGDRRALKQILLNLLSNAVKFTPEGGHVAV 672

Query: 685 RTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
           R    G   +I I DTGIGIP+ AL KIG+PFE + +Q+ ++  G GLGLAI+ +L  LH
Sbjct: 673 RAKVNGGAAVIAIEDTGIGIPRHALNKIGRPFEQVESQFTKTHKGSGLGLAIAKSLAELH 732

Query: 745 GGRLKIISQEGKGTIVTICMP 765
           GG ++I S EG GT V + +P
Sbjct: 733 GGSMRIRSTEGAGTTVVVRLP 753


>gi|15888325|ref|NP_354006.1| two component sensor kinase [Agrobacterium tumefaciens str. C58]
 gi|15155995|gb|AAK86791.1| two component sensor kinase [Agrobacterium tumefaciens str. C58]
          Length = 778

 Score =  650 bits (1676), Expect = 0.0,   Method: Composition-based stats.
 Identities = 342/728 (46%), Positives = 491/728 (67%), Gaps = 3/728 (0%)

Query: 41  LFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNN 100
           +    +   + IP++ + FLV +A S ++ +   Y + E+    ++ +     +    NN
Sbjct: 43  MPQVETLLKRLIPILILAFLVVVAASRMLGIAAEYGRMEEAARHSTALTALTAKAALLNN 102

Query: 101 NIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYI-GKKIGEII 159
           +  F    + +AE+ L   L        + +LL+  N  +FA + K +    G  +  ++
Sbjct: 103 DTIFTAQDRTRAEASLVAALPSGSLADGTMVLLSGSNGRIFAGAGKEASLYVGTSLPALL 162

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
           PE++  +    T    E ++D Q ++   +    +   ++   S  P+   WR E+ + V
Sbjct: 163 PEIAIVQRFPGTPGTIETNIDGQQHYATMIPFGDDGAMVIAARSLQPIRSFWRSEIAMNV 222

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
             F+ IS++LL +L++YY Q K+ ++ D I  E+N+ VETALSRGRCGLW+F+  +++  
Sbjct: 223 TLFAGISSILLVVLYAYYMQVKRARDADDIFAESNLRVETALSRGRCGLWDFDLSSRRMF 282

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASG 339
            S S+YEI+G+P +   LSF   AR++H ++  + E+AR+V   +++Q+DQIF MRH+ G
Sbjct: 283 WSGSLYEILGLPPKAAPLSFSDAARMMHSEDGNLYELARAVGCGNLRQIDQIFRMRHSKG 342

Query: 340 ADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWD 399
             +W++ RAQ++RT +G   +IGIAMD+TE++ L +RYAEADQRL+ AIE TSEA VLWD
Sbjct: 343 HYVWLRARAQVIRTNNGP-RVIGIAMDVTEQHRLAQRYAEADQRLADAIESTSEAFVLWD 401

Query: 400 KNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ-DMSKEIK 458
           KNDRLVMCN +YQKAYGLPD VLV G  +S +  A  RP++E R +DP++S    + E++
Sbjct: 402 KNDRLVMCNIHYQKAYGLPDSVLVAGTEKSTVYAAAARPVVERRVADPDQSGLSRTTEVQ 461

Query: 459 LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
           LAD RWLQINE  T DGG +SVGTDITLLK +Q +LR+S+RRL ATI DLS S+  LERQ
Sbjct: 462 LADDRWLQINERRTRDGGLVSVGTDITLLKRHQERLRDSERRLMATIGDLSASQHKLERQ 521

Query: 519 KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
           KTELS ANA Y  EKERA+ AN+ KSEFLA MSHELRTPLNAILGFSE+++ E+FG +GS
Sbjct: 522 KTELSDANANYLAEKERAQAANRAKSEFLANMSHELRTPLNAILGFSEILQNEMFGPVGS 581

Query: 579 VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
            KY EYA+DIH SG+HLLN+IN+IL+MSKIE   + I+++  DL P+I E +RL    A+
Sbjct: 582 PKYSEYARDIHDSGKHLLNVINDILDMSKIEAGHMRINRETIDLAPLIEETLRLTAIQAE 641

Query: 639 SKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIA 698
            KNI +++K+ + L    D+R +K+I+  ILSN++KFT + G++ +RT      +I+TIA
Sbjct: 642 QKNITVQQKVCAGLTMQGDRRAMKQIMLNILSNAVKFTGDGGRIALRTHVHEAAMILTIA 701

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           DTGIGIP  AL+KIGQPFE + +QY +S GG GLGLAIS +L  LHGG +KI S EG+GT
Sbjct: 702 DTGIGIPAQALQKIGQPFEQVQSQYAKSQGGSGLGLAISRSLVKLHGGTMKIRSCEGRGT 761

Query: 759 IVTICMPQ 766
           +VTI +P 
Sbjct: 762 VVTIIIPH 769


>gi|163759100|ref|ZP_02166186.1| putative sensor histidine kinase transmembrane protein [Hoeflea
           phototrophica DFL-43]
 gi|162283504|gb|EDQ33789.1| putative sensor histidine kinase transmembrane protein [Hoeflea
           phototrophica DFL-43]
          Length = 795

 Score =  648 bits (1672), Expect = 0.0,   Method: Composition-based stats.
 Identities = 314/769 (40%), Positives = 475/769 (61%), Gaps = 4/769 (0%)

Query: 1   MENMQNILANYG---LYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISM 57
           M + Q+I A  G   +  PG R+          K         L +      + IP++ +
Sbjct: 1   MADAQSISAAEGSSHVQKPGARRSSGRQLSGHAKLFAQPAYDGLINAEPFLKRLIPVLIV 60

Query: 58  VFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLG 117
            FL+ +AT+  + +     Q      Q + +   A       +        + + E+ L 
Sbjct: 61  AFLLVVATARFLNINENRDQLFSAAEQMTALSLAAASAALSIDTDPVAKKLRWETEARLN 120

Query: 118 QLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEA 177
           + L         ++L+      +FA++   +H +G  +  ++ E S      +   +   
Sbjct: 121 RALGAMPEDQGRYLLVIDAEARIFAATAGGNHLVGTVLSSLLSESSPLWLFGERAGVQSI 180

Query: 178 SLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYY 237
             D +        LP  +G++L +     +   WR+ V++ V  F   S++LL IL++Y+
Sbjct: 181 RFDGEDSLAALTRLPDGAGALLSLTPVKTMNDAWRQSVSVNVTLFIATSSILLVILYAYF 240

Query: 238 RQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTL 297
            QA + +E D+I  E+   V+ ALSRGRCGLW+++    + + SRSMYEI+G+   +  +
Sbjct: 241 SQAGRAQEADSIYHESQRRVDMALSRGRCGLWDWDMARGRLYWSRSMYEILGLKPRDTVI 300

Query: 298 SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG 357
           SF   ++L+H D+  + EIAR V    +KQ+D +F MRHA+G  +W++ RAQ++   S  
Sbjct: 301 SFGEASQLVHPDDGDLYEIARKVASGDIKQVDHLFRMRHANGHYLWMRARAQVVDPTSAE 360

Query: 358 MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL 417
            ++IGIAMD+TE++ L++R  EADQRL  AIE TSEA VLWD+++RLV+ N +YQ+ +GL
Sbjct: 361 THLIGIAMDVTEQHRLQQRTMEADQRLFDAIESTSEAFVLWDRDERLVLWNKHYQEIHGL 420

Query: 418 PDHVLVPGNARSIIQDAQTRPIIEYRTSDP-ERSQDMSKEIKLADSRWLQINEWCTHDGG 476
           P  +L PG  R +++ A TRP++E R + P  R    + E++L D RWLQINE  T DGG
Sbjct: 421 PADILAPGTPRPVVEKAATRPVVERRLAVPCARDSAQTFEVQLGDGRWLQINERKTRDGG 480

Query: 477 TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERA 536
            +SVGTDIT LK NQ +LR+S++RL ATI DL++S+  L+R+  ELS  N  YQVE ERA
Sbjct: 481 LVSVGTDITPLKRNQERLRDSEKRLMATIGDLTSSQAELKRKAAELSELNMDYQVETERA 540

Query: 537 ETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLL 596
           E A++ KSEFLA MSHELRTPLNAI+GFSEV++  +FG LGS KY EYA DIH SG HLL
Sbjct: 541 EAASRAKSEFLANMSHELRTPLNAIIGFSEVLQARMFGPLGSDKYGEYADDIHNSGIHLL 600

Query: 597 NMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNA 656
            +IN+IL+M+KIE  ++ +++++ DL P++ E +RL+   A+ K+I+++++I ++L  NA
Sbjct: 601 TVINDILDMAKIEAGQMQLEREDVDLAPLLKETLRLVAIQAEQKDIRVDQRISAKLSLNA 660

Query: 657 DKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPF 716
           D+R +K+IL  +LSN++KFT   GK+++R  K    V +TI DTGIGIPK+ L +IGQPF
Sbjct: 661 DRRAMKQILLNLLSNAVKFTEPGGKILVRARKTSCAVTLTIEDTGIGIPKALLNRIGQPF 720

Query: 717 EPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           E + NQ+ +S GG GLGLAIS +L  LHGG +K+ S EG GTIV++ +P
Sbjct: 721 EQVQNQFSKSTGGSGLGLAISRSLAELHGGAMKVRSIEGMGTIVSVRVP 769


>gi|153009989|ref|YP_001371204.1| multi-sensor signal transduction histidine kinase [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561877|gb|ABS15375.1| multi-sensor signal transduction histidine kinase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 784

 Score =  648 bits (1672), Expect = 0.0,   Method: Composition-based stats.
 Identities = 272/734 (37%), Positives = 423/734 (57%), Gaps = 6/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
                  S      + +P + ++FL+ +  + +  +       E+         T  +  
Sbjct: 36  PAYGKFISIEPILRRLVPALIIIFLIILGVARVFSMLAWREDIEQQHKAFLSAATANLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      D  +Q   K  +  + +  ++    S   + +  P   V A S   S   G
Sbjct: 96  MIERVANGTDAGAQIAAKDIQDTIAEFRSRGLSSSGMTLAVIDPQSSVVAISGPISDLSG 155

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
           K +  I+ E       ++   + +  L  +P             S++ +     +   WR
Sbjct: 156 KPVDTILTEAQPLFLFAERAGVLKVMLQGEPAFGALSKPMTLPYSVIAVEPESTIFAEWR 215

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+  + ++  IL++Y+ QA + +E D +  +    ++ AL RGRCGLW+++
Sbjct: 216 RAVSLNVTLFAGTTGVMFAILYAYFSQAARAREADDLSGQIQRRIDLALGRGRCGLWDWD 275

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 276 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINTEDGDLYSIAEQAAAGDISHVDRVF 335

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 336 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 393

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA +LWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 394 EAFILWDSNNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 453

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL ATI+DLS +
Sbjct: 454 GQTFERQLSDGRWLQVNERRTQDGGLVSIGTDITQLKLHQERLVDSERRLMATIHDLSIA 513

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY  EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 514 RKGERDRVRELSELARKYGQEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 573

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 574 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREQIDLCPLINETVR 633

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A  KNI +  +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 634 MISLQADEKNIAVNTRIEEAMQLYADRRAIKQVLINLLSNAVKFTSYGGQITVRARKTGS 693

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSA++KIGQPFE + NQ+ ++  G GLGLAI+ +L  LHGG L+I 
Sbjct: 694 ALFMTIQDTGVGIPKSAIKKIGQPFEQVENQFTKTHTGSGLGLAITRSLAELHGGWLRIR 753

Query: 752 SQEGKGTIVTICMP 765
           S EG GT+V++C+P
Sbjct: 754 STEGVGTVVSVCIP 767


>gi|239831458|ref|ZP_04679787.1| PAS domain S-box-containing protein [Ochrobactrum intermedium LMG
           3301]
 gi|239823725|gb|EEQ95293.1| PAS domain S-box-containing protein [Ochrobactrum intermedium LMG
           3301]
          Length = 783

 Score =  647 bits (1670), Expect = 0.0,   Method: Composition-based stats.
 Identities = 269/734 (36%), Positives = 423/734 (57%), Gaps = 6/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
                  S      + +P + ++FL+ +  + +  +       E+         T  +  
Sbjct: 36  PAYGKFVSIEPILRRLVPALIIIFLIILGVARVFSMLAWRDDIEQQHKAFLSAATANLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      D  +Q   K  +  + +  ++        + +      V A+S       G
Sbjct: 96  MIERAANGTDAGAQLSAKDIQDTMAEFRSRGLSSPGMTLAVIDGQSSVVAASGPGPDISG 155

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
           K +  I+ +       ++   + + +L  +P             SI+ +     +   WR
Sbjct: 156 KPLDTILSDAQPLFLFAERAGVLKVTLQAEPAFGALSKPLSLPYSIIAVEPESTIFAEWR 215

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+  + ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 216 RAVSLNVTLFAGTTGVMFAILYAYFSQAARAREADDLSGQIQRRIDLALARGRCGLWDWD 275

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 276 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINTEDGDLYSIAEQAAAGDISHVDRVF 335

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 336 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 393

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA +LWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 394 EAFILWDSNNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 453

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL ATI+DLS +
Sbjct: 454 GQTFERQLSDGRWLQVNERRTQDGGLVSIGTDITQLKLHQERLVDSERRLMATIHDLSIA 513

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY  EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 514 RKGERDRVRELSELARKYGQEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 573

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 574 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 633

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A  KNI +  +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 634 MISLQADEKNIAVNTRIEDAMQLYADRRAIKQVLINLLSNAVKFTSYGGQITVRARKTGS 693

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSA++KIGQPFE + NQ+ ++  G GLGLAI+ +L  LHGG L+I 
Sbjct: 694 ALFMTIQDTGVGIPKSAIKKIGQPFEQVENQFTKTHTGSGLGLAITRSLAELHGGWLRIR 753

Query: 752 SQEGKGTIVTICMP 765
           S EG GT+V++C+P
Sbjct: 754 STEGVGTVVSVCIP 767


>gi|222148029|ref|YP_002548986.1| two component sensor kinase [Agrobacterium vitis S4]
 gi|221735017|gb|ACM35980.1| two component sensor kinase [Agrobacterium vitis S4]
          Length = 790

 Score =  645 bits (1665), Expect = 0.0,   Method: Composition-based stats.
 Identities = 352/757 (46%), Positives = 494/757 (65%), Gaps = 9/757 (1%)

Query: 18  NRQKITVSSKQAF--------KRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSII 69
           +R +       +F          AY      + +  ++  Q IP++ + FL+ IA +  +
Sbjct: 12  DRLRPEFPGYLSFLDAVKNHGGVAYVVRSLSISNTDAALRQVIPILVVAFLIVIAMARGM 71

Query: 70  KVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSES 129
            + + YA+ E     ++ M+  A      +         + KAE+++ + L       ES
Sbjct: 72  GLVSEYARMESAIRHSTAMMASAAAAALSSGPELPAELGRDKAEALIKRFLPPNLLDDES 131

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
           F+LL  P   V ASS   S ++G +I  + P+++  R+        E  ++   +  +  
Sbjct: 132 FVLLLDPEGRVVASSGNGSSFVGMQIMALFPQVAVLRNFGDQTGAVETDINGFRHIAVLT 191

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
               +   +L  +S       WR E+ L V  FS IS +L+ IL++Y+ QAK+ +E   +
Sbjct: 192 PTGTDGALVLAAHSLKSAADYWRAELALNVTLFSAISLILMGILYAYFAQAKRARETSDV 251

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
            +++N  VETALSRGRCGLW+F+  ++K   SRSM++I+G+P  N+ L F   ARL+H D
Sbjct: 252 FVDSNRRVETALSRGRCGLWDFDLASRKLVWSRSMFDILGLPPSNEPLGFADAARLMHPD 311

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
           +  +  +AR++     + +DQ+F MRHA+G  +W++ RAQ++RT SG  ++IGIAMD+TE
Sbjct: 312 DGNLYALARTIGRDGDRHIDQVFRMRHANGHYVWLRARAQVIRTSSGSPHVIGIAMDVTE 371

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           ++ L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCNA++Q  YGLPD VLVPG  R+
Sbjct: 372 QHRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNAHFQHVYGLPDSVLVPGVERA 431

Query: 430 IIQDAQTRPIIEYRTSDP-ERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
           ++  A  RPII+ R +DP  +    + E++LAD RWLQINE  T DGG +SVGTDITLLK
Sbjct: 432 VVDAAAARPIIQRRIADPSAKGSSRTTELQLADERWLQINERRTRDGGLVSVGTDITLLK 491

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLA 548
            +Q +LRE +RRL ATI DLS+S++ LERQK ELS AN KY  EK+RAE ANK KSEFLA
Sbjct: 492 RHQERLREQERRLMATIGDLSSSQKKLERQKAELSEANEKYLAEKQRAEAANKAKSEFLA 551

Query: 549 KMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKI 608
            MSHELRTPLNAILGFSE++   +FG +GS KY EYA+DIH SG+HLLN+IN+IL+MSKI
Sbjct: 552 NMSHELRTPLNAILGFSEILSTGMFGPIGSPKYGEYARDIHDSGKHLLNVINDILDMSKI 611

Query: 609 ETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPI 668
           E   + +  +N D   +I+E +RL   SA+ KNI IE++I S L   AD+R +K+IL  I
Sbjct: 612 EAGHMLLKCENVDFASLIDETLRLTTISAKDKNIAIEQRIASGLAMTADRRALKQILLNI 671

Query: 669 LSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
           LSN++KFTN  G++ +R  KI   V + ++DTGIGIPK A+ KIGQPFE + +QY +S G
Sbjct: 672 LSNAVKFTNEGGRISVRAHKIDGAVRLLVSDTGIGIPKQAISKIGQPFEQVQSQYAKSKG 731

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           G GLGLAIS +L  LHGG L+I S+EGKGT+V+I +P
Sbjct: 732 GSGLGLAISRSLIMLHGGSLRIRSREGKGTVVSINVP 768


>gi|85715377|ref|ZP_01046359.1| Signal transduction histidine kinase [Nitrobacter sp. Nb-311A]
 gi|85697798|gb|EAQ35673.1| Signal transduction histidine kinase [Nitrobacter sp. Nb-311A]
          Length = 788

 Score =  644 bits (1661), Expect = 0.0,   Method: Composition-based stats.
 Identities = 253/753 (33%), Positives = 429/753 (56%), Gaps = 11/753 (1%)

Query: 22  ITVSSKQAFKRAY-TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEK 80
           +   S +   ++        L +      + +P + + FLV I   ++++V  +  Q++ 
Sbjct: 11  VQSDSIKGLAQSIAKPAYRRLLTAEPVLRRAVPALIIAFLVTICVGALVQVIDQTRQKQA 70

Query: 81  MTNQTSLMLTEAIEIIFQNNNIKFDL--ASQKKAESMLGQLLAKTRFLSESFILLAQPNE 138
           MT    L L + +    ++  + +    AS ++ +++L +L+      +   I++   ++
Sbjct: 71  MTKHDLLALADLLAERLEHAGVVYQDRPASIERFQNLLPKLIPSWGVAAGRHIIVTGADQ 130

Query: 139 LVFASST-KNSHYIGKKIGEIIP--ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNS 195
            V A      +     +I E+I   +       S         LD      +   +    
Sbjct: 131 RVLARIPIGITSSESSRILELIGITQSPALHGMSPASVADIVLLDGSGALAVQRAIRSLL 190

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI 255
           G + +I        +WR +  L +   +    ++L + F+++ Q+ + +E D I      
Sbjct: 191 GQVTVIQEAD---AVWRPDTALSITLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRG 247

Query: 256 CVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE 315
            ++TAL+RGRCGLW+++    +   S+SM+ ++G+   +  L+F  ++ L++ ++  + E
Sbjct: 248 RIDTALNRGRCGLWDWDLSRGRIFWSQSMFTLLGLESRSDLLAFGEVSSLVNSEDIDLFE 307

Query: 316 IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEK 375
           IA  +    +  +DQ F MRH+SG  IW++VR ++ +  SGG ++IGIA+D+TE+  L +
Sbjct: 308 IADELISGKIDHIDQSFRMRHSSGHWIWLRVRCELSQNASGGAHLIGIAVDVTEQKSLAE 367

Query: 376 RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQ 435
           +  EAD RL  AIE   EA VLWD +DRLV+CN+++Q+ + LPD  +V G     + +  
Sbjct: 368 KSVEADLRLRDAIESIPEAFVLWDADDRLVLCNSHFQRLHKLPDSAVVVGTPYETVVEVG 427

Query: 436 TRPIIEYRTSDPER--SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
             P I  R  +     S+  + +++LAD  WL I+E  T DGG +SVGTDIT +K ++ +
Sbjct: 428 RMPEIRARQPETGTVTSEAHTFDVQLADGNWLHISERRTKDGGYVSVGTDITRIKEHEQK 487

Query: 494 LRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
           L E+  RL+AT+ DL  ++  LERQ  +L+    KY  +K RAE AN+ KS+FLA MSHE
Sbjct: 488 LVENDLRLRATVIDLKRTQATLERQALKLADLAQKYADQKNRAEDANRAKSKFLANMSHE 547

Query: 554 LRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKI 613
           LRTPLNAI+GFSE++   +FG LGS KY EY +DI  SGQ+LL +IN++L+MSKIE  ++
Sbjct: 548 LRTPLNAIIGFSEIMSNGMFGTLGSKKYSEYCRDILTSGQYLLEVINDVLDMSKIEAGRM 607

Query: 614 SIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSI 673
           ++D +  DL  +++E +R++      K++  + +    +   AD+R +K+IL  +LSN+I
Sbjct: 608 NLDMEAFDLTGVLDESLRVVSGRTSDKSLTFDLRNNDGISIVADRRAVKQILVNLLSNAI 667

Query: 674 KFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLG 733
           KFT + G++M R+      + +TIADTGIGI   AL K+G+PFE + +Q  ++  G GLG
Sbjct: 668 KFTPDGGRIMARSKIFENFITLTIADTGIGIASHALRKLGKPFEQVESQLTKTHAGSGLG 727

Query: 734 LAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           LAI+ +L NLH G +K+ S+ G GT+V + +P+
Sbjct: 728 LAIAKSLVNLHNGSMKLRSKPGVGTVVRVTLPR 760


>gi|49475278|ref|YP_033319.1| two-component sensor histidine kinase [Bartonella henselae str.
           Houston-1]
 gi|49238084|emb|CAF27291.1| Two-component sensor histidine kinase [Bartonella henselae str.
           Houston-1]
          Length = 773

 Score =  643 bits (1659), Expect = 0.0,   Method: Composition-based stats.
 Identities = 258/739 (34%), Positives = 416/739 (56%), Gaps = 11/739 (1%)

Query: 34  YTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAI 93
           + S    L        +++P + +VFLV +A    + +       +K T  T  +L   I
Sbjct: 35  FDSSYQKLLFIEPWLRRSLPFVIVVFLVVLAAIRFVSIYDLRHTIDKNTRSTITLLAAHI 94

Query: 94  EIIFQNNNIKFD------LASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKN 147
                 + +           S    +++L     +    + + I +      + ASS+  
Sbjct: 95  ANTIDRDLLAATQKGKAIALSHTYLQNILSNFQNQGLIKTGTVIAIVDQKGNILASSSP- 153

Query: 148 SHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVP- 206
              +GK + + I E    RS  K   + + ++ +    + S +   N    + I+ +   
Sbjct: 154 EIILGKPLQDFISESIALRSLRKHAGIMKVTIGKDAPALASFHQTENGKYGVFISEKTQE 213

Query: 207 LLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRC 266
           + R WR+  +L +        ++L +L++YY Q  + ++ D+I  +    ++ A+ RGRC
Sbjct: 214 IYREWRKIFSLNITLLIGTGGVILALLYAYYNQIVRARKTDSISEKIQNRIDMAMMRGRC 273

Query: 267 GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK 326
           GLW++N  + + + SR+MYE++G   ++  LS   I  +I+ ++    ++A+ +     K
Sbjct: 274 GLWDWNMASGRVYWSRAMYEMLGYIPQDALLSISQITAIINPNDANFFDLAQELMSGKKK 333

Query: 327 QLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
            +D    MRHA G  +W+++RA++  T    ++++GIA D++E+  L +  A+AD R+  
Sbjct: 334 HIDINVPMRHADGHYVWMRIRAEV--TDEEELHLVGIAFDISEQRQLAEETAQADLRIRD 391

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
           AIE  SE+ VLWD   RLVM N+ + +   +P  VL PG  R+ ++      I EY   D
Sbjct: 392 AIENISESFVLWDSEGRLVMSNSKFCEYAAIPKQVLQPGIQRATVEAMARPAINEYPLKD 451

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
            + + +++   + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I 
Sbjct: 452 -DGTGNLTSIRQTADGCWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQ 510

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           +L  +R   +++ TE+   N   + EKERAE+ANK KSEFLA MSHELRTPLNAILGFS+
Sbjct: 511 ELKRARGNAQQRATEVEKLNKSLKAEKERAESANKAKSEFLANMSHELRTPLNAILGFSD 570

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           ++ +  FG LGS +Y EY  DI+ SG HLL +IN+IL+MSKIE  + ++D++N DL PII
Sbjct: 571 IMLQSTFGPLGSQRYQEYMHDIYNSGNHLLTLINDILDMSKIEAGRFTLDRKNIDLEPII 630

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
           +E +R +   AQ KNI +   I  EL    D R +K+I   ++SN++KFT + G + +  
Sbjct: 631 SEAVRTLTPQAQEKNISVSTNIAPELHAEVDGRAMKQIFLNLISNAVKFTPSGGSINVCA 690

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            K    ++  I DTG+GIP+SA++K+GQPFE + NQ  ++  G GLGLAIS +L  LH G
Sbjct: 691 FKKKNNLVCRIKDTGVGIPQSAIKKLGQPFEQVENQLTKTHTGSGLGLAISRSLLELHKG 750

Query: 747 RLKIISQEGKGTIVTICMP 765
           +L+IIS+E KGT VTI MP
Sbjct: 751 KLEIISKEMKGTTVTITMP 769


>gi|222085322|ref|YP_002543852.1| two-component sensor histidine kinase protein [Agrobacterium
           radiobacter K84]
 gi|221722770|gb|ACM25926.1| two-component sensor histidine kinase protein [Agrobacterium
           radiobacter K84]
          Length = 771

 Score =  642 bits (1656), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/756 (49%), Positives = 503/756 (66%), Gaps = 9/756 (1%)

Query: 19  RQKITVSSKQAFKRAYTS--------IISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           R ++     +++              I            + IP++ + FL+ +A S    
Sbjct: 13  RLRVNFDGLKSWHSGVNDRAGVRAETISRRFPQTEHILKRVIPVLIVSFLMVVAASHFFS 72

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           + T + +      Q + +   A    F N+   F    + +AE  L   L + R    +F
Sbjct: 73  MVTEHGRMAASARQATSLSIAAAAAAFSNDASLFRAGDRDEAERKLSTYLPQDRLDPGAF 132

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VF SS   S+YIG  I +  PE+S  RS      + E  +D  PY+     
Sbjct: 133 VLLVQASGRVFGSSAAGSNYIGLTISDFFPEVSAIRSFGDHAGVIETMIDGAPYYAAISL 192

Query: 191 LPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTIL 250
           +      +L   S   + +LWR+E+TL V  F+ IS++LL IL++YY Q K+ ++ D I 
Sbjct: 193 IGDKGDFVLSAASMEQIDKLWRDELTLNVTLFAGISSILLVILYAYYTQVKRTRDADEIF 252

Query: 251 LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
           LE+N+ VETALSRGRCGLW+F+F +++F  SRSMY+++G+P  ++ LSF    RL+H D+
Sbjct: 253 LESNMRVETALSRGRCGLWDFDFASREFFWSRSMYDMLGLPAADRPLSFADAERLMHPDD 312

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEK 370
             +  +ARS+T  +  Q+DQI  +RHA G  +W++ RAQ++RT SG +++IGIAMD+TE+
Sbjct: 313 NSLHTLARSITRGNAGQVDQILRIRHAKGHYVWMRARAQVIRTNSGRVHMIGIAMDVTEQ 372

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
           + L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLP+ VLVPG  R++
Sbjct: 373 HRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNDHFQQAYGLPNGVLVPGTERAV 432

Query: 431 IQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
           +  A  RPIIE R  DP RS    + E++LAD RWLQINE  T DGG +SVGTDIT LK 
Sbjct: 433 VNAAAARPIIERRIVDPGRSNHSQTTEVQLADERWLQINERRTRDGGLVSVGTDITQLKR 492

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
           NQ +LRES+RRL ATINDLS SRQILERQK ELS AN  Y  EKERAE ANK KSEFLA 
Sbjct: 493 NQERLRESERRLMATINDLSASRQILERQKAELSTANTNYLAEKERAEAANKAKSEFLAN 552

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           MSHELRTPLNAILGFSE+++ ++FG LGS +Y EYA+DIH SG+HLLN+IN+IL+MSKIE
Sbjct: 553 MSHELRTPLNAILGFSEILQDQMFGPLGSSRYNEYAKDIHDSGKHLLNVINDILDMSKIE 612

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPIL 669
              I +  +  DL P+I E +RL    A  KNI +E+ I S +   AD+R +K+IL  +L
Sbjct: 613 AGHIKLSCEKIDLAPLIEECLRLTSIPAACKNIHVEQSISSGIKLTADRRAMKQILLNLL 672

Query: 670 SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           SNS+KFTNN G++ +RT K+   V++TIADTGIGIPKSAL KIGQPFE + +QY +S GG
Sbjct: 673 SNSVKFTNNGGRIAVRTRKVDDAVVLTIADTGIGIPKSALSKIGQPFEQVQSQYAKSKGG 732

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GLGLAIS +LT LH GR++I S+EG GT++ I +P
Sbjct: 733 SGLGLAISRSLTLLHHGRMRIRSREGIGTVIAIRIP 768


>gi|325292361|ref|YP_004278225.1| two component sensor kinase [Agrobacterium sp. H13-3]
 gi|325060214|gb|ADY63905.1| two component sensor kinase [Agrobacterium sp. H13-3]
          Length = 775

 Score =  641 bits (1653), Expect = 0.0,   Method: Composition-based stats.
 Identities = 347/728 (47%), Positives = 490/728 (67%), Gaps = 3/728 (0%)

Query: 41  LFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNN 100
           +    +   + IP++ + FLV IA S ++ +   Y++ E+    ++ +     +    NN
Sbjct: 40  MPQVETLLKRLIPILILAFLVVIAASRMLGIVAEYSRMEEAARHSTALTALTAKAALINN 99

Query: 101 NIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFA-SSTKNSHYIGKKIGEII 159
            I F    + +AE+ L   L        + +LL+  N  +FA +    + YIG  +  ++
Sbjct: 100 GIVFASQERARAEASLAAALPSGSLADGTMVLLSGSNGRIFAGAGKGATLYIGTSLPALL 159

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
           PE++  +         E ++D QP++   +    + G ++   S  P+   WR E+ + V
Sbjct: 160 PEIAIVQRFPGAPGTIETNIDNQPHYATMIPFGDDGGMVIAARSLEPIRSFWRSEIAMNV 219

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
             F+ IS++LL +L++YY Q K+ ++ D I  E+N+ VETALSRGRCGLW+F+   ++  
Sbjct: 220 TLFAGISSILLVVLYAYYMQVKRARDADDIFAESNLRVETALSRGRCGLWDFDLSTRRMF 279

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASG 339
            S S+YEI+G P +   LSF   AR++H ++  + E+AR+V    ++Q+DQIF MRHA G
Sbjct: 280 WSGSLYEILGRPPKAAPLSFSDAARMMHSEDGNLYELARAVGCGDLRQIDQIFRMRHAKG 339

Query: 340 ADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWD 399
             +W++ RAQ++RT +G   +IGIAMD+TE++ L +RYAEADQRL+ AIE TSEA VLWD
Sbjct: 340 HYVWLRARAQVIRTNNGP-RVIGIAMDVTEQHRLAQRYAEADQRLADAIESTSEAFVLWD 398

Query: 400 KNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ-DMSKEIK 458
           KNDRLVMCN +YQKAYGLPD VLV G  +S +Q A  RP++E R +DP++S      E++
Sbjct: 399 KNDRLVMCNTHYQKAYGLPDSVLVAGTEKSAVQAAAARPVVERRVADPDQSGLSRMTEVQ 458

Query: 459 LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
           LAD RWLQINE  T DGG +SVGTDITLLK +Q +LR+S+RRL ATI DLS S+  LERQ
Sbjct: 459 LADDRWLQINERRTRDGGLVSVGTDITLLKRHQERLRDSERRLMATIGDLSASQHKLERQ 518

Query: 519 KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
           KTELS ANA Y  EKERA+ AN  KSEFLA MSHELRTPLNAILGFS++++ E+FG +GS
Sbjct: 519 KTELSDANANYLAEKERAQAANLAKSEFLANMSHELRTPLNAILGFSDILQNEMFGPVGS 578

Query: 579 VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
            KY EYA+DIH SG+HLLN+IN+IL+MSKIE   + I+++  DL P+I E +RL    A+
Sbjct: 579 PKYSEYARDIHDSGKHLLNVINDILDMSKIEAGHMRINRETIDLAPLIEETLRLTAIQAE 638

Query: 639 SKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIA 698
            KNI +++K+ + L    D+R +K+I+  +LSN++KFT N G++ +RT      +I+TIA
Sbjct: 639 QKNITVQQKVCAGLTMQGDRRAMKQIMLNLLSNAVKFTGNGGRVALRTHVHQAAMILTIA 698

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           DTGIGIP  AL+KIGQPFE + +QY +S GG GLGLAIS +L  LHGG +KI S EG+GT
Sbjct: 699 DTGIGIPAEALDKIGQPFEQVQSQYAKSQGGSGLGLAISRSLVRLHGGTMKIRSCEGRGT 758

Query: 759 IVTICMPQ 766
           +VTI +P 
Sbjct: 759 VVTIIIPH 766


>gi|307945461|ref|ZP_07660797.1| Non-motile and phage-resistance protein [Roseibium sp. TrichSKD4]
 gi|307771334|gb|EFO30559.1| Non-motile and phage-resistance protein [Roseibium sp. TrichSKD4]
          Length = 790

 Score =  640 bits (1650), Expect = 0.0,   Method: Composition-based stats.
 Identities = 243/741 (32%), Positives = 410/741 (55%), Gaps = 11/741 (1%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
                L    +   + +P++ ++F+  +A+    ++   + + ++       +    I  
Sbjct: 37  PAYRRLLRSETLLRRLVPILCLIFIGTLASYRAAELMNDHQRVDETVRHELELTATIISK 96

Query: 96  IFQNNNIK-FDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKK 154
              +      +   Q   + +L + L          IL+   N  + AS+    +  G+ 
Sbjct: 97  HLASAEKDLPEQGQQSAIQRVLAESLPTGATSDGRVILVTDENARIIASAPLRPNLNGQP 156

Query: 155 IGEIIPELSRSRSRSKTVQMSEASLD------QQPYHVLSVNLPHNSGSILIINSRVPLL 208
           I +I               + E +LD       +  +    +L    G + II     + 
Sbjct: 157 ISDIFGASQPLTVFGARAGIMEVALDIFGNGEMEDTYSTIHHLDGELGMVAIIQPTNSVY 216

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
             WR +V+  V  F   +++LL +++++Y QA + ++ D I       ++TAL+ GRCGL
Sbjct: 217 AEWRSDVSANVTLFVGTASILLVLIYAFYAQANRAEQADEIYAATRTRIDTALNHGRCGL 276

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           ++++    +   S S+YE++G   ++  LSF  +A L H D+  + E+A  +       +
Sbjct: 277 FDWDLSRGRIFWSSSLYEMLGHKPKDSLLSFAEVADLTHPDDVDLYELATELLEAGGGIV 336

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
           D++F MRHA+G+ +W++ R ++         ++IGI +D+TE++ LE++   AD RL  A
Sbjct: 337 DKMFRMRHANGSWVWLRARGEIQSEPGRSEPHLIGICIDVTEQHRLEEQSRTADLRLRDA 396

Query: 388 IECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYR---T 444
           IE  SEA VLW+KN+ LV+CN+NYQ+ +GLP H + PG     +  A     +  +    
Sbjct: 397 IETISEAFVLWNKNNELVICNSNYQELHGLPTHAVTPGTPYKDVMAAAENTQVAPQPVKI 456

Query: 445 SDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKAT 504
           S    + + S E +L D RWLQI+E  T DGG +SVGTDIT LK ++ QL + ++ L AT
Sbjct: 457 SQRVDAPEGSYEAQLDDGRWLQISERRTKDGGFVSVGTDITALKRHEEQLIDREKELNAT 516

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
           ++DL+ SR+ L+ Q  +L     KY  E+ RAE ANK KSEFLA +SHELRTPLNAI+GF
Sbjct: 517 VDDLTRSRKTLQLQAKQLEELADKYSEERNRAENANKAKSEFLANISHELRTPLNAIIGF 576

Query: 565 SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIP 624
           S+++ KE+FG LG+ KY +Y  DIH SG +LLN+IN+IL+MSKIE  ++SI+ ++     
Sbjct: 577 SDIMNKEMFGPLGTEKYSDYCHDIHNSGTYLLNVINDILDMSKIEAGRMSIETEDLSAKE 636

Query: 625 IINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI 684
              +  R++ ++A+ K+I +   +   +   AD+R +K+IL  +L+N++KFT  +G + +
Sbjct: 637 AAEDAARIMSTAAREKHIDVTCTVEDGIQVRADRRALKQILLNLLANAVKFTPEHGTVSL 696

Query: 685 RTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
           +  +    +   I+DTGIGI    + ++ QPF  + NQ+ ++  G GLGLAI+ +L  +H
Sbjct: 697 KAHQEKNRICFEISDTGIGIADKDIARLAQPFVQVENQFTKTHQGSGLGLAIARSLIEIH 756

Query: 745 GGRLKIISQEGKGTIVTICMP 765
           GG+L+I S+ G+GT V   +P
Sbjct: 757 GGKLEISSELGEGTHVRFLLP 777


>gi|328544516|ref|YP_004304625.1| Multi-sensor signal transduction histidine kinase [polymorphum
           gilvum SL003B-26A1]
 gi|326414258|gb|ADZ71321.1| Multi-sensor signal transduction histidine kinase [Polymorphum
           gilvum SL003B-26A1]
          Length = 787

 Score =  637 bits (1643), Expect = e-180,   Method: Composition-based stats.
 Identities = 246/761 (32%), Positives = 402/761 (52%), Gaps = 14/761 (1%)

Query: 19  RQKITVSSKQAFKRAYT--------SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           R+ +  +  +  + + T             L      F + IP++ +VF+  +A    ++
Sbjct: 12  RRFVQFAGSKTQEASLTGHIRLLAQPTYQRLLRTEPLFRRLIPILCLVFIASLALYRTLE 71

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIF-QNNNIKFDLASQKKAESMLGQLLAKTRFLSES 129
           +T  +   E+       ++   +     Q      +L  +   + +L   L         
Sbjct: 72  LTFDHQDTERQARDEISLIASVLSARLGQEETALPELGYRSALQRVLADALPAGATSRGR 131

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQ-QPYHVLS 188
            ILL  P+ ++ AS+    H  G+ I  ++              +               
Sbjct: 132 SILLTDPDGMIVASAPLQPHLEGQPITALLGPSQPLTVFGARAGVMMVDKGSAGEALATV 191

Query: 189 VNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDT 248
            +L    G + ++     +   WR  V+  V  F   S +LL ++++++ QA + ++ D 
Sbjct: 192 HHLDGRLGMVAVMQPEKEIFADWRGNVSANVTLFVGTSTVLLVLVYAFFSQATRAEQADE 251

Query: 249 ILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHY 308
           I       ++TAL+ GRCGL++++    +   S S+Y+++G   ++  L F  IA L H 
Sbjct: 252 IYAATRTRIDTALTHGRCGLFDWDLARGRIFWSASLYDLLGREPKDDILGFAEIADLTHP 311

Query: 309 DNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDL 367
           D+  +  +A ++       +D++F MRHA G+ +W++ R ++         ++IGI +D+
Sbjct: 312 DDIDLYRLAETLLETGQTTVDRMFRMRHADGSWVWLRARGEVQTDPGRAEPHLIGICIDV 371

Query: 368 TEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA 427
           TE++ L ++   AD RL  AIE  SEA VLW+ ++ LV+CN+NYQ  + LP+  + PG  
Sbjct: 372 TEQHELAEQSRTADLRLRDAIETISEAFVLWNADNELVICNSNYQSLHNLPEQAVRPGAP 431

Query: 428 RSIIQDAQTRPIIEY---RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDI 484
            + +  A     I         P    + S E +L D RWLQI+E  T DGG +SVGTDI
Sbjct: 432 YAEVMAAARNSHITTSPLHGGTPGAGANASYEAQLDDGRWLQISERRTKDGGFVSVGTDI 491

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKS 544
           T LK ++ +L +S+RRL AT++DL  SRQ LE Q  +L     KY  EK  AE AN+ KS
Sbjct: 492 TTLKRHEERLLDSERRLMATVSDLRKSRQTLEMQAQQLVELAEKYAQEKTNAENANRAKS 551

Query: 545 EFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILE 604
           EFLA +SHELRTPLNAI+GFS+++ + +FG +GS +Y EY +DIH SG +LLN+IN+IL+
Sbjct: 552 EFLANISHELRTPLNAIIGFSDIMDRGMFGPIGSERYAEYCRDIHESGTYLLNVINDILD 611

Query: 605 MSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKI 664
           MSKIE  ++ +  +   +  ++ E  R+I + AQ K I++  ++   L   AD+R +K++
Sbjct: 612 MSKIEAGRMEMTVKPLGVEAVVEEAGRIIRAPAQEKAIEVTCEVEPGLAVAADRRALKQV 671

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYD 724
           L  +LSN +KFT   G + +   + G      IADTGIGI K+ ++++ QPF  + NQ+ 
Sbjct: 672 LLNLLSNGVKFTPEKGTVRLSVHRAGGLARFEIADTGIGIRKADVDRLAQPFVQVENQFT 731

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           ++  G GLGLAI+ +L  L GG L I S  G+GT V   +P
Sbjct: 732 KTHKGSGLGLAIARSLVELQGGTLTIASVPGQGTRVAFTLP 772


>gi|118587761|ref|ZP_01545171.1| PAS domain protein [Stappia aggregata IAM 12614]
 gi|118439383|gb|EAV46014.1| PAS domain protein [Stappia aggregata IAM 12614]
          Length = 784

 Score =  637 bits (1642), Expect = e-180,   Method: Composition-based stats.
 Identities = 240/741 (32%), Positives = 401/741 (54%), Gaps = 11/741 (1%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
           S+   L    S   + IP +++VF+V +A      + T Y + ++    T  ++   +  
Sbjct: 37  SLAESLARSDSLMRRLIPGLAIVFIVILALFRTGDLVTDYTRTQETAQMTLSLMATVVAS 96

Query: 96  IFQNNNIK-FDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKK 154
              ++     +   +   + +L   L           L+A  +  + AS+        + 
Sbjct: 97  GLMSSESDLPETGYRTTLKRILADSLPSGATSKGRIYLVADQSGTIVASAPLQPALESRP 156

Query: 155 IGEIIPELSRSRSRSKTVQMSEASL------DQQPYHVLSVNLPHNSGSILIINSRVPLL 208
           I +++              +            ++       +L    G + ++     + 
Sbjct: 157 ISDLLGPSQPLMVFGARAGVMPVVTNLGGSKGEEQVLATVHHLDGRLGMVAVLQPENAIF 216

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
             WR++++  V  F   S +LL +++ ++ QA + +  D +       ++TAL+ GRCGL
Sbjct: 217 SQWRDDLSANVTLFVGTSLVLLAVIYGFFSQATRAEAADDMYAATRARIDTALTHGRCGL 276

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           ++++    +   S S+YE++G   ++  LSF  +A + H D+  +  +A  +       +
Sbjct: 277 FDWDLSRGRMFWSSSLYELLGREPKDDILSFADVADITHPDDIDLLGLAEHLLESGETLV 336

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
           D+ F MRHA G+ IW++ R ++         ++IGI +D+TE++ L ++   AD RL  A
Sbjct: 337 DETFRMRHADGSWIWLRARGEIQSEPGRAEPHLIGICIDITEQHELAEQSRMADLRLRDA 396

Query: 388 IECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYR---T 444
           IE  SEA VLW+  + LV+CN+NYQ  + LP+ V+ PG     +  A +   +       
Sbjct: 397 IETISEAFVLWNARNELVICNSNYQSLHSLPNSVIKPGTPYKDVMAAASNAEVAPHPVTL 456

Query: 445 SDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKAT 504
                + D S E +L D RWLQI+E  T DGG +SVGTDIT LK ++ +L +S++RLKAT
Sbjct: 457 RQRGGAPDGSYEAQLEDGRWLQISERRTKDGGFVSVGTDITALKKHEEKLVDSEKRLKAT 516

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
           + DL  SRQ LE Q  +L     KYQ EK RAE ANK KSEFLA +SHELRTPLNAI+GF
Sbjct: 517 VTDLQKSRQTLEVQARQLVEMADKYQEEKTRAEAANKAKSEFLANISHELRTPLNAIIGF 576

Query: 565 SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIP 624
           S+++ +E+FG +G+ +Y +Y +DI+ SG +LLN+IN+IL+MSKIE  +++I+ +  +   
Sbjct: 577 SDIMTQEMFGPVGTDRYSDYCKDIYSSGTYLLNVINDILDMSKIEAGRMTIETETVNASE 636

Query: 625 IINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI 684
              +  R++  +A  KNI +   +   +  +ADKR +K+IL  +L+N++KFT +NG + +
Sbjct: 637 SAEDASRIVTGAATEKNITVTTDVVENVSVHADKRALKQILLNLLANAVKFTPDNGTVTL 696

Query: 685 RTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
           +    G  +   + DTGIGI +  +E++ QPF  + NQ+ ++  G GLGLAI+ +L  LH
Sbjct: 697 KARPRGDKLHFEVIDTGIGISERDIERLAQPFVQVENQFTKTHQGSGLGLAIARSLVELH 756

Query: 745 GGRLKIISQEGKGTIVTICMP 765
           GG L I S+  KGT V+  +P
Sbjct: 757 GGALVIKSEVKKGTTVSFTLP 777


>gi|92117002|ref|YP_576731.1| periplasmic sensor signal transduction histidine kinase
           [Nitrobacter hamburgensis X14]
 gi|91799896|gb|ABE62271.1| periplasmic sensor signal transduction histidine kinase
           [Nitrobacter hamburgensis X14]
          Length = 775

 Score =  635 bits (1639), Expect = e-180,   Method: Composition-based stats.
 Identities = 241/740 (32%), Positives = 409/740 (55%), Gaps = 10/740 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L        + +P + + FL+ I   ++++V  +  Q++ MT    L L + + 
Sbjct: 25  KPAYRRLLIAEPVLRRAVPALIIAFLLTICVGALVQVIDQTRQKQAMTKHDLLALADLLA 84

Query: 95  IIFQNNNIKFDL--ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASST-KNSHYI 151
              ++  +      AS ++ +++L  L+      +   +++   ++ V A    + +   
Sbjct: 85  ERLEHVGVIHQDRPASIERLQNLLPSLIPSWGIAAGRHVIVTGADQRVLARVPIEAAPGE 144

Query: 152 GKKIGEIIPELSRSRSRSKTVQMS--EASLDQQPYHVLSVNLPHNSGSILIINSRVPLLR 209
             +I E+I        R  +         LD          +    G + +I  +     
Sbjct: 145 SSRILELISTAQSPALRGMSSASVADIILLDGSGALATQRVVRSLLGHVTVIQEKTD--S 202

Query: 210 LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLW 269
           +WR +  L +   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW
Sbjct: 203 VWRPDTALSITLSATTGFVVLILGFAFHWQSTRAREGDVINDAVRGRIDTALNRGRCGLW 262

Query: 270 NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD 329
           +++    +   S+SM+ ++G+   +  L+F  I+ L + D+  +  I   +    +  +D
Sbjct: 263 DWDLSRGRIFWSQSMFTMLGLESRSDLLTFGEISALANPDDIDLFAIGDQLISGKIHHID 322

Query: 330 QIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
           Q F MRH+ G  IW++VR ++ +    G  ++IGIA+D+TE+  L ++  EAD RL  AI
Sbjct: 323 QSFRMRHSGGHWIWLRVRCELSQGAGDGAAHLIGIAVDITEQKSLAEKTVEADLRLRDAI 382

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
           E   EA VLWD +DRLV+CN+++Q+ + LP+  +  G +   + +      I  R  +  
Sbjct: 383 ETIPEAFVLWDADDRLVLCNSHFQRLHKLPESAVAAGTSYETVIEVGRMHEICARPPETG 442

Query: 449 --RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
                  + E +L +  WL I+E  T DGG +SVGTDIT +K ++ +L ++  RL+AT+ 
Sbjct: 443 TTAPGARTFEAQLDNGCWLNISERRTKDGGYVSVGTDITRIKEHEQKLVDNDLRLRATVI 502

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL  ++  LE+Q  EL+    KY  EK+RAE AN+ KS+FLA MSHELRTPLNAI+GFSE
Sbjct: 503 DLKRTQATLEQQAIELADLAQKYAKEKDRAEDANRAKSKFLANMSHELRTPLNAIIGFSE 562

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           ++   +FG LGS KY EY  DI  SGQ+LL +IN++L+MSKIE  ++ +D +  DL   +
Sbjct: 563 IMSNGMFGTLGSEKYSEYCHDILTSGQYLLEVINDVLDMSKIEAGRMKLDMEPLDLSRTL 622

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            E +R++      K +  + +I  ++   AD R +K+I+  +LSN++KFT + G++M R+
Sbjct: 623 AESLRVVTGRTSDKKLTFDVRIDDDIAITADHRAVKQIIVNLLSNAVKFTPDGGRVMARS 682

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                 V +TIADTGIGI   +L K+G+PFE + +Q  ++  G GLGLAI+ +L NLHGG
Sbjct: 683 QVFANSVALTIADTGIGIAPHSLRKLGKPFEQVESQLTKTYAGSGLGLAIAKSLVNLHGG 742

Query: 747 RLKIISQEGKGTIVTICMPQ 766
            +++ S+ G GT+V + +P+
Sbjct: 743 SMRLRSKPGTGTVVRVTLPR 762


>gi|121602141|ref|YP_988756.1| putative non-motile and phage-resistance protein [Bartonella
           bacilliformis KC583]
 gi|120614318|gb|ABM44919.1| putative non-motile and phage-resistance protein [Bartonella
           bacilliformis KC583]
          Length = 773

 Score =  635 bits (1638), Expect = e-180,   Method: Composition-based stats.
 Identities = 248/734 (33%), Positives = 406/734 (55%), Gaps = 9/734 (1%)

Query: 38  ISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIF 97
              L        + IP I + FL+ +A    + +   +   +K T     +LT  I  I 
Sbjct: 39  YKRLLFIEPWLRRFIPFIIITFLIVLAAIRFVLIYDWHNAIDKDTRSKITLLTTHIINII 98

Query: 98  QNNNIKFDLASQKKA------ESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYI 151
             + +      +K        +++L     +    + + I +   N  V ASS  +    
Sbjct: 99  NRDLLSATKKERKAILSHNHLQNILINFQNEGLTNTNTMITIIDQNRNVLASSNPDITL- 157

Query: 152 GKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLW 211
           GK + + IP+ +   +  K     +  + ++P         +    + I      +   W
Sbjct: 158 GKPLQDFIPQSTALWTLGKYTGAMQIMIGEEPALASFHETENGQYGVFISEKTHHIYMEW 217

Query: 212 REEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF 271
            +  +L ++ F   ++++L +L++YY Q  + +  D I  +    ++ A+ RGRCGLW++
Sbjct: 218 HKVFSLNLILFIGTASIILALLYAYYTQVTRARNTDLISEKIQNRIDMAMMRGRCGLWDW 277

Query: 272 NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
           N  + + + SR+MYE++G   ++  LS   I  +I+  +    ++A+ +     K +D  
Sbjct: 278 NMASGRIYWSRAMYEMLGYVPQDALLSISQITAIINSTDINFFDLAQELMSGEKKHIDIN 337

Query: 332 FHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
             MRHA G  +W+++RA++  T     +++GI+ D++E++   ++ A+AD R+  AIE  
Sbjct: 338 VPMRHADGHHVWMRIRAEV--TEEEEPHLVGISFDISEQHQFVEQTAQADLRIRDAIENI 395

Query: 392 SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ 451
           SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ +       I EY   + + + 
Sbjct: 396 SESFVLWDSEGRLVMSNSKFCEYAAIPKQMLQSGIQRATVTAMARPAISEYFLKEDDGTG 455

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
           +++   + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L  +
Sbjct: 456 NLTSIRQTADGFWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQELKRA 515

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R   +++ TE+   N   Q EKERAE+ANK KSEFLA +SHELRTPLNAILGFS+++ + 
Sbjct: 516 RGNAQQRATEVEKLNKSLQAEKERAESANKAKSEFLANISHELRTPLNAILGFSDIMLQS 575

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY +DIH SG HLL +IN+IL+MSKIE  + ++D +N DL PII+E IR
Sbjct: 576 TFGPLGSQRYEEYMRDIHNSGTHLLTLINDILDMSKIEAGRFTLDCKNVDLEPIISEAIR 635

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
            +   AQ K I I   I  +L    D R +++I   ++SN++KFT + G + I   +   
Sbjct: 636 TLTPQAQEKKISITANIAPKLHAELDCRAMRQIFLNLISNAVKFTPSGGSIDICAFQKKN 695

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            +I  I DTG+GIP+SA++K+G+PFE + NQ+ ++  G GLGLAIS +L  LH G+L+I 
Sbjct: 696 NLIFKIKDTGVGIPQSAIKKLGKPFEQVENQFTKTHTGSGLGLAISRSLLELHKGKLEIA 755

Query: 752 SQEGKGTIVTICMP 765
           S+E  GT VTI +P
Sbjct: 756 SEEENGTTVTITIP 769


>gi|115523964|ref|YP_780875.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisA53]
 gi|115517911|gb|ABJ05895.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisA53]
          Length = 771

 Score =  635 bits (1638), Expect = e-180,   Method: Composition-based stats.
 Identities = 242/737 (32%), Positives = 407/737 (55%), Gaps = 8/737 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L     +  + +P + + FL+ I   +++++  +   +    ++    L + I 
Sbjct: 25  KPAYQRLLVAEPALRRAVPTLIIAFLLTIFVGALVQIIDQTRDKRSAMSRDLAALADLIT 84

Query: 95  IIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKK 154
                       A+  + +  L  L+    F +   I++   N+ V A    N+      
Sbjct: 85  ERIDRIAADRT-ATPGQLQGALQGLIPAWGFAAGRHIIVVDANQRVIARVPPNATIGDAS 143

Query: 155 -IGEIIPELSRSRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            I E++       +      + + +L   +  H +   +    G +++I   +    +W 
Sbjct: 144 RILEVLGATQPLTTSGLQSGVVDLTLPSGRTIHAVQRIVRALPGQVVVIQEDLG--SIWG 201

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
               L +   +    ++L + F+++ Q+ + +E D I       ++TAL  GRCGLW+++
Sbjct: 202 SNTALSITLSATTGFVVLILGFAFHWQSTRAREGDAINDAVRGRIDTALDSGRCGLWDWD 261

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               +   SRSM+ ++G+   +  L+F  +  L+  D+  +  IA  +    + Q+D  F
Sbjct: 262 LSRGRIFWSRSMFTMLGLESRSDLLTFGEVNALVKSDDIDLFAIANQLILGEITQIDHTF 321

Query: 333 HMRHASGADIWIQVRAQM-MRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
            M HA+G  IW++VR ++       G+++IGIA+D+TE   L +R  EAD RL  AIE  
Sbjct: 322 RMLHANGHWIWLRVRCEIGEGGGDAGLHLIGIAVDITEHKSLAERTVEADLRLRDAIETI 381

Query: 392 SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS- 450
            EA VLWD  +RLV+CN+++Q+ + LPD  + PG +   + +  + P    R+ +   + 
Sbjct: 382 PEAFVLWDAENRLVLCNSHFQRLHQLPDSAVTPGTSYDTVIEVGSMPEARTRSPECGGAQ 441

Query: 451 -QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
               + E +L + +WL I+E  T DGG ++VGTDIT +K ++ +L ++  RL+AT+ DL 
Sbjct: 442 LGARTFEAQLDNGQWLHISERRTKDGGYVAVGTDITRIKDHEHKLIDNDLRLRATVADLK 501

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
            S+  LERQ  +L+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++ 
Sbjct: 502 ISQVKLERQAVQLADLARKYAEEKYRAEDANQTKSKFLANMSHELRTPLNAIIGFSEIMG 561

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
             +FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE  ++ +D +  D    ++E 
Sbjct: 562 SGMFGRLGSEKYQEYCHDILTSGHYLLEVINDILDMSKIEAGRMKLDLEPLDFAGTLSES 621

Query: 630 IRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
           +R++   A++K +++   I   +   AD+R +K+IL  +LSN++KFT   G++ +R    
Sbjct: 622 LRVVSGRAENKQLELHADIEQGISVIADRRAVKQILVNLLSNAVKFTPEGGQITVRGRAR 681

Query: 690 GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
              +++ IADTGIGI   +L K+GQPFE + +Q  +S  G GLGLAI+ +LTNLHGG ++
Sbjct: 682 ADSIVLMIADTGIGIAPQSLRKLGQPFEQVESQLTKSYHGSGLGLAIAKSLTNLHGGSMR 741

Query: 750 IISQEGKGTIVTICMPQ 766
           + SQ G+GT+V + +P+
Sbjct: 742 LRSQLGQGTVVRLVLPR 758


>gi|220925321|ref|YP_002500623.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium nodulans ORS 2060]
 gi|219949928|gb|ACL60320.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium nodulans ORS 2060]
          Length = 782

 Score =  633 bits (1634), Expect = e-179,   Method: Composition-based stats.
 Identities = 250/741 (33%), Positives = 406/741 (54%), Gaps = 13/741 (1%)

Query: 29  AFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLM 88
              RA T     L    S     IP I  +FL+ +   +  ++  +         +   +
Sbjct: 18  GIARAITPAHQRLARAESWLRFAIPAILGLFLISLFAITATQLLAQRRDAVAEAGRQIDL 77

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
           L   +     +           ++E  L   +  +  ++   + L  P++ + AS     
Sbjct: 78  LARLVAASLSSTAP--------ESELRLDGAVPASALVAGRAVYLIGPDDRIAASLPALL 129

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
              G ++ + + E        +   +  A+L   P       LP   G + ++ S     
Sbjct: 130 P-PGHRLADHLGEAQPLLILGERAGVMTATLGGAPALATLRALPSGRGRVAVVQSLDTAT 188

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
             WR     E V     + +++ +  +Y  QA + +  D +  +    ++TAL RGRCGL
Sbjct: 189 ADWRSRARTEAVVIGTATLVIVCVGLAYTLQADRARTVDRVCEQVRQRLDTALCRGRCGL 248

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           W+++    + + S SMY+++G   E++ LSF  +  L+H D+  +  +A  +  +    +
Sbjct: 249 WDWDIARGRIYWSDSMYQLLGYVREHEFLSFGDVNALVHPDDTDLYGLASQLAAQDAT-V 307

Query: 329 DQIFHMRHASGADIWIQVRAQMMRT-ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
           D  F +R A+G  IW++ RA+++R    GG +++GI +D++E+  L +  A AD RL  A
Sbjct: 308 DHEFRIRSAAGEWIWLKARAEIVRDQDDGGRHLVGIIIDISEQRRLAESTATADMRLRDA 367

Query: 388 IECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDP 447
           +E  SEA VLWD  +RLV+CN+ +++ + L      PG     I      P +     + 
Sbjct: 368 VEAVSEAFVLWDAQNRLVLCNSKFRRLHALTLEEAQPGRRYDAIMGRAAVPAVRREIPNT 427

Query: 448 E--RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATI 505
           +       + E +LAD RWLQI+E  T DGG +SVGTDIT LK +Q +L ES+R+L ATI
Sbjct: 428 DLAELGARTFEAELADGRWLQISERRTKDGGYVSVGTDITTLKRHQERLVESERQLIATI 487

Query: 506 NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS 565
            DL  SR+ LE Q  +L+    +Y  +K +AE+AN++KSEFLA MSHELRTPLNAILGF+
Sbjct: 488 ADLKRSRRTLELQTQQLADLAERYLDQKAQAESANRSKSEFLANMSHELRTPLNAILGFA 547

Query: 566 EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPI 625
           EV++ E+FG+LGS KY EY +DI  SG +LL++I++IL+MS+IE  ++++ KQ   +   
Sbjct: 548 EVMQDEVFGQLGSEKYREYCRDIRSSGHYLLSVIDDILDMSRIEARRVTLVKQPVPVAEA 607

Query: 626 INEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR 685
           +   ++LI   A++K + +  ++ ++    AD+R + +IL  +L N++KFT   G++ +R
Sbjct: 608 LERALKLIAEPARAKGLTLSVEMSADAVVLADERALHQILVNLLQNAVKFTPEAGRVAVR 667

Query: 686 TSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
           T +    V I + D+GIGIPK+ L K+G PFE + + + +S  G GLGLAIS +LT LHG
Sbjct: 668 TRRALDAVHIFVEDSGIGIPKAVLPKLGAPFEQVESNFSRSFKGSGLGLAISRSLTELHG 727

Query: 746 GRLKIISQEGKGTIVTICMPQ 766
           GRL+I S+ G GTIV + +PQ
Sbjct: 728 GRLRIRSEVGCGTIVLVRLPQ 748


>gi|192290539|ref|YP_001991144.1| PAS/PAC sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris TIE-1]
 gi|192284288|gb|ACF00669.1| PAS/PAC sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris TIE-1]
          Length = 769

 Score =  632 bits (1631), Expect = e-179,   Method: Composition-based stats.
 Identities = 245/738 (33%), Positives = 410/738 (55%), Gaps = 8/738 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L +      + +P++ + FLV I   + +++  +  Q+    N+    L + I 
Sbjct: 25  KPAYHRLLNAEPVLRRAVPLLIIAFLVTIFFGAAVQIIEQSKQKRGAMNRDLSALADLIA 84

Query: 95  IIFQNNNIKFDL--ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASST-KNSHYI 151
              ++  +      AS ++ +++L  L+          +++   ++ + A         +
Sbjct: 85  ERLEHIGVVRLDRPASIERLQNLLPGLIPTWGIAPGRHVIVTSADQRILARVPIGTEPSV 144

Query: 152 GKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLW 211
             +  EI+   S ++S  ++                   +    G ++II      L   
Sbjct: 145 DNRFLEILGAASLTKSGQQSSISEITLPGGASALATMHVVKSLPGQVVIIQEDTGSL--L 202

Query: 212 REEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF 271
           R +  L+V   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW++
Sbjct: 203 RSDTALQVTLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRSRIDTALNRGRCGLWDW 262

Query: 272 NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
           +    +   S+SM+ I+G+   N  L+F  +  L+  ++  +  IA  +    V  +D  
Sbjct: 263 DLSRGRIFWSQSMFTILGLESRNDLLTFGEVNALVKGEDIDLFAIADELMAGRVDHIDHS 322

Query: 332 FHMRHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           F MRHA G  IW+++R ++ +       ++IGIA+D+TE+  L +R  EAD RL  AIE 
Sbjct: 323 FQMRHAHGHWIWLRMRCELTQEAGATEKHLIGIAVDITEQKSLAERSVEADLRLRDAIET 382

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER- 449
             EA VLWD  +RLV+CN+++Q+ + LPD  + PG +   I +    P +  R  D    
Sbjct: 383 IPEAFVLWDAENRLVLCNSHFQRLHKLPDSAVTPGTSYETILEVGRMPQLRTRLCDNGAV 442

Query: 450 -SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
                + E +L D  WL I+E  T DGG ++VGTDIT +K ++ +L ++  RL+AT+ DL
Sbjct: 443 MPGARTFEAQLDDGSWLHISERRTKDGGYVAVGTDITRIKAHEQKLVDNDLRLRATVADL 502

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             ++  LE+Q  EL+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++
Sbjct: 503 KITQSKLEKQALELADLARKYADEKRRAEEANQTKSKFLANMSHELRTPLNAIIGFSEIM 562

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
              +FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE  ++ ++ +  DL   I E
Sbjct: 563 GSGMFGTLGSEKYQEYCHDIMTSGHYLLEVINDILDMSKIEAGRMRLEMEPLDLAKTIGE 622

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            ++++   A+ K++++  ++  ++   AD+R IK+IL  +LSN++KFT + G++ +R   
Sbjct: 623 SVKVVAGRAEHKHLELRSELNDQIPIVADRRAIKQILINLLSNAVKFTPDAGRVTVRGHV 682

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
            G  +++ IADTGIGIP  +L ++GQPFE + +Q  +S  G GLGLAI+ +L NLHGG +
Sbjct: 683 AGGSIVLMIADTGIGIPPQSLRRLGQPFEQVESQLTKSYHGSGLGLAIAKSLVNLHGGSM 742

Query: 749 KIISQEGKGTIVTICMPQ 766
           ++ S  G GT+V + +P+
Sbjct: 743 RLRSTLGAGTVVMVSLPR 760


>gi|294851985|ref|ZP_06792658.1| two-component system protein [Brucella sp. NVSL 07-0026]
 gi|294820574|gb|EFG37573.1| two-component system protein [Brucella sp. NVSL 07-0026]
          Length = 798

 Score =  632 bits (1631), Expect = e-179,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 424/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 51  PAYSKFIVIEPILRRLVPALIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 110

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 111 MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 169

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 170 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 229

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 230 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSRQIQRRIDMALARGRCGLWDWD 289

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 290 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 349

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 350 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 407

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP  +L PG  R+ +         E R ++   R+ 
Sbjct: 408 EAFVLWDANNRLVMANSKFSEYAGLPVWMLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 467

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 468 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 527

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 528 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 587

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 588 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 647

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 648 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 707

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 708 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 767

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 768 STERVGTVVSVCIP 781


>gi|39935007|ref|NP_947283.1| sensor histidine kinase pleC [Rhodopseudomonas palustris CGA009]
 gi|39648858|emb|CAE27379.1| sensor histidine kinase, possible pleC [Rhodopseudomonas palustris
           CGA009]
          Length = 779

 Score =  632 bits (1630), Expect = e-179,   Method: Composition-based stats.
 Identities = 245/738 (33%), Positives = 410/738 (55%), Gaps = 8/738 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L +      + +P++ + FLV I   + +++  +  Q+    N+    L + I 
Sbjct: 35  KPAYHRLLNAEPVLRRAVPLLIIAFLVTIFFGAAVQIIEQSKQKRGAMNRDLSALADLIA 94

Query: 95  IIFQNNNIKFDL--ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASST-KNSHYI 151
              ++  +      AS ++ +++L  L+          +++   ++ + A         +
Sbjct: 95  ERLEHIGVVRLDRPASIERLQNLLPGLIPTWGIAPGRHVIVTSADQRILARVPIGTEPSV 154

Query: 152 GKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLW 211
             +  EI+   S ++S  ++                   +    G ++II      L   
Sbjct: 155 DNRFLEILGAASLTKSGQQSSISEITLPGGASALATMHVVKSLPGQVVIIQEDTGSL--L 212

Query: 212 REEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF 271
           R +  L+V   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW++
Sbjct: 213 RSDTALQVTLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRSRIDTALNRGRCGLWDW 272

Query: 272 NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
           +    +   S+SM+ I+G+   N  L+F  +  L+  ++  +  IA  +    V  +D  
Sbjct: 273 DLSRGRIFWSQSMFTILGLESRNDLLTFGEVNALVKGEDIDLFAIADELMAGRVDHIDHS 332

Query: 332 FHMRHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           F MRHA G  IW+++R ++ +       ++IGIA+D+TE+  L +R  EAD RL  AIE 
Sbjct: 333 FQMRHAHGHWIWLRMRCELTQEAGATEKHLIGIAVDITEQKSLAERSVEADLRLRDAIET 392

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER- 449
             EA VLWD  +RLV+CN+++Q+ + LPD  + PG +   I +    P +  R  D    
Sbjct: 393 IPEAFVLWDAENRLVLCNSHFQRLHKLPDSAVTPGTSYETILEVGRMPQLRTRLCDNGAV 452

Query: 450 -SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
                + E +L D  WL I+E  T DGG ++VGTDIT +K ++ +L ++  RL+AT+ DL
Sbjct: 453 MPGARTFEAQLDDGSWLHISERRTKDGGYVAVGTDITRIKAHEQKLVDNDLRLRATVADL 512

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             ++  LE+Q  EL+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++
Sbjct: 513 KITQSKLEKQALELADLARKYADEKRRAEEANQTKSKFLANMSHELRTPLNAIIGFSEIM 572

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
              +FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE  ++ ++ +  DL   I E
Sbjct: 573 GSGMFGTLGSEKYQEYCHDIMTSGHYLLEVINDILDMSKIEAGRMRLEMEPLDLAKTIGE 632

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            ++++   A+ K++++  ++  ++   AD+R IK+IL  +LSN++KFT + G++ +R   
Sbjct: 633 SVKVVAGRAEHKHLELRSELNDQIPIVADRRAIKQILINLLSNAVKFTPDAGRVTVRGHL 692

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
            G  +++ IADTGIGIP  +L ++GQPFE + +Q  +S  G GLGLAI+ +L NLHGG +
Sbjct: 693 AGGSIVLMIADTGIGIPPQSLRRLGQPFEQVESQLTKSYHGSGLGLAIAKSLVNLHGGSM 752

Query: 749 KIISQEGKGTIVTICMPQ 766
           ++ S  G GT+V + +P+
Sbjct: 753 RLRSTLGAGTVVMVSLPR 770


>gi|254718765|ref|ZP_05180576.1| PAS domain S-box-containing protein [Brucella sp. 83/13]
 gi|265983743|ref|ZP_06096478.1| multi-sensor signal transduction histidine kinase [Brucella sp.
           83/13]
 gi|264662335|gb|EEZ32596.1| multi-sensor signal transduction histidine kinase [Brucella sp.
           83/13]
          Length = 783

 Score =  632 bits (1630), Expect = e-179,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 36  PAYSKFIVIEPILRRLVPALIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 96  MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 154

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 155 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 214

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 215 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 274

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 275 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 334

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 335 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 392

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 393 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 452

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 453 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 512

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 513 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 572

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 573 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 632

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 633 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 692

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 693 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 752

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 753 STERVGTVVSVCIP 766


>gi|254472050|ref|ZP_05085451.1| multi-sensor signal transduction histidine kinase [Pseudovibrio sp.
           JE062]
 gi|211959252|gb|EEA94451.1| multi-sensor signal transduction histidine kinase [Pseudovibrio sp.
           JE062]
          Length = 744

 Score =  632 bits (1629), Expect = e-179,   Method: Composition-based stats.
 Identities = 257/724 (35%), Positives = 405/724 (55%), Gaps = 5/724 (0%)

Query: 47  SFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQ-NNNIKFD 105
              + IP + +VF+   A    +++   Y    +       ++  A+      +   K  
Sbjct: 1   MMRRIIPALCIVFIACTAIFRGLEIAYNYESVSQKAQDDLTLIATALTASIDVSEQEKGS 60

Query: 106 LASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRS 165
           +      +  L + L          ILL  PN  + AS+       G KI   + +    
Sbjct: 61  VGLTSALQRALSEALPPRATSQSRQILLTDPNGTIVASAPTRPDMEGLKITSFLGDTQPM 120

Query: 166 RSRSKTVQMSEASLD-QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSI 224
               K   +   +   +        +LP+  G + I+     +   WR E++  V  F  
Sbjct: 121 TFFGKRAGVLTINEGTKDATRATVHHLPNKLGMVAIMQPEDAIFSSWRAELSANVTIFVA 180

Query: 225 ISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSM 284
            S +LL I+++Y+ QA + ++ D I       ++ AL+RGRCGL++++    +   S S+
Sbjct: 181 TSMVLLVIIYAYFAQATRAQQADGIYAATRSRIDAALNRGRCGLFDWDLSRGRVFWSASL 240

Query: 285 YEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWI 344
           YE++G+   N  + F  I  L H D+  + ++A+S+       +D+ + MRH  G+ +W+
Sbjct: 241 YEMLGMDPRNDIMGFAEIQSLTHPDDVDLYDLAKSLLDTGKSNVDRQWRMRHIDGSWVWL 300

Query: 345 QVRAQMMRTIS-GGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDR 403
           +VRA++         ++IGI MD+TE+  L ++   AD RL  AIE  SEA VLWD ++ 
Sbjct: 301 RVRAEVQTDAGTNEPHLIGICMDVTEQKMLAEQSRTADLRLRDAIENISEAFVLWDADNH 360

Query: 404 LVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTS--DPERSQDMSKEIKLAD 461
           LVMCN+NY+K + LPDHV+  G   + +  + ++PII         +   + S ++++  
Sbjct: 361 LVMCNSNYRKLHQLPDHVVQAGTPYATVMSSASQPIISEPEEGDHIDSDMESSYKVEMEG 420

Query: 462 SRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
            RWLQ++E  T DGG +SVGTDIT LK  + +L ES+R   ATI DL  SRQ LE Q  +
Sbjct: 421 GRWLQVSERRTKDGGFVSVGTDITELKRKEEKLLESERGHMATIADLRQSRQKLELQAQQ 480

Query: 522 LSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKY 581
           L     KY  EK RAE AN+ KSEFLA +SHELRTPLNAI+GFSE++ + +FG+LGS KY
Sbjct: 481 LVELTEKYADEKTRAEDANQAKSEFLANISHELRTPLNAIIGFSEIMDQGMFGDLGSDKY 540

Query: 582 YEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKN 641
            EY +DIH SG +LLN+IN+IL+MSKIE  +I +  ++  +  I+ +  R+I ++A  KN
Sbjct: 541 KEYCKDIHSSGNYLLNVINDILDMSKIEAGRIELSVEDVQIQQIVQDAARIISATAAEKN 600

Query: 642 IKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTG 701
           IK+  +    +   AD+R +K+IL  +L+NS+KFT  NG++ +   K+G    + I D G
Sbjct: 601 IKVVNENLPHMHLQADRRAVKQILLNLLANSVKFTPENGEVRVSARKVGAFAELKITDNG 660

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           IGI K  ++++ +PF  + NQ+ ++  G GLGLAI+ +L+ LHGG ++I S+ GKGT VT
Sbjct: 661 IGIAKKDIDRLAKPFVQVENQFTKTHKGSGLGLAIARSLSELHGGYMEIDSEVGKGTEVT 720

Query: 762 ICMP 765
           I +P
Sbjct: 721 IKLP 724


>gi|306845222|ref|ZP_07477798.1| PAS domain S-box-containing protein [Brucella sp. BO1]
 gi|306274381|gb|EFM56188.1| PAS domain S-box-containing protein [Brucella sp. BO1]
          Length = 783

 Score =  631 bits (1628), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 36  PAYSKFIIIEPILRRLVPALIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 96  MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 154

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 155 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 214

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 215 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 274

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 275 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 334

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 335 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 392

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 393 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 452

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 453 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 512

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 513 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 572

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 573 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 632

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 633 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 692

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 693 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 752

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 753 STERVGTVVSVCIP 766


>gi|86750547|ref|YP_487043.1| histidine kinase [Rhodopseudomonas palustris HaA2]
 gi|86573575|gb|ABD08132.1| histidine kinase [Rhodopseudomonas palustris HaA2]
          Length = 771

 Score =  631 bits (1628), Expect = e-178,   Method: Composition-based stats.
 Identities = 239/740 (32%), Positives = 413/740 (55%), Gaps = 10/740 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L +      + +P++ + FL+ I   + ++   +  Q+    N+    L + + 
Sbjct: 25  KPAYHRLLTAEPVLRRAVPILIIAFLITICFGAAVQFIDQSRQKRAALNRDLCALADLLA 84

Query: 95  IIFQNNNIKFDL--ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSH-YI 151
              ++  +      AS ++ +++L  L+      +   +++   ++ V A    +     
Sbjct: 85  ERLEHIGVVRLDRPASIERLQNLLPGLIPSWGIAAGRHVIVTSADQRVLARVPGDEGTSA 144

Query: 152 GKKIGEIIPELSRSRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSILIINSRVPLLRL 210
                +II         ++   +++  L            +    G +++I+       +
Sbjct: 145 ASSFLDIISATPPLTRSAQQGTITQIILPSGASALATLHTVKSLPGQVIVIHEDTG--SI 202

Query: 211 WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
            R +  L++   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW+
Sbjct: 203 LRSDAALQITLSATTGFVVLILGFAFHWQSTRAQEGDLINDAVRSRIDTALNRGRCGLWD 262

Query: 271 FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ 330
           ++    +   S+SM+ ++G+   N  L+F  +  L++ D+  +  I   +   +   +D 
Sbjct: 263 WDLSRGRIFWSQSMFTLLGLESRNDLLTFGEVNALVNSDDIDLFAIGDQLIAGNTDHIDH 322

Query: 331 IFHMRHASGADIWIQVRAQM-MRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
            F MRHA+G  IW+++R ++   T S   ++IGIA+D+TE+  L +R  EAD RL  AIE
Sbjct: 323 SFRMRHANGHWIWLRMRCELSQETQSDNKHLIGIAVDVTEQKSLAERTVEADLRLRDAIE 382

Query: 390 CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
              EA VLWD ++RLV+CN+++Q+ + LPD  + PG +   + +    P I  R  D   
Sbjct: 383 TIPEAFVLWDADNRLVLCNSHFQRLHKLPDIAVAPGTSYETVIEVGQMPEIRTRLCDNSG 442

Query: 450 S---QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
                  + E +LAD  WL I+E  T DGG ++VGTDIT +K ++ +L ++  RL+AT+ 
Sbjct: 443 GSSPGARTFEAQLADGSWLHISERRTKDGGYVAVGTDITRIKAHEQKLVDNDLRLRATVA 502

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL  S+  LERQ  EL+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE
Sbjct: 503 DLKISQYKLERQAIELADLARKYSEEKTRAEEANQTKSKFLANMSHELRTPLNAIIGFSE 562

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           ++   +FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE  ++ +D +  DL   +
Sbjct: 563 IMGSGMFGTLGSEKYQEYCHDIMTSGHYLLEVINDILDMSKIEAGRMRLDMEELDLARTL 622

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            E ++++   A+ K +++  +I  ++   AD+R +K+IL  +LSN++KFT + G++ +R+
Sbjct: 623 GESLKVVAGRAEHKQLELLSEIEDDIPIVADRRAVKQILINLLSNAVKFTPDGGRVTVRS 682

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
             +   +++ IAD+GIGI   +L ++GQPFE + +Q  ++  G GLGLAI+ +LT LHGG
Sbjct: 683 RTLPNAIVLMIADSGIGIAPQSLRRLGQPFEQVESQLSKTYHGSGLGLAIAKSLTTLHGG 742

Query: 747 RLKIISQEGKGTIVTICMPQ 766
            +++ S  G GT+V + +P+
Sbjct: 743 SMRLRSTLGAGTVVMVTLPR 762


>gi|146341839|ref|YP_001206887.1| two-component sensor histidine kinase [Bradyrhizobium sp. ORS278]
 gi|146194645|emb|CAL78670.1| putative two-component sensor histidine kinase with a ATP-binding
           domain (C-term) [Bradyrhizobium sp. ORS278]
          Length = 774

 Score =  631 bits (1628), Expect = e-178,   Method: Composition-based stats.
 Identities = 248/738 (33%), Positives = 419/738 (56%), Gaps = 8/738 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L +      + +P + + FLV I   + ++V     Q+   T +    +++ + 
Sbjct: 26  KPAYQRLLTAEPVLRRAVPTLIIAFLVTICLGAFVQVLDHSRQKRGATKRDLAAISDLLA 85

Query: 95  IIFQNNNIKFD-LASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHY-IG 152
               +  ++ D +A+ +  +++L  L+          +++   +  + A    ++     
Sbjct: 86  DRIGHIAMRPDRIANIEHLQALLPDLIPAWGSAPGRHVIVTGADHRILARVPVDTGLGEN 145

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSILIINSRVPLLRLW 211
            +I ++I       +      ++E +L + +P   +S  +    G +++I  +  L  +W
Sbjct: 146 DRILDLISTAQLLATPGLQGAVTEITLPNGRPAFAVSQLIKALPGRVVVIQEK--LEPIW 203

Query: 212 REEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF 271
             +  L +   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW++
Sbjct: 204 GSDAALSITLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRGRIDTALNRGRCGLWDW 263

Query: 272 NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
           +    +   S SM+ ++G+      L+F  +  L++ D+  +  IA  +    ++ +DQ 
Sbjct: 264 DLSRGRIFWSNSMFAMLGLDNRTDLLTFGEVNALVNSDDIDLFAIADQLVAGELRHIDQS 323

Query: 332 FHMRHASGADIWIQVRAQMMR-TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           F MRH  G  IW++VR ++ + T   G+++IGIA+D+TE+  L ++  EAD RL  AIE 
Sbjct: 324 FRMRHTEGHWIWLRVRCELSQGTTDSGLHLIGIAVDVTEQKSLVEKTVEADLRLRDAIET 383

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD--PE 448
            SEA VLWD N+RLV+CN+++QK + LPD  + PG +   + +    P I  R  D   +
Sbjct: 384 ISEAFVLWDSNNRLVLCNSHFQKLHKLPDSAVTPGTSYETVIEVGKMPEIRTRLHDNSQQ 443

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
                + E +L D  WL I+E  T DGG +SVGTDIT +K ++ +L ++  RL+AT+ DL
Sbjct: 444 AQGGRTFEAQLDDGSWLHISERRTKDGGYVSVGTDITRIKEHEQKLVDNDLRLRATVIDL 503

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             S+  LERQ  EL+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++
Sbjct: 504 QRSQSALERQAIELADLAEKYSQEKTRAEEANQTKSKFLANMSHELRTPLNAIIGFSEIM 563

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
              +FG LGS KY EY  DI  SGQ+LL +IN+IL+MSKIE  ++ +D +  DL   + E
Sbjct: 564 GSGMFGSLGSEKYQEYCHDILTSGQYLLEVINDILDMSKIEAGRMKLDMEPLDLAKTLAE 623

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            +R++   AQ K++ ++  I   +   AD+R  K+I+  +LSN++KFT   G++ +R+  
Sbjct: 624 SLRVVSGRAQDKSLVLDADIEGNIPVIADRRATKQIMVNLLSNAVKFTPEGGRVTMRSRV 683

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
               V++ IADTGIGIP  +L ++G+PFE + +Q  ++  G GLGLAI+ +L  LHGG +
Sbjct: 684 FEDKVVLIIADTGIGIPAQSLARLGRPFEQVESQMTKTYHGSGLGLAIARSLAQLHGGSM 743

Query: 749 KIISQEGKGTIVTICMPQ 766
           ++ S+   GT+V + +P+
Sbjct: 744 RLRSRLEHGTVVRVTLPR 761


>gi|75675393|ref|YP_317814.1| Signal transduction histidine kinase [Nitrobacter winogradskyi
           Nb-255]
 gi|74420263|gb|ABA04462.1| signal transduction histidine kinase [Nitrobacter winogradskyi
           Nb-255]
          Length = 779

 Score =  631 bits (1628), Expect = e-178,   Method: Composition-based stats.
 Identities = 245/739 (33%), Positives = 418/739 (56%), Gaps = 10/739 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L        + +P + + FLV I   ++++V  +  Q++ MT    L L + + 
Sbjct: 25  KPAYRRLLIAEPVLRRAVPTLIIAFLVTICIGALVQVIDQTRQKQAMTKHDLLALADLLA 84

Query: 95  IIFQNNNIKFDL--ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASST-KNSHYI 151
              ++  +      AS ++ +++L +L+ +    +   +++   ++ V A      +   
Sbjct: 85  ERLEHAGVIDQDRPASIERLQNLLPKLIPQWSIATGRHVIVTGVDQRVLARVPVGAASGE 144

Query: 152 GKKIGEIIPELSRSRSRSKTVQMS--EASLDQQPYHVLSVNLPHNSGSILIINSRVPLLR 209
             ++ E+I        R            LD      +   +    G + +I        
Sbjct: 145 SSRMLELISITQSPILRGAAPASVADIVLLDGSSVLAVQRVVRSLLGQVTVIQEVN---A 201

Query: 210 LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLW 269
            WR +  L +   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW
Sbjct: 202 AWRPDTALSITLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRSRIDTALNRGRCGLW 261

Query: 270 NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD 329
           +++    +   S+SM+ ++G+   +  L+F  ++ L++ D+  + E+A  +    +  +D
Sbjct: 262 DWDLSRGRIFWSQSMFTMLGMESRSDLLTFGEVSSLVNSDDIDLFEVADQLISGKIGHID 321

Query: 330 QIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
           Q F MRH+SG  IW++VR ++ +  +GG ++IGIA+D+TE+  L ++  EAD RL  AIE
Sbjct: 322 QSFRMRHSSGHWIWLRVRCELSQNANGGAHLIGIAVDVTEQKSLAEKSIEADLRLRDAIE 381

Query: 390 CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
              EA VLWD +DRLV+CN+++Q+ + LPD  +  G     + +    P I  R S+   
Sbjct: 382 SIPEAFVLWDADDRLVLCNSHFQRLHKLPDSAVAVGTPYETVVEVGRMPEIRARHSETGT 441

Query: 450 SQ--DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIND 507
                 + +++LAD  WL ++E  T DGG +SVGTDIT +K ++ +L E+  RL+AT+ D
Sbjct: 442 VTLKAHTFDVQLADGNWLHVSERRTKDGGYVSVGTDITRIKEHEQKLVENDLRLRATVID 501

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L  ++  LE+Q  +L+    KY  EK RAE AN+ KS+FLA MSHELRTPLNAI+GFSE+
Sbjct: 502 LKRTQATLEQQAIKLADLAQKYADEKNRAEDANRAKSKFLANMSHELRTPLNAIIGFSEI 561

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           +   +FG LGS KY EY +DI  SGQ+LL +IN++L+MSKIE  + ++D +  DL  +++
Sbjct: 562 MSNGMFGTLGSTKYSEYCRDILTSGQYLLEVINDVLDMSKIEAGRTNLDMETLDLTGVLD 621

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
           E +R++      K +  + +   ++   AD+R +K+I+  +LSN++KFT  +G++M R+ 
Sbjct: 622 ESLRVVSGRTSDKGLTFDVRSDDDISIIADRRAVKQIMVNLLSNAVKFTPASGRIMARSK 681

Query: 688 KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
                V +TIADTGIGI   AL ++G+PFE + +Q  ++  G GLGLAI+ +L NLH G 
Sbjct: 682 VFENSVTLTIADTGIGIAPHALRRLGKPFEQVESQLTKTHAGSGLGLAIAKSLVNLHSGS 741

Query: 748 LKIISQEGKGTIVTICMPQ 766
           ++I S+ G GT+V + +P+
Sbjct: 742 MRIRSKPGAGTVVRVTLPR 760


>gi|254713753|ref|ZP_05175564.1| PAS domain S-box-containing protein [Brucella ceti M644/93/1]
 gi|254717189|ref|ZP_05179000.1| PAS domain S-box-containing protein [Brucella ceti M13/05/1]
 gi|261219005|ref|ZP_05933286.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M13/05/1]
 gi|261321495|ref|ZP_05960692.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M644/93/1]
 gi|260924094|gb|EEX90662.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M13/05/1]
 gi|261294185|gb|EEX97681.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M644/93/1]
          Length = 783

 Score =  631 bits (1627), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 422/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+    + +  +       E          T  +  
Sbjct: 36  PAYSKFIVIEPILRRLVPTLIIIFLIIFGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 96  MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 154

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 155 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 214

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 215 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 274

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 275 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 334

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 335 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 392

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 393 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 452

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 453 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 512

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 513 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 572

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 573 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 632

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 633 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 692

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 693 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 752

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 753 STERVGTVVSVCIP 766


>gi|17987608|ref|NP_540242.1| sensory transduction protein kinase [Brucella melitensis bv. 1 str.
           16M]
 gi|23501503|ref|NP_697630.1| sensory box histidine kinase [Brucella suis 1330]
 gi|62289578|ref|YP_221371.1| histidine kinase [Brucella abortus bv. 1 str. 9-941]
 gi|148559697|ref|YP_001258609.1| sensory box histidine kinase [Brucella ovis ATCC 25840]
 gi|161618591|ref|YP_001592478.1| multi-sensor signal transduction histidine kinase [Brucella canis
           ATCC 23365]
 gi|225852141|ref|YP_002732374.1| PAS domain S-box-containing protein [Brucella melitensis ATCC
           23457]
 gi|254688899|ref|ZP_05152153.1| PAS domain S-box-containing protein [Brucella abortus bv. 6 str.
           870]
 gi|254697031|ref|ZP_05158859.1| PAS domain S-box-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701410|ref|ZP_05163238.1| PAS domain S-box-containing protein [Brucella suis bv. 5 str. 513]
 gi|254703955|ref|ZP_05165783.1| PAS domain S-box-containing protein [Brucella suis bv. 3 str. 686]
 gi|254707666|ref|ZP_05169494.1| PAS domain S-box-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|254709750|ref|ZP_05171561.1| PAS domain S-box-containing protein [Brucella pinnipedialis B2/94]
 gi|254729930|ref|ZP_05188508.1| PAS domain S-box-containing protein [Brucella abortus bv. 4 str.
           292]
 gi|256031240|ref|ZP_05444854.1| PAS domain S-box-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|256044318|ref|ZP_05447222.1| PAS domain S-box-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113155|ref|ZP_05454032.1| PAS domain S-box-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256254648|ref|ZP_05460184.1| PAS domain S-box-containing protein [Brucella ceti B1/94]
 gi|256257147|ref|ZP_05462683.1| PAS domain S-box-containing protein [Brucella abortus bv. 9 str.
           C68]
 gi|256264347|ref|ZP_05466879.1| sensory box histidine kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369055|ref|YP_003106563.1| sensory box histidine kinase [Brucella microti CCM 4915]
 gi|260168376|ref|ZP_05755187.1| sensory box histidine kinase [Brucella sp. F5/99]
 gi|260563672|ref|ZP_05834158.1| sensory box histidine kinase [Brucella melitensis bv. 1 str. 16M]
 gi|260566796|ref|ZP_05837266.1| sensory box histidine kinase [Brucella suis bv. 4 str. 40]
 gi|260754384|ref|ZP_05866732.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 6 str. 870]
 gi|260757603|ref|ZP_05869951.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 4 str. 292]
 gi|260761429|ref|ZP_05873772.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260883409|ref|ZP_05895023.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 9 str. C68]
 gi|261221823|ref|ZP_05936104.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           B1/94]
 gi|261315163|ref|ZP_05954360.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis M163/99/10]
 gi|261317281|ref|ZP_05956478.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis B2/94]
 gi|261751949|ref|ZP_05995658.1| multi-sensor signal transduction histidine kinase [Brucella suis
           bv. 5 str. 513]
 gi|261754607|ref|ZP_05998316.1| multi-sensor signal transduction histidine kinase [Brucella suis
           bv. 3 str. 686]
 gi|261757836|ref|ZP_06001545.1| sensory box histidine kinase [Brucella sp. F5/99]
 gi|265988319|ref|ZP_06100876.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis M292/94/1]
 gi|265990730|ref|ZP_06103287.1| multi-sensor signal transduction histidine kinase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265994568|ref|ZP_06107125.1| multi-sensor signal transduction histidine kinase [Brucella
           melitensis bv. 3 str. Ether]
 gi|297247993|ref|ZP_06931711.1| two-component system, PleD family, sensor histidine kinase PleC
           [Brucella abortus bv. 5 str. B3196]
 gi|17983316|gb|AAL52506.1| sensory transduction protein kinase [Brucella melitensis bv. 1 str.
           16M]
 gi|23347410|gb|AAN29545.1| sensory box histidine kinase [Brucella suis 1330]
 gi|62195710|gb|AAX74010.1| histidine kinase [Brucella abortus bv. 1 str. 9-941]
 gi|148370954|gb|ABQ60933.1| sensory box histidine kinase [Brucella ovis ATCC 25840]
 gi|161335402|gb|ABX61707.1| multi-sensor signal transduction histidine kinase [Brucella canis
           ATCC 23365]
 gi|225640506|gb|ACO00420.1| PAS domain S-box-containing protein [Brucella melitensis ATCC
           23457]
 gi|255999215|gb|ACU47614.1| sensory box histidine kinase [Brucella microti CCM 4915]
 gi|260153688|gb|EEW88780.1| sensory box histidine kinase [Brucella melitensis bv. 1 str. 16M]
 gi|260156314|gb|EEW91394.1| sensory box histidine kinase [Brucella suis bv. 4 str. 40]
 gi|260667921|gb|EEX54861.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 4 str. 292]
 gi|260671861|gb|EEX58682.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260674492|gb|EEX61313.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 6 str. 870]
 gi|260872937|gb|EEX80006.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 9 str. C68]
 gi|260920407|gb|EEX87060.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           B1/94]
 gi|261296504|gb|EEY00001.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis B2/94]
 gi|261304189|gb|EEY07686.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis M163/99/10]
 gi|261737820|gb|EEY25816.1| sensory box histidine kinase [Brucella sp. F5/99]
 gi|261741702|gb|EEY29628.1| multi-sensor signal transduction histidine kinase [Brucella suis
           bv. 5 str. 513]
 gi|261744360|gb|EEY32286.1| multi-sensor signal transduction histidine kinase [Brucella suis
           bv. 3 str. 686]
 gi|262765681|gb|EEZ11470.1| multi-sensor signal transduction histidine kinase [Brucella
           melitensis bv. 3 str. Ether]
 gi|263001514|gb|EEZ14089.1| multi-sensor signal transduction histidine kinase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263094621|gb|EEZ18419.1| sensory box histidine kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660516|gb|EEZ30777.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis M292/94/1]
 gi|297175162|gb|EFH34509.1| two-component system, PleD family, sensor histidine kinase PleC
           [Brucella abortus bv. 5 str. B3196]
 gi|326408641|gb|ADZ65706.1| PAS domain S-box-containing protein [Brucella melitensis M28]
 gi|326538363|gb|ADZ86578.1| PAS domain S-box-containing protein [Brucella melitensis M5-90]
          Length = 783

 Score =  631 bits (1627), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 36  PAYSKFIVIEPILRRLVPTLIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 96  MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 154

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 155 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 214

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 215 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 274

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 275 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 334

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 335 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 392

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 393 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 452

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 453 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 512

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 513 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 572

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 573 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 632

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 633 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 692

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 693 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 752

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 753 STERVGTVVSVCIP 766


>gi|254693380|ref|ZP_05155208.1| PAS domain S-box-containing protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261213630|ref|ZP_05927911.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 3 str. Tulya]
 gi|260915237|gb|EEX82098.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 3 str. Tulya]
          Length = 783

 Score =  631 bits (1627), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 36  PAYSKFIVIEPILRRLVPTLIIIFLIILGVARVFSLLAWRDDIELQHKAAISGATAHLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 96  MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 154

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 155 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 214

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 215 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 274

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 275 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 334

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 335 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 392

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 393 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 452

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 453 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 512

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 513 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 572

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 573 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 632

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 633 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 692

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 693 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 752

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 753 STERVGTVVSVCIP 766


>gi|316934884|ref|YP_004109866.1| PAS/PAC sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris DX-1]
 gi|315602598|gb|ADU45133.1| PAS/PAC sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris DX-1]
          Length = 769

 Score =  631 bits (1627), Expect = e-178,   Method: Composition-based stats.
 Identities = 239/738 (32%), Positives = 416/738 (56%), Gaps = 8/738 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L +      + +P++ + FLV I   + +++  +  Q+    N+    L + + 
Sbjct: 25  KPAYHRLLNAEPVLRRAVPLLIIAFLVTIFCGAAVQIIEQSKQKRGAMNRDLGALADLLA 84

Query: 95  IIFQNNNIKFDL--ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASST-KNSHYI 151
              ++  +      AS ++ +++L  L+      +   +++   ++ + A      +  +
Sbjct: 85  ERLEHIGVVRLDRPASIERLQNLLPALIPSWGIAAGRHVIVTSADQRILARVPIGGAPAV 144

Query: 152 GKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLW 211
             +  E++   + +++  +   +                +    G ++I+        + 
Sbjct: 145 DNRFFEVLGAAALTKAGQQGGIVEIVLPGGASALATMHVVKSLPGQVVIVQEDTG--SVL 202

Query: 212 REEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF 271
           R +  L+V   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW++
Sbjct: 203 RSDTALQVTLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRSRIDTALNRGRCGLWDW 262

Query: 272 NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
           +    +   S+SM+ I+G+   N  L+F  +  L+  ++  + EIA  +    V  +D+ 
Sbjct: 263 DLSRGRIFWSQSMFTILGLESRNDLLTFGEVNALVKGEDIDLFEIADELVAGRVDHIDRS 322

Query: 332 FHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           F MRHA G  IW+++R ++ +       ++IGIA+D+TE+  L +R  EAD RL  AIE 
Sbjct: 323 FQMRHAQGHWIWLRMRCELSQEAGSADKHLIGIAVDITEQKSLAERSVEADLRLRDAIET 382

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER- 449
             EA VLWD  +RLV+CN+++Q+ + LPD  + PG +   I +    P +  R  D    
Sbjct: 383 IPEAFVLWDAENRLVLCNSHFQRLHKLPDSAVSPGTSYETILEVGRMPQLRTRLCDNGGV 442

Query: 450 -SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
                + E +L D +WL I+E  T DGG ++VGTDIT +K ++ +L ++  RL+AT+ DL
Sbjct: 443 APGARTFEAQLDDGKWLHISERRTKDGGYVAVGTDITRIKAHEQKLVDNDLRLRATVADL 502

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             ++  LE+Q  +L+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++
Sbjct: 503 KITQTKLEKQAHQLADLARKYGDEKRRAEEANQTKSKFLANMSHELRTPLNAIIGFSEIM 562

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
              +FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE  ++ ++ +  DL   I E
Sbjct: 563 GSGMFGTLGSEKYQEYCHDIMTSGHYLLEVINDILDMSKIEAGRMRLEMEPLDLSKTIGE 622

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            ++++   A+ K++ +  ++  ++   AD+R IK+IL  +LSN++KFT + G++ +R+  
Sbjct: 623 SLKVVAGRAEHKHLDLRAEVGDQIPIVADRRAIKQILINLLSNAVKFTPDAGRVTVRSRI 682

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
            G  +++ IADTGIGIP  +L ++GQPFE + +Q  +S  G GLGLAI+ +L NLHGG +
Sbjct: 683 AGDSIVLMIADTGIGIPPQSLRRLGQPFEQVESQLTKSYHGSGLGLAIAKSLVNLHGGSM 742

Query: 749 KIISQEGKGTIVTICMPQ 766
           ++ S  G+GT+V + +P+
Sbjct: 743 RLRSTLGEGTVVMVSLPR 760


>gi|82699508|ref|YP_414082.1| PAS domain-containing protein [Brucella melitensis biovar Abortus
           2308]
 gi|189023837|ref|YP_001934605.1| sensory box histidine kinase [Brucella abortus S19]
 gi|260545661|ref|ZP_05821402.1| sensory box histidine kinase [Brucella abortus NCTC 8038]
 gi|82615609|emb|CAJ10596.1| PAS domain:PAC motif:ATP-binding region, ATPase-like:Histidine
           kinase A, N-terminal:Bacterial sensor protein,
           C-terminal:Hist [Brucella melitensis biovar Abortus
           2308]
 gi|189019409|gb|ACD72131.1| sensory box histidine kinase [Brucella abortus S19]
 gi|260097068|gb|EEW80943.1| sensory box histidine kinase [Brucella abortus NCTC 8038]
          Length = 783

 Score =  630 bits (1626), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 36  PAYSKFIVIEPILRRLVPTLIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 96  MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 154

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 155 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 214

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 215 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 274

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 275 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 334

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 335 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 392

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 393 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 452

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 453 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 512

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 513 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 572

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 573 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 632

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 633 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 692

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 693 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 752

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 753 STERVGTVVSVCIP 766


>gi|256060749|ref|ZP_05450912.1| PAS domain S-box-containing protein [Brucella neotomae 5K33]
 gi|261324738|ref|ZP_05963935.1| multi-sensor signal transduction histidine kinase [Brucella
           neotomae 5K33]
 gi|261300718|gb|EEY04215.1| multi-sensor signal transduction histidine kinase [Brucella
           neotomae 5K33]
          Length = 783

 Score =  630 bits (1626), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 36  PAYSKFIVIEPILRRLVPTLIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATVHLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 96  MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 154

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 155 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 214

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 215 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 274

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 275 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 334

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 335 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 392

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 393 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 452

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 453 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 512

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 513 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 572

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 573 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 632

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 633 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 692

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 693 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 752

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 753 STERVGTVVSVCIP 766


>gi|163842891|ref|YP_001627295.1| PAS domain-containing protein [Brucella suis ATCC 23445]
 gi|163673614|gb|ABY37725.1| PAS domain S-box [Brucella suis ATCC 23445]
          Length = 783

 Score =  630 bits (1625), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 36  PAYSKFIVIEPILRRLVPTLIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 96  MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 154

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 155 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIALEPESTIFAEWK 214

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 215 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 274

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 275 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 334

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 335 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 392

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 393 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 452

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 453 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 512

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 513 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 572

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 573 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 632

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 633 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 692

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 693 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 752

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 753 STERVGTVVSVCIP 766


>gi|148254533|ref|YP_001239118.1| two-component sensor histidine kinase [Bradyrhizobium sp. BTAi1]
 gi|146406706|gb|ABQ35212.1| putative two-component sensor histidine kinase with a ATP-binding
           domain (C-term) [Bradyrhizobium sp. BTAi1]
          Length = 774

 Score =  630 bits (1624), Expect = e-178,   Method: Composition-based stats.
 Identities = 253/738 (34%), Positives = 422/738 (57%), Gaps = 8/738 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L +      + +P + + FLV I   + ++V  +  Q+   T +    +++ + 
Sbjct: 26  KPAYQRLLTAEPVLRRAVPTLIIAFLVTICLGAFVQVLDQSRQKRAATKRDLTAVSDLLA 85

Query: 95  IIFQNNNIKFD-LASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHY-IG 152
               +  ++ D +A  +  +S+L  ++          +++   +  + A    ++     
Sbjct: 86  DRIGHMAMRPDRVAHIEHLQSLLPDMIPAWGAAPGRHVIVTGADHRILARVPVDAALGEN 145

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSILIINSRVPLLRLW 211
            +I ++I       +      ++E +L + +P   +S  +    G ++II  +  L  +W
Sbjct: 146 DRILDLISTAQLLATPGLQGAVTEITLPNGRPAFAISQLIKALPGRVVIIQEK--LEPIW 203

Query: 212 REEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF 271
             +  L V   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW++
Sbjct: 204 GSDAALSVTLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRGRIDTALNRGRCGLWDW 263

Query: 272 NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
           +    +   S SM+E++G+      L+F  +  L++ D+  +  IA  +    + Q+DQ 
Sbjct: 264 DLSRGRIFWSNSMFEMLGLDNRTDLLTFGEVNALVNSDDIDLFAIADQLVAGDIHQIDQS 323

Query: 332 FHMRHASGADIWIQVRAQMMR-TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           F MRH  G  IW++VR ++ + T + G+++IGIA+D+TE+  L ++  EAD RL  AIE 
Sbjct: 324 FRMRHTEGHWIWLRVRCELSQGTTASGLHLIGIAVDITEQKSLAEKTVEADLRLRDAIET 383

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS 450
            SEA VLWD N+RLV+CN+++QK + LPD  ++PG +   + +    P I  R  D  + 
Sbjct: 384 ISEAFVLWDANNRLVLCNSHFQKLHKLPDSAVIPGTSYETVIEVGKMPEIRTRLHDHSQQ 443

Query: 451 --QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
                + E +L D  WL I+E  T DGG +SVGTDIT +K ++ +L ++  RL+AT+ DL
Sbjct: 444 SPGARTFEAQLDDGSWLHISERRTKDGGYVSVGTDITRIKEHEQKLVDNDLRLRATVIDL 503

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             S+  LERQ  EL+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++
Sbjct: 504 QRSQSALERQAIELADLAEKYSQEKTRAEEANQTKSKFLANMSHELRTPLNAIIGFSEIM 563

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
              +FG LGS KY EY  DI  SGQ+LL +IN+IL+MSKIE  ++ +D +  DL   + E
Sbjct: 564 GSGMFGSLGSEKYQEYCHDILTSGQYLLEVINDILDMSKIEAGRMKLDMEPLDLAKTLAE 623

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            +R++   AQ K + ++  I   +   AD+R  K+I+  +LSN++KFT   G++ +R+  
Sbjct: 624 SLRVVSGRAQDKRLVLDADIEGNIPIVADRRATKQIMVNLLSNAVKFTPEGGRVTMRSRV 683

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
               V++ IADTGIGIP  +L ++G+PFE + +Q  ++  G GLGLAI+ +LT LHGG +
Sbjct: 684 FDDKVVLIIADTGIGIPAQSLARLGRPFEQVESQMTKTYHGSGLGLAIARSLTQLHGGSM 743

Query: 749 KIISQEGKGTIVTICMPQ 766
           ++ S+   GT+V + +P+
Sbjct: 744 RLRSRIESGTVVRVTLPR 761


>gi|225627123|ref|ZP_03785161.1| PAS domain S-box-containing protein [Brucella ceti str. Cudo]
 gi|225617958|gb|EEH15002.1| PAS domain S-box-containing protein [Brucella ceti str. Cudo]
          Length = 798

 Score =  630 bits (1624), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 51  PAYSKFIVIEPILRRLVPTLIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 110

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 111 MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 169

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 170 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 229

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 230 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 289

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 290 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 349

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 350 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 407

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 408 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 467

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 468 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 527

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 528 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 587

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 588 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 647

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 648 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 707

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 708 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 767

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 768 STERVGTVVSVCIP 781


>gi|237815075|ref|ZP_04594073.1| PAS domain S-box-containing protein [Brucella abortus str. 2308 A]
 gi|237789912|gb|EEP64122.1| PAS domain S-box-containing protein [Brucella abortus str. 2308 A]
          Length = 798

 Score =  630 bits (1624), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 51  PAYSKFIVIEPILRRLVPTLIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 110

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 111 MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 169

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 170 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 229

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 230 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 289

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 290 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 349

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 350 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 407

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 408 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 467

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 468 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 527

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 528 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 587

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 588 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 647

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 648 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 707

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 708 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 767

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 768 STERVGTVVSVCIP 781


>gi|306842114|ref|ZP_07474784.1| PAS domain S-box-containing protein [Brucella sp. BO2]
 gi|306287787|gb|EFM59215.1| PAS domain S-box-containing protein [Brucella sp. BO2]
          Length = 783

 Score =  629 bits (1623), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 36  PAYSKFIIIEPILRRLVPTLIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 95

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 96  MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 154

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 155 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 214

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 215 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 274

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 275 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 334

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 335 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 392

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 393 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 452

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 453 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 512

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 513 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 572

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 573 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 632

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 633 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 692

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 693 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 752

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 753 STERVGTVVSVCIP 766


>gi|306840195|ref|ZP_07472975.1| PAS domain S-box-containing protein [Brucella sp. NF 2653]
 gi|306404726|gb|EFM61025.1| PAS domain S-box-containing protein [Brucella sp. NF 2653]
          Length = 769

 Score =  628 bits (1621), Expect = e-178,   Method: Composition-based stats.
 Identities = 270/734 (36%), Positives = 423/734 (57%), Gaps = 7/734 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
              S          + +P + ++FL+ +  + +  +       E          T  +  
Sbjct: 22  PAYSKFIVIEPILRRLVPALIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQ 81

Query: 96  IFQNNNIKFDLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           + +      +  +Q   K  +  + +L ++    S   I +     ++ A+S   +   G
Sbjct: 82  MIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAAS-GPAGIAG 140

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            +I  I+ +       ++   +    L  +              SI+ +     +   W+
Sbjct: 141 SQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWK 200

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
             V+L V  F+    ++  IL++Y+ QA + +E D +  +    ++ AL+RGRCGLW+++
Sbjct: 201 RAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWD 260

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               + + SRSMYE++G   ++  L F  +A +I+ ++  +  IA       +  +D++F
Sbjct: 261 MARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF 320

Query: 333 HMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            MRHA G+ +W++VRA++     G ++++GIA D++E++   ++ AEAD R+ +AIE  S
Sbjct: 321 RMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS 378

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQ 451
           EA VLWD N+RLVM N+ + +  GLP   L PG  R+ +         E R ++   R+ 
Sbjct: 379 EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAG 438

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +
Sbjct: 439 GQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIA 498

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+  
Sbjct: 499 RKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAG 558

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R
Sbjct: 559 TFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVR 618

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +I   A+ KNI +E +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G 
Sbjct: 619 IISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGA 678

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I 
Sbjct: 679 ALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIR 738

Query: 752 SQEGKGTIVTICMP 765
           S E  GT+V++C+P
Sbjct: 739 STERVGTVVSVCIP 752


>gi|91976495|ref|YP_569154.1| ATP-binding region, ATPase-like [Rhodopseudomonas palustris BisB5]
 gi|91682951|gb|ABE39253.1| ATP-binding region, ATPase-like [Rhodopseudomonas palustris BisB5]
          Length = 771

 Score =  628 bits (1620), Expect = e-178,   Method: Composition-based stats.
 Identities = 242/754 (32%), Positives = 416/754 (55%), Gaps = 11/754 (1%)

Query: 22  ITVSSKQAFKRAY-TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEK 80
           +   S +   ++        L +      + +P++ + FLV I   + ++V  +  Q+  
Sbjct: 11  VQSDSIKGLAQSIAKPAYHRLLTAEPVLRRAVPILIIAFLVTICFGAAVQVIDQSRQKRA 70

Query: 81  MTNQTSLMLTEAIEIIFQNNNIKFD--LASQKKAESMLGQLLAKTRFLSESFILLAQPNE 138
             N+    L + +    ++  +      AS ++ +S+L  L+      +   +++   ++
Sbjct: 71  ALNRDLSALADLLAERLEHIGVVRLDRAASIERLQSLLPGLVPSWGIAAGRHVIVTGADQ 130

Query: 139 LVFASSTKNSHYIGK-KIGEIIPELSRSRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSG 196
            V A    +       +  +II         S+   +SE +L            +    G
Sbjct: 131 RVLARVPGDEGASAANRFLDIISATPTLTKSSQQGVLSEITLPSGASALATLHTIKSLPG 190

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
            ++II        + R +  L++   +    ++L + F+++ Q+ + +E D I       
Sbjct: 191 QVIIIQEDTG--SILRSDAALQITLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRSR 248

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++TAL+RGRCGLW+++    +   S+SM+ ++G+   N  L+F  +  L++ D+  +  I
Sbjct: 249 IDTALNRGRCGLWDWDLSRGRIFWSQSMFTLLGLESRNDLLTFGEVNALVNSDDIDLFTI 308

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEK 375
              +       +D  F MRHA+G  IW+++R ++ +       ++IGIA+D+TE+  L +
Sbjct: 309 GDELIAGAADHIDHSFRMRHANGHWIWLRMRCELSQESPTENKHLIGIAVDVTEQKSLAE 368

Query: 376 RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQ 435
           R  EAD RL  AIE   EA VLWD ++RLV+CN+++Q+ + LPD  + PG +   + +  
Sbjct: 369 RTVEADLRLRDAIETLPEAFVLWDSDNRLVLCNSHFQRLHKLPDSAIAPGTSYETVIEVG 428

Query: 436 TRPIIEYRTSDPERS---QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQA 492
             P I  R  D          + E +L D  WL I+E  T DGG ++VGT+IT +K ++ 
Sbjct: 429 QMPEIRTRQCDVGAGSPPGARTFEAQLDDGSWLHISERRTKDGGYVAVGTNITRIKAHEQ 488

Query: 493 QLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSH 552
           +L ++  RL+AT+ DL  S+  LERQ  EL+    KY  EK RAE AN+ KS+FLA MSH
Sbjct: 489 KLVDNDLRLRATVADLKISQVKLERQAIELADLARKYSEEKNRAEEANQAKSKFLANMSH 548

Query: 553 ELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEK 612
           ELRTPLNAI+GFSE++   +FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE  +
Sbjct: 549 ELRTPLNAIIGFSEIMGSGMFGTLGSEKYQEYCHDIMTSGHYLLEVINDILDMSKIEAGR 608

Query: 613 ISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNS 672
           + ++ +  DL   + E ++++   A +K++++  +I   +   AD+R IK+IL  +LSN+
Sbjct: 609 MRLEMEELDLARTLGESLKVVAGRADNKHLELRAEIEDGIPIVADRRAIKQILINLLSNA 668

Query: 673 IKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGL 732
           +KFT + G++ +R+  +   +++ IAD+GIGI   +L ++GQPFE + +Q  ++  G GL
Sbjct: 669 VKFTPDGGRVTVRSRTLEDSIVMMIADSGIGIAPQSLRRLGQPFEQVESQLTKTYHGSGL 728

Query: 733 GLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           GLAI+ +LT LHGG +++ S  G GT+V + +P+
Sbjct: 729 GLAIAKSLTRLHGGSMRLRSTLGAGTVVMVTLPR 762


>gi|154245571|ref|YP_001416529.1| PAS/PAC sensor signal transduction histidine kinase [Xanthobacter
           autotrophicus Py2]
 gi|154159656|gb|ABS66872.1| PAS/PAC sensor signal transduction histidine kinase [Xanthobacter
           autotrophicus Py2]
          Length = 770

 Score =  627 bits (1617), Expect = e-177,   Method: Composition-based stats.
 Identities = 247/742 (33%), Positives = 398/742 (53%), Gaps = 10/742 (1%)

Query: 28  QAFKRAY-TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTS 86
           +   R+        L        + +P + + FLV I   +++++      +        
Sbjct: 17  RGLARSIARPAYQRLLDAEPVLRRIVPALIVTFLVVIGVGAVVQIHAHRVAELNNAKDDL 76

Query: 87  LMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTK 146
            +L  A               S  +  S L + L      S     +      + AS+ +
Sbjct: 77  SLLALATA----EGLTLRAGNSLARVPSALEESLPPRATESGRRAYVTDAQGRIIASAPR 132

Query: 147 NSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVP 206
           +       + ++I         ++   + E             NL    G I+ +     
Sbjct: 133 SEAPAN--LADLIDPAQPLVIFAERAGVLEVPFGTGTALATVRNLSAPLGQIVFLQPTER 190

Query: 207 LLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRC 266
            L  W +  TL V  F+    +LL + FS++ QA + +E D I       ++TAL+RGRC
Sbjct: 191 ALASWSDSTTLTVTLFTTTGTVLLILGFSFHWQASRAREADAIYDTVRRRIDTALNRGRC 250

Query: 267 GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK 326
           G+W+++    + + S +M+EI+G+  +++ +SF  IA+L+H D+  + E+A+ +  +   
Sbjct: 251 GMWDWDMARGRMYWSDTMFEILGLERKDELVSFGEIAKLVHPDDGDLYELAQELAERPGT 310

Query: 327 QLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLS 385
            +D++F MR A G  +W+++RA++++     G ++IGIAMD+TE   + +R   AD RL 
Sbjct: 311 PVDRVFRMRTAKGDFVWLRMRAEVVQQQGEDGPHLIGIAMDVTEAQRMAERTVTADMRLR 370

Query: 386 KAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTS 445
            AIE  SEA VLWD  +RLV+CN+ +Q  + LPD  +  G    +I      PI      
Sbjct: 371 DAIESISEAFVLWDSQNRLVLCNSKFQSLHELPDEAIHAGTPFDVIASVGRHPITRTPLK 430

Query: 446 DPE--RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKA 503
             +       + E +L++ RWL+I E  T D G +SVGTDIT +K ++ +L ++++RL A
Sbjct: 431 PEDKPEEGSRAFEAQLSNGRWLKIAERRTKDNGYVSVGTDITTMKRHEERLMDNEKRLMA 490

Query: 504 TINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILG 563
            + DL  S+Q LE Q  +L+    KY  E+ +AE AN+ KSEFLA MSHELRTPLNAI+G
Sbjct: 491 LVADLRKSQQTLEHQAQQLAELAEKYSEERNKAEDANRAKSEFLANMSHELRTPLNAIIG 550

Query: 564 FSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLI 623
           FSE+++  +FG LGS KY EY  DI  SG +LL++IN+IL+MSKIE  ++ ++ ++  L 
Sbjct: 551 FSEIMESGMFGPLGSEKYAEYCTDIKGSGTYLLDVINDILDMSKIEAGRMQLEVEDLALD 610

Query: 624 PIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMM 683
            II + +R+   +   KNI +       L    D+R +K+IL  +LSN++KFT   G + 
Sbjct: 611 DIIADALRVTAVNGDEKNIAMTMAAAPNLAIKGDRRALKQILLNLLSNAVKFTPEGGNIA 670

Query: 684 IRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNL 743
           ++    G   +I I DTGIGI K AL +IG+PFE + +Q+ ++  G GLGLAI+ +L  L
Sbjct: 671 VKARINGAAAVIAIEDTGIGIAKDALARIGRPFEQVESQFTKTHKGSGLGLAIAKSLVEL 730

Query: 744 HGGRLKIISQEGKGTIVTICMP 765
           HGG ++I S EG+GT V + +P
Sbjct: 731 HGGAMRIRSVEGRGTTVIVRLP 752


>gi|90423355|ref|YP_531725.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisB18]
 gi|90105369|gb|ABD87406.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisB18]
          Length = 775

 Score =  627 bits (1617), Expect = e-177,   Method: Composition-based stats.
 Identities = 247/740 (33%), Positives = 414/740 (55%), Gaps = 10/740 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L +   +  + +P + + FL+ I   + +++  +  Q+   TN+    L + + 
Sbjct: 25  KPAYHRLLTAEPALRRAVPTLIIAFLITICFGASVQIIDQTRQKRTATNRDLAALADLLA 84

Query: 95  IIFQNNNIKFD---LASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYI 151
                          AS  + + +L  L+         +I++   ++ + A    +    
Sbjct: 85  ERIDRAGSPRQQDRAASIGRLQGLLPGLVPAWGIAVGRYIIVVGADQSILARLPVDVPVG 144

Query: 152 GKK-IGEIIPELSRSRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSILIINSRVPLLR 209
               I E++       + +    +++ +L D +        +    G ++II     +  
Sbjct: 145 DATRILEVLSATQPLTASAPQSGITDIALPDGRTAIATQRVIRSLPGQVVIIQE--NVEP 202

Query: 210 LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLW 269
           +WR +  L +   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW
Sbjct: 203 IWRSDTALSITLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRGRIDTALNRGRCGLW 262

Query: 270 NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD 329
           +++    +   S+SM+ ++G+   +  L+F  +  L+  D+  +  IA  +    + Q+D
Sbjct: 263 DWDLSRGRIFWSQSMFTMLGLESRSDLLTFGEVNALVKSDDIDLFAIANQLITGTISQID 322

Query: 330 QIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
             F M+HA+G  IW++VR ++ +     G ++IGIA+D+TE   L +R  EAD RL  AI
Sbjct: 323 HTFRMQHANGHWIWLRVRCELSQGAGDAGTHLIGIAVDITEHKSLAERTVEADLRLRDAI 382

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
           E   EA VLWD  +RLV+CN+++Q+ + LPD  + PG +   + +  T P    R  +  
Sbjct: 383 ETIPEAFVLWDAENRLVLCNSHFQRLHKLPDSAVTPGTSYETVVEVGTMPEARTRLPEAG 442

Query: 449 R--SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
                  + E +L + +WL I+E  T DGG ++VGTDIT +K ++ +L E+  RL+AT+ 
Sbjct: 443 HHPPGARTFEAQLDNGKWLHISERRTKDGGYVAVGTDITRIKEHEQKLVENDLRLRATVV 502

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL  S+  LERQ  EL     KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE
Sbjct: 503 DLKRSQATLERQAVELVDLAQKYSEEKNRAEDANQTKSKFLANMSHELRTPLNAIIGFSE 562

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           ++   +FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE  ++ +D +  DL   +
Sbjct: 563 IMGSGMFGSLGSEKYQEYCHDILTSGHYLLEVINDILDMSKIEAGRMKLDLEPFDLATTL 622

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
           +E +R++   A +K + +   I +++   AD+R IK+IL  +LSN++KFT + G++ +R 
Sbjct: 623 SESLRVVSGRADNKQLMLRADIDNDIPVLADRRAIKQILVNLLSNAVKFTPDGGRVTVRG 682

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
               + +++ IADTGIGI K +L ++GQPFE + +Q  ++  G GLGLAI+ +LTNLHGG
Sbjct: 683 RVFEEQIVLLIADTGIGIAKQSLRRLGQPFEQVESQLTKTYHGSGLGLAIAKSLTNLHGG 742

Query: 747 RLKIISQEGKGTIVTICMPQ 766
            +++ SQ G GT+V + +P+
Sbjct: 743 SMRLRSQLGVGTVVRVALPR 762


>gi|319408254|emb|CBI81907.1| two-component sensor histidine kinase [Bartonella schoenbuchensis
           R1]
          Length = 772

 Score =  627 bits (1616), Expect = e-177,   Method: Composition-based stats.
 Identities = 255/736 (34%), Positives = 410/736 (55%), Gaps = 10/736 (1%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAI-- 93
           SI   L S      ++IP I ++FL+ +A    + +       +K T  T  +L   I  
Sbjct: 37  SIHKKLLSIEPWLRRSIPFIIILFLIVLAAVRFVSIYDLRHTIDKDTRSTMNLLAAYIVN 96

Query: 94  ----EIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSH 149
               ++       K    S    E +L  L  +    + + I +   NE V ASS  +  
Sbjct: 97  TIDRDLSTVTKQGKTTSLSHSHLEDILVDLRNQNLVNTNTIIAIVDQNENVLASS-SSEV 155

Query: 150 YIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLR 209
            +GK +   I E +   S  +    ++  +  +P   L     ++  S+ +      +  
Sbjct: 156 ILGKPLKNFISENAALESLKQHTGATQIKIGTEPALALLSQTKNSQYSVFMSEKTHDIYM 215

Query: 210 LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLW 269
            WR+  +L +  F   + ++L +L++YY Q  +    D +  +    ++ A+ RGRCGLW
Sbjct: 216 EWRKIFSLNMTLFIGTTGIILALLYAYYNQVSRAHNMDLVSEKNQNRIDMAMMRGRCGLW 275

Query: 270 NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD 329
           ++N  + + + SR+MYE++G   ++  LS   I  +I+  +    ++A+ +     K +D
Sbjct: 276 DWNMASGRVYWSRAMYEMLGYVPQDALLSISQITAIINPTDTNFFDLAQELMSGEKKHID 335

Query: 330 QIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
               MRHA G  IW++ RA++  T     +++GI+ D++E+  L ++ A+AD R+  AIE
Sbjct: 336 INIPMRHADGHYIWMRFRAEV--TEGEEPHLVGISFDISEQRQLAEQTAQADLRIRDAIE 393

Query: 390 CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
             SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ + +A  RP I       + 
Sbjct: 394 NISESFVLWDSEGRLVMSNSKFCEYAAIPKQMLQSGIQRATV-EAMARPAISEYLLKEDG 452

Query: 450 SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
           + +++   + AD  WL+INE  T DGG +  GTDI+ LK  Q + + S++ L + I +L 
Sbjct: 453 TGNLTSIRQTADGCWLKINERRTQDGGLVCTGTDISELKQQQEKFKNSEKSLFSFIQELK 512

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
            +R   +++ TE+   N   Q EKERAE+ANK KSEFLA +SHELRTPLNAILGFS+++ 
Sbjct: 513 RARGNAQQRATEVEKLNKSLQAEKERAESANKAKSEFLANISHELRTPLNAILGFSDIML 572

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
           +  FG LGS +Y EY +DIH SG HLL +IN+IL+MSKIE  + ++D +N DL PII+E 
Sbjct: 573 QSTFGPLGSQRYKEYMRDIHNSGTHLLTLINDILDMSKIEAGRFTLDCKNIDLGPIISEA 632

Query: 630 IRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
           +R +   AQ K + + + I  +L    D R I++I   ++SN++KFT + G + +   + 
Sbjct: 633 VRTLTPQAQEKKVSVTENIAPKLHAEVDCRAIRQIFLNLISNAVKFTPSGGNIDVCAFQK 692

Query: 690 GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
              +I  I DTG+GIP++A++K+GQPFE + NQ+ ++  G GLGLAIS +L  LH G+L+
Sbjct: 693 ENNLIFKIKDTGVGIPQAAIKKLGQPFEQVENQFTKTHTGSGLGLAISRSLVKLHKGKLE 752

Query: 750 IISQEGKGTIVTICMP 765
           I S+E KGT VTI MP
Sbjct: 753 ITSKEEKGTTVTITMP 768


>gi|110633259|ref|YP_673467.1| multi-sensor signal transduction histidine kinase [Mesorhizobium
           sp. BNC1]
 gi|110284243|gb|ABG62302.1| multi-sensor signal transduction histidine kinase [Chelativorans
           sp. BNC1]
          Length = 774

 Score =  626 bits (1615), Expect = e-177,   Method: Composition-based stats.
 Identities = 287/755 (38%), Positives = 445/755 (58%), Gaps = 2/755 (0%)

Query: 12  GLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKV 71
            L+  G R K         K         L +      + IP++ ++FL+ +A + ++ +
Sbjct: 12  ALFSRGGRPKAETEVAGNAKIIAAPAYERLLAIEPYLRRAIPILIVIFLLILAAARLVTL 71

Query: 72  TTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFI 131
              +   EK T +   M+   +    Q   ++  LA   +AE ++ + + +    +   +
Sbjct: 72  LNWHGDIEKDTKRHLGMVASNLAQAVQIAGVES-LAEVGQAEVLIDETILRASMDAGWVL 130

Query: 132 LLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNL 191
            L      V A S       G+ +  ++              + E  + +  ++     L
Sbjct: 131 ALTDSRFAVTAVSASAQKMKGQSLETVVSGGQPLFMFGDRAGVLEVQIGEATWYAAVSLL 190

Query: 192 PHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILL 251
           P   G+ + +  +  +   WR  V+L V  F++ + +L+ IL++Y+ QA + +  D I  
Sbjct: 191 PGGDGAAVALAPQDQVFGAWRSTVSLNVTLFALTAGVLMAILYAYFSQAARAQAADRIYR 250

Query: 252 EANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNK 311
           EA+  V+ AL RG+CGLW+++    K + S SMYE++G    +  LSF  +A L+H D+ 
Sbjct: 251 EAHQRVDLALVRGKCGLWDWDMARGKMYWSASMYEMLGYEAADVMLSFGDVASLLHPDDS 310

Query: 312 KICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKY 371
            +  +A  +  + V+Q+DQ+F MRHA+G  IWI+ RAQ++   +  +++IGIA+D+TE+ 
Sbjct: 311 DLFAVANRIVAREVEQVDQVFRMRHANGQWIWIRARAQVVDPDAPEIHLIGIAVDVTEQR 370

Query: 372 HLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSII 431
            L ++   ADQRL  AIE  +E+ VLWD ++RLVMCN+ Y +  GL    +VPG  R  I
Sbjct: 371 TLVQQSEAADQRLRTAIENITESFVLWDASERLVMCNSRYLQDTGLDPSEIVPGLPRQEI 430

Query: 432 QDAQTRPIIEYRTS-DPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHN 490
           +        E R +     S+ ++ E +LAD RWLQ+ E  T DGGT+SVGTDIT LK +
Sbjct: 431 ESRMKATRYERRLTGSNNASEGITYERQLADGRWLQVTELKTRDGGTVSVGTDITQLKQH 490

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKM 550
           Q +L ES+RRL ATI+DLS +R+  + +  EL   N KY  E ERAE+AN+ KSEFLA M
Sbjct: 491 QEKLVESERRLMATIHDLSLARRAEQERGQELVELNRKYMRETERAESANRAKSEFLANM 550

Query: 551 SHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIET 610
           SHELRTPLNAI+GFSE++++ +FG LGS +Y EY  DI+ SG +LL +IN+IL+MSKIE 
Sbjct: 551 SHELRTPLNAIIGFSELMQQGLFGPLGSERYQEYVNDIYSSGTYLLGVINDILDMSKIEA 610

Query: 611 EKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILS 670
            + SI +++ DL  +I E +R++   A  KNI++   +P+ L  +AD+R +K+IL  +L 
Sbjct: 611 GQFSIHRESIDLSEVIRETMRVVTLQAGKKNIELTSDVPASLSLHADRRAVKQILINLLF 670

Query: 671 NSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGF 730
           N++KFT   G++ +R   +   +++TI DTG GIP+ AL+K+G+PFE + NQY +S  G 
Sbjct: 671 NAVKFTGQGGRVTLRARVVSNSLMLTIKDTGCGIPREALKKLGRPFEQVENQYSRSHNGS 730

Query: 731 GLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GLGLAIS +LT LHGG L+I S EG GTIV+I +P
Sbjct: 731 GLGLAISRSLTELHGGALRIRSTEGVGTIVSIRLP 765


>gi|298290750|ref|YP_003692689.1| multi-sensor signal transduction histidine kinase [Starkeya novella
           DSM 506]
 gi|296927261|gb|ADH88070.1| multi-sensor signal transduction histidine kinase [Starkeya novella
           DSM 506]
          Length = 770

 Score =  623 bits (1606), Expect = e-176,   Method: Composition-based stats.
 Identities = 253/749 (33%), Positives = 415/749 (55%), Gaps = 12/749 (1%)

Query: 22  ITVSSKQAFKRAY-TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEK 80
           + V +     R+        L        + +P + + F+  +A ++++++    A    
Sbjct: 11  VRVQAMGGLARSVARPAYQRLVEAEPFMRKAVPALIIAFIASVAIAALVQIRAYRADAVA 70

Query: 81  MTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELV 140
                  +   AI      +            + +L   L            L      V
Sbjct: 71  NAKDELALFAAAISSEIGRHGTGTT------PDVLLSSSLPPRATEDARRYGLVDSAGKV 124

Query: 141 FASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSIL 199
            A+  + +    ++IG+++         ++   + + S+ D  P      NLP     ++
Sbjct: 125 VAAHDEVAAA-REQIGQLLANTQALTIFAENAGVLDVSMPDGSPALATVRNLPGVPYQLV 183

Query: 200 IINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVET 259
           ++      L  W+ +  L V   S   A+LL + F+++ QA + +E D I       ++T
Sbjct: 184 VVQPLAGALATWQSDTILTVTLLSTTGAVLLILGFAFHWQASRAREADGIYDTVRARIDT 243

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
           ALSRGRCGLW+++    +   S SM+E++G    ++ +SF  +A L+H D+  + +IA+ 
Sbjct: 244 ALSRGRCGLWDWDMGRGRMFWSESMFEMLGFEPRDELISFGEVASLVHTDDTNLYDIAKE 303

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYA 378
           +  K  + +D++F M+HA G  +W++ RA+++   +G   +++GIA+D+TE+  L +R A
Sbjct: 304 IADKPGRTIDRVFRMKHADGHWVWLRARAEVVPQDNGEPPHLVGIAVDVTEERRLAERTA 363

Query: 379 EADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRP 438
            AD RL  AIE  SE+ VLWD ++RLVMCN+ +Q  +G  D  + PG     +     +P
Sbjct: 364 TADMRLRDAIESISESFVLWDASNRLVMCNSKFQSLHGFGDANVAPGTEFETVAALARQP 423

Query: 439 IIEYRTSDPERSQD--MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRE 496
           ++       +R ++   + E +L   RWL++ E  T DGG +SVGTDIT LK ++ +L E
Sbjct: 424 VVRIPLRPEDRPEEGARAFEAQLEGGRWLKVTERRTKDGGYVSVGTDITALKRHEERLME 483

Query: 497 SKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
           S++RL A + DL  S+Q LE Q  +L+     Y  EK +AE AN+ KSEFLA MSHELRT
Sbjct: 484 SEKRLMALVADLRKSQQTLEMQALQLAELAQNYADEKTKAEDANRAKSEFLANMSHELRT 543

Query: 557 PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
           PLNAI+GFSE+++  +FG LGS KY EY +DI  SG++LL++IN+IL+MS+IE  ++ ++
Sbjct: 544 PLNAIIGFSELMESGLFGPLGSDKYNEYCRDIRDSGRYLLDVINDILDMSRIEAGRMHLN 603

Query: 617 KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFT 676
            Q  +L  ++ + IR++   A  K I +       +   ADKR +K+I   +LSN+IKFT
Sbjct: 604 LQPVELDEVVTDSIRVMSVRADEKQITVAADTDGAVSLEADKRALKQITLNLLSNAIKFT 663

Query: 677 NNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAI 736
             NG++ +RT +  +  ++ I D+GIGIPK+AL KIG+PFE + +Q+ ++  G GLGLAI
Sbjct: 664 PENGRVSVRTRRSARAALLVIEDSGIGIPKAALAKIGKPFEQVESQFTKTHKGSGLGLAI 723

Query: 737 SDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + +L  LHGG ++I S EG GT V I +P
Sbjct: 724 AKSLVELHGGTMRIRSSEGVGTTVIIRLP 752


>gi|299133557|ref|ZP_07026751.1| multi-sensor signal transduction histidine kinase [Afipia sp.
           1NLS2]
 gi|298591393|gb|EFI51594.1| multi-sensor signal transduction histidine kinase [Afipia sp.
           1NLS2]
          Length = 812

 Score =  622 bits (1603), Expect = e-175,   Method: Composition-based stats.
 Identities = 263/752 (34%), Positives = 418/752 (55%), Gaps = 13/752 (1%)

Query: 22  ITVSSKQAFKRAY-TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEK 80
           +   S +   ++      + L        + +P++ + FLV I   + ++V  +  Q+  
Sbjct: 11  VQSDSIKGLAQSIAQPAYNRLLIAEPLLRRAVPILIIAFLVTILIGAFVQVLDQNRQKHA 70

Query: 81  MTNQTSLMLTEAI-EIIFQNNNIKFDLA-SQKKAESMLGQLLAKTRFLSESFILLA--QP 136
            T +    L + + E I      + D A S  K +S L  L+      S   IL+     
Sbjct: 71  ATTREIASLADLMKERIDHLAARRPDRALSATKLQSTLPALVPPWASASGRHILITGLDR 130

Query: 137 NELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSG 196
            E V  +   ++         + P   ++ + +    +     D +        L   SG
Sbjct: 131 QEGVQLALDGSNDA---AFDAVTPAQVQALNDTGEAVIELPLPDGRMALAAQRTLDTASG 187

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           S++++         WR +  L++   +    ++L + F+++ Q+ + +E+D I       
Sbjct: 188 SVIVMQ--AQNAASWRSDTALQITLSATTGFVVLILGFAFHWQSTRARESDLINDAVRGR 245

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++TAL+RGRCGLW+++    +   S+SM+ ++G+   N  L+F  +  L+H ++  +  I
Sbjct: 246 IDTALNRGRCGLWDWDLSRGRIFWSQSMFTMLGLESRNDLLAFGEVNALVHSEDIDLMAI 305

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEK 375
           A  +    +  +DQ F MRHA G  IW+ VR ++     +GG ++IGIA+D+TE+  L  
Sbjct: 306 ADQLLSGQISHIDQTFRMRHADGHWIWLCVRCELTEAGSNGGCHLIGIALDITEQKSLAA 365

Query: 376 RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQ 435
           R  EAD RL  AIE   EA VLWD  +RLV+CN+++Q+ + LPD  +  G     + +  
Sbjct: 366 RSVEADLRLRDAIETIPEAFVLWDSENRLVLCNSHFQRLHKLPDSAVTAGTPYETVIEVG 425

Query: 436 TRPIIEYRTSDPE--RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
             P I  R +D E       + E +L D  WL I+E  T DGG +SVGTDIT +K ++ +
Sbjct: 426 HMPEIRARVADTEISAPGSRTFEAQLNDGSWLNISERRTKDGGFVSVGTDITQIKRHEQR 485

Query: 494 LRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
           L ++  RL A + DL  S+  LE+Q  EL+    KY  EK RAE AN+TKS+FLA MSHE
Sbjct: 486 LVDNDLRLTAYVVDLKRSQAALEQQARELADLAQKYAEEKRRAEEANQTKSKFLANMSHE 545

Query: 554 LRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKI 613
           LRTPLNAI+GFSEV+ + +FG LGS +Y EY QDI  SG +LL++IN++L+MSKIE  ++
Sbjct: 546 LRTPLNAIIGFSEVMGRGMFGPLGSGRYQEYCQDILTSGNYLLDVINDVLDMSKIEAGRM 605

Query: 614 SIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSI 673
            +D +  DL   ++E  R+  S A  K + ++ +I   +   AD+R +K+IL  +LSN++
Sbjct: 606 KLDPEKLDLAETVSESTRVASSWADGKRLTLDSRIDGAIPIVADRRAMKQILVNLLSNAV 665

Query: 674 KFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLG 733
           KFT + G++++R+  IG  V++TIADTGIGIPK AL ++G PFE + +Q  +S  G GLG
Sbjct: 666 KFTPDGGRIVVRSRIIGDRVMVTIADTGIGIPKEALARLGCPFEQVESQLTKSYHGSGLG 725

Query: 734 LAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           LAI+ +L  LH G +K+ SQ   GT+V I +P
Sbjct: 726 LAIAKSLVQLHSGSMKLRSQLHIGTVVRINLP 757


>gi|27378251|ref|NP_769780.1| two-component sensor histidine kinase [Bradyrhizobium japonicum
           USDA 110]
 gi|27351398|dbj|BAC48405.1| two-component sensor histidine kinase [Bradyrhizobium japonicum
           USDA 110]
          Length = 776

 Score =  619 bits (1597), Expect = e-175,   Method: Composition-based stats.
 Identities = 244/741 (32%), Positives = 419/741 (56%), Gaps = 11/741 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L     +  + +P + + FL+ I   + ++V  +  Q+  +       L + + 
Sbjct: 25  KPAYHRLLIAEPALRRAVPTLIIAFLITICLGAFVQVVDQTRQKRLVIRHDISALADLLA 84

Query: 95  --IIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLA--QPNELVFASSTKNSHY 150
             I    ++ +  L + +   ++L  L+      +   +++     +  + A    +S  
Sbjct: 85  ERIDRLTSSRQERLKNIESLPALLPDLIPSWGTATGRHVIVTSAGVDRRILARIPVDSDP 144

Query: 151 IG-KKIGEIIPELSRSRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSILIINSRVPLL 208
            G  ++ + I       +  +   +S+ +L +      +S  +    G + +I  R    
Sbjct: 145 SGNDRLLDSITTAQLLAAPPRDGNISDMTLPNGNAAMAISRQIKSLPGFVTVIQER--NE 202

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
            +W  +  L V   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGL
Sbjct: 203 PIWGSDAALSVTLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRGRIDTALNRGRCGL 262

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           W+++    +   S+SM+ ++G+   N+ L+F  +  L+  D+  + EIA  +  + +  +
Sbjct: 263 WDWDLSRGRIFWSQSMFSMLGLDGRNELLTFGEVNALVKSDDIDLFEIADQLISEKIDHI 322

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
           DQ F M+H  G  IW++VR +         +++IGIA+D+TE+  L +R  EAD RL  A
Sbjct: 323 DQTFRMQHVDGHWIWLRVRCEKTSGATDSSVHLIGIAVDITEQKSLAERTVEADLRLRDA 382

Query: 388 IECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD- 446
           IE   EA VLWD +DRLV+CN+++Q+ + LPD  ++PG +   + +    P +  R ++ 
Sbjct: 383 IETIPEAFVLWDASDRLVLCNSHFQRLHKLPDSAVIPGTSYETVLEVGRMPEVRTRHNET 442

Query: 447 -PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATI 505
             +     + E +L D  WL I+E  T DGG +SVGTDIT +K ++ +L ++  RL+AT+
Sbjct: 443 AAQGPGARTFEAQLDDGSWLHISERRTKDGGYVSVGTDITRIKEHEQKLVDNDLRLRATV 502

Query: 506 NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS 565
            DL  S+  LERQ  EL+    KYQ EK RAE AN+TKS+FLA MSHELRTPLNAI+GFS
Sbjct: 503 IDLKRSQAALERQTNELADLAEKYQREKTRAEEANQTKSKFLANMSHELRTPLNAIIGFS 562

Query: 566 EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPI 625
           E++   +FGELGS KY EY QDI  SG +LL +IN+IL+MSKIE  ++ +D +  DL   
Sbjct: 563 EIMGSGLFGELGSEKYQEYCQDILTSGHYLLEVINDILDMSKIEAGRMKLDMEELDLART 622

Query: 626 INEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR 685
           + E +R++   AQ K++ ++  I   +   AD+R  K+I+  +LSN++KFT + G++++R
Sbjct: 623 LAESLRVVSGRAQDKHLTLDADIEKSISVVADRRATKQIIVNLLSNAVKFTPDGGRIVVR 682

Query: 686 TSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
           + ++   +++ IADTGIGI   +L ++G+PFE + +Q  ++  G GLGLAI+ +L  LHG
Sbjct: 683 SRQLDDRIVLMIADTGIGIAPHSLARLGRPFEQVESQLTKTYHGSGLGLAIARSLAQLHG 742

Query: 746 GRLKIISQEGKGTIVTICMPQ 766
           G +++ S+   GT+V + +P+
Sbjct: 743 GSMRLRSKIDVGTVVRVTLPR 763


>gi|319898572|ref|YP_004158665.1| two-component sensor histidine kinase [Bartonella clarridgeiae 73]
 gi|319402536|emb|CBI76079.1| two-component sensor histidine kinase [Bartonella clarridgeiae 73]
          Length = 769

 Score =  618 bits (1594), Expect = e-174,   Method: Composition-based stats.
 Identities = 257/747 (34%), Positives = 409/747 (54%), Gaps = 14/747 (1%)

Query: 27  KQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTS 86
           K    R   S    L        ++IP   ++ L+ + T     +       +K    T 
Sbjct: 25  KVGISRISNSTYQKLLFIEPWLRRSIPFAIIISLIVLTTIRFASLYNWRHTIDKNARSTL 84

Query: 87  LMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF--------ILLAQPNE 138
            +L+  I      + +      QKKA  +    L                  I +   N 
Sbjct: 85  SLLSSYIVNKIDRDLLAS--TQQKKAAVLSPNHLQNILINFHHHNFTSINPTIAIIDQNR 142

Query: 139 LVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSI 198
            V ASS+ +     K + + I E     S  K   + + ++ ++P       + ++   +
Sbjct: 143 NVLASSSSDIILE-KPLQDFIAENIDLWSLKKNTGIIKITIGKEPALASFSQIDNSQYRV 201

Query: 199 LIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE 258
            I  ++  +   W+++ +L +      ++++L +L++YY Q  + +  D    +     +
Sbjct: 202 FISATKKNIYMEWQKKFSLNITLLIGTASIILVLLYAYYNQIIRARNTDLTSEKIQNRTD 261

Query: 259 TALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIAR 318
            A+ RGRCGLW++N  N + + SR+MYE++G   +N  LS   I  +I   +    EIA+
Sbjct: 262 MAMMRGRCGLWDWNMANGRVYWSRAMYEMLGYAPQNALLSISQITAIIDPKDANFFEIAQ 321

Query: 319 SVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYA 378
            +     K +D    MRHA G  +W+++RA++  T     +++GI+ D++E+    ++ A
Sbjct: 322 ELMSGAKKHIDINVPMRHAEGYYVWMRIRAEV--TDEEEPHLVGISFDISEQRQFAEQTA 379

Query: 379 EADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRP 438
           +AD R+  AIE  SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ + +A +RP
Sbjct: 380 QADLRIRDAIENISESFVLWDSAGRLVMSNSKFCEYAAIPKQMLQSGIERATV-EAMSRP 438

Query: 439 IIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESK 498
            I       + + +++   + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+
Sbjct: 439 AISEYPLKVDEAGNLTSIRQTADGYWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSE 498

Query: 499 RRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
           RRL + I +L  +R   +++ TE+   N   Q EKE+AE+ANK KSEFLA MSHELRTPL
Sbjct: 499 RRLFSFIQELKRARGNAQQRATEVEKLNKSLQEEKEKAESANKAKSEFLANMSHELRTPL 558

Query: 559 NAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQ 618
           NAILGFSE++ +  FG LGS +Y EY  DIH SG HLL +IN+IL+MSKIE  + ++D +
Sbjct: 559 NAILGFSEIMLQSTFGPLGSQRYKEYMHDIHNSGTHLLTLINDILDMSKIEAGRFTLDCK 618

Query: 619 NADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNN 678
           N +L PII+E IR +   AQ+K I +   I  +L  + D R +K+I   ++SN++KFT +
Sbjct: 619 NINLEPIISETIRTLTPQAQAKKISLTTNIEPKLHADVDCRAMKQIFLNLISNAVKFTPS 678

Query: 679 NGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISD 738
            G + IR  +    +I +I DTG+GIPK A++K+G+PFE + NQ+ ++  G GLGLAIS 
Sbjct: 679 GGSIDIRAFQKNNNLIFSIKDTGVGIPKEAIKKLGKPFEQVENQFTKTHPGSGLGLAISR 738

Query: 739 ALTNLHGGRLKIISQEGKGTIVTICMP 765
           +L  LH G+L+I S+E KGTIVTI MP
Sbjct: 739 SLLELHKGKLEITSKEAKGTIVTITMP 765


>gi|170738618|ref|YP_001767273.1| multi-sensor signal transduction histidine kinase [Methylobacterium
           sp. 4-46]
 gi|168192892|gb|ACA14839.1| multi-sensor signal transduction histidine kinase [Methylobacterium
           sp. 4-46]
          Length = 764

 Score =  617 bits (1592), Expect = e-174,   Method: Composition-based stats.
 Identities = 248/741 (33%), Positives = 401/741 (54%), Gaps = 18/741 (2%)

Query: 29  AFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLM 88
              RA T     L    S     IP +  +FLV +   +  ++ ++         +   +
Sbjct: 18  GIARALTPAHQRLARAESWLRVAIPAVIGLFLVCLFAITATQLMSQRRDAVAEAGREIDL 77

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
           L                          L   +     +    I L  P+E++ AS     
Sbjct: 78  LARLAAATLAQGG-------------GLDGAVPAGALIPGREIHLIGPDEVITASLPVPL 124

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
              G+ +GE + E        +   +    L   P       LP     + ++ S   + 
Sbjct: 125 P-PGRSLGEHLGEAQPLLILGERAGLMTVGLRGAPALATLRALPGGQQRVAVVQSLDTVT 183

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
             W+     E +     + +++ I  +Y  QA + +  D +  +    ++TAL RGRCGL
Sbjct: 184 AAWQGRARTEAMVIGTATLVIVCIGLAYTLQADRARAVDRVCEQVRQRLDTALCRGRCGL 243

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           W+++    + + S SMY+++G   E++ LSF  +  L+H D+  +  +A  +  +    +
Sbjct: 244 WDWDIARGRIYWSDSMYQLLGYTREHEFLSFGDVNALVHPDDTDLYGLASQLAAQDAT-V 302

Query: 329 DQIFHMRHASGADIWIQVRAQMMRT-ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
           D  F +R A+G  IW++ RA+++R    GG +++GIA+D++E+  L +  A AD RL  A
Sbjct: 303 DHEFRIRSAAGEWIWLKARAEIVRDQEDGGRHLVGIAIDISEQRRLAESTATADMRLRDA 362

Query: 388 IECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDP 447
           +E  SEA VLWD  +RLV+CN+ +++ + L      PG     I      P +       
Sbjct: 363 VEAVSEAFVLWDAQNRLVLCNSKFRRLHALTPEDAQPGRRYDTIMGRAAVPPVRREIQAG 422

Query: 448 E--RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATI 505
           E   +   + E +LAD RWLQI+E  T DGG +SVGTDIT LK +Q +L ES+R+L ATI
Sbjct: 423 EFAETGARTFEAELADGRWLQISERRTKDGGYVSVGTDITALKRHQERLVESERQLIATI 482

Query: 506 NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS 565
            DL  SR+ LE Q  +L+    +Y  +K +AE+AN++KSEFLA MSHELRTPLNAILGF+
Sbjct: 483 ADLKRSRRTLELQTQQLADLAERYLDQKAQAESANRSKSEFLANMSHELRTPLNAILGFA 542

Query: 566 EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPI 625
           EV++ E+FG LG  KY EY +DI  SGQ+LL++I++IL+MS+IE  ++++ KQ   +  +
Sbjct: 543 EVMQDEVFGHLGCEKYREYCRDIRSSGQYLLSVIDDILDMSRIEARRVTLAKQPLPVAEV 602

Query: 626 INEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR 685
           +   ++++  +A++K + +  ++ ++    AD R + +IL  +L N++KFT + G++ +R
Sbjct: 603 LERVLKVVAEAARAKGLTLSVEMNADAVVLADARALHQILLNLLQNAVKFTPDAGRVAVR 662

Query: 686 TSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
           T +    V I + D+GIGIP++ L K+G PFE + +   +S  G GLGLAI+ +LT LHG
Sbjct: 663 TRRALDAVHIYVEDSGIGIPRTVLPKLGAPFEQVESNLSRSFKGSGLGLAIARSLTELHG 722

Query: 746 GRLKIISQEGKGTIVTICMPQ 766
           GRL+I S+ G GTIV + +PQ
Sbjct: 723 GRLRIRSEVGSGTIVLVRLPQ 743


>gi|319406908|emb|CBI80543.1| two-component sensor histidine kinase [Bartonella sp. 1-1C]
          Length = 769

 Score =  615 bits (1585), Expect = e-173,   Method: Composition-based stats.
 Identities = 258/745 (34%), Positives = 413/745 (55%), Gaps = 10/745 (1%)

Query: 27  KQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTS 86
           +    R   SI   L        ++IP   ++ L+ +AT              K    T 
Sbjct: 25  RVGVTRISNSIYQKLLFIEPWLRRSIPFAIIISLIVLATIRFASFYDWRHTIGKNARSTL 84

Query: 87  LMLTEAI------EIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELV 140
            +L+ +I      +++      K    S    +++L      +       I +   N  +
Sbjct: 85  SLLSSSIINKIDHDLLIFTQQKKVASLSHNHLQNILTTFHHHSSTNINPMIAILDRNGNM 144

Query: 141 FASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILI 200
            ASS       G+ + + I +   S    K   + + ++ Q+P              + I
Sbjct: 145 LASSNS-EMISGESLQDFISKNIDSWPLKKNTSIIQITIGQEPALASFNQTDSGQYGVFI 203

Query: 201 INSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETA 260
             ++  + R W+++ +L +  F    +++L +L++YY Q  + +  D I  +    ++ A
Sbjct: 204 SATKKHIYREWQKKFSLNITLFIGTVSIILVLLYAYYNQITRARNTDLISEKIQNRIDMA 263

Query: 261 LSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSV 320
           + RGRCGLW++N  + + + SR+MYE++G   +N  LS   I  +I   +    E+A+ +
Sbjct: 264 MMRGRCGLWDWNMASGRVYWSRAMYEMLGYEPQNALLSISQITAIIDPKDANFFELAQEL 323

Query: 321 TGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEA 380
            G   K +D    MRHA G  +W+++RA++  T     +++GI+ D++E++   ++ A A
Sbjct: 324 MGSEKKHIDINVPMRHAEGHYVWMRIRAEV--TDEEEPHLVGISFDISEQHQFAEQTARA 381

Query: 381 DQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII 440
           D R+  AIE  SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ + +A +RP I
Sbjct: 382 DLRIRDAIENISESFVLWDSEGRLVMSNSKFCEYASIPKQMLQSGIERATV-EAMSRPAI 440

Query: 441 EYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRR 500
                  + S +++   + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RR
Sbjct: 441 SEYPLKIDESGNLTSIRQTADGYWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERR 500

Query: 501 LKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNA 560
           L + I +L  +R   +++ TE+   N   Q EKERAE+ANK KSEFLA +SHELRTPLNA
Sbjct: 501 LFSFIQELKRARGNAQQRATEVEKLNKSLQEEKERAESANKAKSEFLANISHELRTPLNA 560

Query: 561 ILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNA 620
           ILGFSE++ +  FG LGS +Y EY  DIH SG HLL +IN+IL+MSKIE  + ++D++N 
Sbjct: 561 ILGFSEIMLQSTFGPLGSQRYKEYMHDIHNSGTHLLTLINDILDMSKIEAGRFTLDRKNI 620

Query: 621 DLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNG 680
           +L PII+E IR +   AQ+K I +   I  +L  + D R +K+I   ++SN++KFT + G
Sbjct: 621 NLEPIISETIRTLTPQAQAKKISLTTNIEQKLHADVDCRAMKQIFLNLISNAVKFTPSGG 680

Query: 681 KMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDAL 740
            + IR  +    +I +I DTG+GIP+ A++K+GQPFE + NQ+ ++  G GLGLAIS +L
Sbjct: 681 SIDIRAFQKNNNLIFSIKDTGVGIPQEAIKKLGQPFEQVENQFTKTHPGSGLGLAISRSL 740

Query: 741 TNLHGGRLKIISQEGKGTIVTICMP 765
             LH G+L+I S+E KGTIVTI MP
Sbjct: 741 LELHKGKLEITSKEAKGTIVTIIMP 765


>gi|319403897|emb|CBI77483.1| two-component sensor histidine kinase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 769

 Score =  614 bits (1584), Expect = e-173,   Method: Composition-based stats.
 Identities = 255/745 (34%), Positives = 411/745 (55%), Gaps = 10/745 (1%)

Query: 27  KQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTS 86
           +    R   SI   L        ++IP   ++ L+ +AT     +       +K      
Sbjct: 25  RVGVTRISNSIYQKLLFIEPWLRRSIPFAIIISLIVLATIRFASLYDWRHTIDKNARSIL 84

Query: 87  LMLTEAI------EIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELV 140
            +L+ +I      +++      K    S    +++L      +       I +   N  +
Sbjct: 85  SLLSSSIVNKIDHDLLAFTQQKKVASLSPNHLQNILITFHHHSSTHINPMIAILDRNGNI 144

Query: 141 FASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILI 200
            ASS       G+ + + I     S    K   +   +++Q+P              + I
Sbjct: 145 LASSNS-EIISGESLQDFISGNIISWPLKKNTGIIPITIEQEPALASFSQTDSGQYGVFI 203

Query: 201 INSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETA 260
             ++  +   W ++ +L +       +++L +L++YY Q  + +  D I  +    ++ A
Sbjct: 204 SATKKHIYTEWEKKFSLNITLLIGTVSIILVLLYAYYNQVTRARNTDLISEKIQNRIDIA 263

Query: 261 LSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSV 320
           + RGRCGLW++N  + + + SR+MYE++G   +N  LS   I  +I   +    E+A+ +
Sbjct: 264 MMRGRCGLWDWNMASGRVYWSRAMYEMLGYEPQNALLSISQITAIIDPKDANFFELAQEL 323

Query: 321 TGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEA 380
                K +D    MRHA G  +W+++RA++  T     +++GI+ D++E++   ++ A+A
Sbjct: 324 MESKKKHIDINVPMRHAEGHYVWMRIRAEV--TDEEEPHLVGISFDISEQHQFAEQTAQA 381

Query: 381 DQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII 440
           D R+  AIE  SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ + +A +RP I
Sbjct: 382 DLRIRDAIENISESFVLWDSEGRLVMSNSKFCEYAAIPKQMLQSGIERATV-EAMSRPAI 440

Query: 441 EYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRR 500
                  + S +++   + A+  WL+INE  T DGG + VGTDI+ LK  Q +  +S+RR
Sbjct: 441 SEYPLKIDESGNLTSIRQTANGYWLKINERRTQDGGLVCVGTDISELKQQQEKFEDSERR 500

Query: 501 LKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNA 560
           L + I +L  +R   +++ TE+   N   Q EKERAE+ANK KSEFLA +SHELRTPLNA
Sbjct: 501 LFSFIQELKRARGNAQQRATEVEKLNKSLQEEKERAESANKAKSEFLANISHELRTPLNA 560

Query: 561 ILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNA 620
           ILGFSE++ +  FG LGS +Y EY  DIH SG HLL +IN+IL+MSKIE  + ++D++N 
Sbjct: 561 ILGFSEIMLQSTFGPLGSQRYKEYMHDIHNSGTHLLTLINDILDMSKIEAGRFTLDRKNI 620

Query: 621 DLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNG 680
           +L PII+E IR +   AQ+K I +   I  +L  + D R +K+I   ++SN++KFT + G
Sbjct: 621 NLEPIISETIRTLTPQAQAKKISLTTNIEQKLHADVDCRAMKQIFLNLISNAVKFTPSGG 680

Query: 681 KMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDAL 740
            + IR  +    +I +I DTG+GIP+ A++K+GQPFE + NQ+ ++  G GLGLAIS +L
Sbjct: 681 SIDIRAFQKNNNLIFSIKDTGVGIPQEAIKKLGQPFEQVENQFTKTHPGSGLGLAISRSL 740

Query: 741 TNLHGGRLKIISQEGKGTIVTICMP 765
             LH G+L+I S+EGKGTIVTI MP
Sbjct: 741 LELHKGKLEITSKEGKGTIVTIIMP 765


>gi|319784548|ref|YP_004144024.1| ATP-binding region ATPase domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170436|gb|ADV13974.1| ATP-binding region ATPase domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 773

 Score =  611 bits (1577), Expect = e-172,   Method: Composition-based stats.
 Identities = 264/732 (36%), Positives = 419/732 (57%), Gaps = 5/732 (0%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
                 L +      ++IP++ + FL+ IA   ++ +       E+       +    + 
Sbjct: 34  EPAYRRLLAAEPLLRRSIPVLIITFLIVIAALRVLSLMNERDDVERNAKAILTLAAGQLA 93

Query: 95  IIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKK 154
                 +           + +L     +        +++      + A + ++  + G  
Sbjct: 94  SSLATTS----ETVPGAIQDLLETTSRQGAMGRSHVLVITDSAFKIVAVTPRSMPWQGHS 149

Query: 155 IGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREE 214
           +  ++              + + ++D + ++          G+   +  +  +   WR+ 
Sbjct: 150 LDGLVEGGQPLFMFGDRAGVMDVNIDGRDWYAAVSLANGGKGASAALVPQDAVFDAWRKT 209

Query: 215 VTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFD 274
           V+L V  F + + +L+ IL++Y+ QA + +  D I LEA+  ++ AL RGRCGLW+++  
Sbjct: 210 VSLNVTLFVLTAGVLIVILYAYFGQAARAQAADRIYLEAHQRIDMALVRGRCGLWDWDMV 269

Query: 275 NKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM 334
             K + SRSMY+++G       LSF  + ++IH ++  + E+A  +  + +  +DQ+F M
Sbjct: 270 RGKMYWSRSMYDMLGYKPCETMLSFGEVDQIIHPEDGDLFELANRIVAREIDHIDQVFRM 329

Query: 335 RHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA 394
           RHA G  +W++ RAQ++   +  + +IGIA+D+TE+ HL  R   AD RL  AIE  +E+
Sbjct: 330 RHADGQWVWMRARAQVIDPEAPEIQLIGIAVDVTEQRHLALRSEAADLRLRTAIENINES 389

Query: 395 LVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER-SQDM 453
            VLWD    L+MCN+ YQ+  GL D  ++PG AR+ +++       E R +         
Sbjct: 390 FVLWDSTQHLIMCNSKYQQDNGLSDRDVMPGTARAALEERMLAFASERRLAHTSGLQGGA 449

Query: 454 SKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQ 513
           + E +LAD RWLQ+NE  T DGG +SVG+DIT +K +Q +L +S+RRL ATI+DLS +R+
Sbjct: 450 TFERQLADGRWLQVNELKTRDGGIVSVGSDITQIKLHQEKLVDSERRLMATIHDLSLARR 509

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
             E +  EL   N KY  E ERAE AN+ KSEFLA MSHELRTPLNAI+GFSE++++ +F
Sbjct: 510 AEEERSRELVDLNRKYMKETERAEAANRAKSEFLANMSHELRTPLNAIIGFSELMEQGLF 569

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G LGS +Y EYA DI+ SG++LL +IN+IL+MSKIE  + S+D++  DL P+I+E +R++
Sbjct: 570 GPLGSERYEEYATDINSSGKYLLGVINDILDMSKIEAGQFSLDREEIDLGPLISETVRVV 629

Query: 634 GSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCV 693
              A  K I +E +I   L   AD+R IK+I+  +LSN++KFT + G + +R       +
Sbjct: 630 SLQAAQKAISVETRIADALTLVADRRAIKQIVINLLSNAVKFTGHGGHISVRARNTSGAL 689

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
           ++TI D G GIPK AL K+G+PFE + NQ+ +S  G GLGLAIS +L  L GG LKI S 
Sbjct: 690 VLTIEDNGCGIPKEALGKLGRPFEQVQNQFSKSHAGSGLGLAISRSLAELQGGALKIRSS 749

Query: 754 EGKGTIVTICMP 765
           EG GTIV++ +P
Sbjct: 750 EGVGTIVSVRIP 761


>gi|260462368|ref|ZP_05810576.1| PAS/PAC sensor signal transduction histidine kinase [Mesorhizobium
           opportunistum WSM2075]
 gi|259031862|gb|EEW33130.1| PAS/PAC sensor signal transduction histidine kinase [Mesorhizobium
           opportunistum WSM2075]
          Length = 773

 Score =  608 bits (1569), Expect = e-172,   Method: Composition-based stats.
 Identities = 268/749 (35%), Positives = 421/749 (56%), Gaps = 6/749 (0%)

Query: 19  RQKITVSSKQAFKRAY-TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQ 77
           R++          R         L +      ++IP + ++FL+ IA   ++ +      
Sbjct: 17  RRETRSDGLAGNTRLIAEPAYKRLLAAEPLLRRSIPALIVIFLIVIAALRVLSLMNERDD 76

Query: 78  QEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPN 137
            E+       +    +                   + +L     +        +++    
Sbjct: 77  VERDAKAILTLAAGQLASSLATVT----DTQPGAIQDLLETTSRQGAMGRSHVLVITDGA 132

Query: 138 ELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGS 197
             + A S +++ + G  +  ++              + E S+  Q ++       +  G+
Sbjct: 133 FKITAVSPRSTPWQGHSLDGLVEGGQPLFMFGDRAGVMEVSIGGQDWYAAVSVAKNGKGA 192

Query: 198 ILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICV 257
              +  +  +   WR+ V+L V  F + + +L+ IL++Y+ QA + +  D I LEA+  +
Sbjct: 193 AAALVPQEAVFDTWRKTVSLNVTLFVLTAGVLIIILYAYFGQAARAQAADRIYLEAHQRI 252

Query: 258 ETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIA 317
           + AL RGRCGLW+++    K + SRSMY+++G       LSF  +  +IH ++  + E+A
Sbjct: 253 DMALVRGRCGLWDWDMVRGKMYWSRSMYDMLGYEPCETMLSFGEVDEIIHPEDGDLFELA 312

Query: 318 RSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRY 377
             +  + +  +DQ+F MRHA G  +W++ RAQ+M   +  + +IGIA+D+TE+ HL  R 
Sbjct: 313 NRIVAREIDHIDQVFRMRHADGQWVWMRARAQVMDPEAPEIQLIGIAVDVTEQRHLALRS 372

Query: 378 AEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTR 437
             AD RL  AIE  +E+ VLWD   RL+MCN+ YQ+  GL D  ++PG  R  +++    
Sbjct: 373 EAADLRLRTAIENINESFVLWDSAQRLIMCNSKYQQDNGLSDRDVMPGVTRVSLEERMLA 432

Query: 438 PIIEYRTSDPER-SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRE 496
              E R ++        + E +L+D RWLQ+NE  T DGG +SVG+DIT +K +Q +L +
Sbjct: 433 FASERRLANTNGPQGGATFERQLSDGRWLQVNELKTRDGGIVSVGSDITQIKLHQEKLVD 492

Query: 497 SKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
           S+RRL ATI+DLS +R+  E +  EL   N KY  E ERAE AN+ KSEFLA MSHELRT
Sbjct: 493 SERRLMATIHDLSLARRAEEERSRELVDLNRKYMKETERAEAANRAKSEFLANMSHELRT 552

Query: 557 PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
           PLNAI+GFSE++++ +FG LGS +Y EYA DI+ SG++LL +IN+IL+MSKIE  + S+D
Sbjct: 553 PLNAIIGFSELMEQGLFGPLGSSRYEEYATDINSSGKYLLGVINDILDMSKIEAGQFSLD 612

Query: 617 KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFT 676
           ++  DL P+I+E +R++   A  K I +E +I   L   AD+R IK+I+  +LSN++KFT
Sbjct: 613 QEQIDLGPLISETVRVVSLQAAQKAITVETRIADALTLFADRRAIKQIVINLLSNAVKFT 672

Query: 677 NNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAI 736
              G + +R       +++TI D G GIPK AL K+G+PFE + NQ+ ++  G GLGLAI
Sbjct: 673 GQGGHISVRARNTSGALVLTIEDNGCGIPKEALGKLGRPFEQVQNQFSKNHAGSGLGLAI 732

Query: 737 SDALTNLHGGRLKIISQEGKGTIVTICMP 765
           S +L  L GG LKI S EG GTIV++ +P
Sbjct: 733 SRSLAELQGGALKIRSTEGVGTIVSVRIP 761


>gi|319405334|emb|CBI78952.1| two-component sensor histidine kinase [Bartonella sp. AR 15-3]
          Length = 769

 Score =  608 bits (1567), Expect = e-171,   Method: Composition-based stats.
 Identities = 252/737 (34%), Positives = 408/737 (55%), Gaps = 10/737 (1%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
           +S    L        ++IP   ++ L+ +A      +       +     T  +L+ +I 
Sbjct: 33  SSTYQKLLFIEPWLRRSIPFAIIISLIVLAIIRFASLYDWRHTIDNNARSTLSLLSSSIV 92

Query: 95  IIFQNNNIKFDL------ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
                + + F         S    +++L      +       I +   N  +  SS    
Sbjct: 93  NKINYDLLAFTQPKKVAGLSHNHLQNILINFHHHSFPNINPMIAILDSNGNILTSSNS-E 151

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
               K + + I E   S    K   + E ++ ++          +    + I  ++  + 
Sbjct: 152 IISEKSLQDFISENIDSLPLKKNTGIIEITIGKELALASFNQTDNGQYRVFISATKKHIY 211

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
             W+++++L +  F    +++L +L++YY Q  + +  D I  +    ++ A+ RGRCGL
Sbjct: 212 TEWQKKLSLNITLFIGTVSIILVLLYAYYNQIIRARNTDLISEKIQNRIDMAMMRGRCGL 271

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           W++N  + + + SR+MYE++G   +N  LS   I  +I   +    E+A+ +     K +
Sbjct: 272 WDWNMASGRVYWSRAMYEMLGYEPQNALLSISQITAIIDPKDANFFELAQELMDSKKKYI 331

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
           D    MRHA G  +W+++RA++  T     +++GI+ D++E++   ++ A+AD R+  AI
Sbjct: 332 DINVPMRHAKGYYVWMRIRAEV--TDEEEPHLVGISFDISEQHQFVEQTAQADLRIRDAI 389

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
           E  SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ + +A +RP I       +
Sbjct: 390 ENISESFVLWDSEGRLVMSNSKFCEYAAIPKQMLQSGIERATV-EAMSRPAISEYPLKID 448

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
            + +++   + AD  WL+INE  T DGG + VGTDI+ LK  Q +  +S+RRL + I +L
Sbjct: 449 ETGNLTSIRQTADGYWLKINERRTQDGGLVCVGTDISELKQQQEKFEDSERRLFSFIQEL 508

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             +R   +++ TE+   N   Q EKERAE+ANK KSEFLA +SHELRTPLNAILGFSE++
Sbjct: 509 KRARGNAQQRATEVEKLNKSLQEEKERAESANKAKSEFLANISHELRTPLNAILGFSEIM 568

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
            +  FG LGS +Y EY  DIH SG HLL +IN+IL+MSKIE  + ++D++N +L PII+E
Sbjct: 569 LQSTFGPLGSQRYKEYVHDIHNSGTHLLTLINDILDMSKIEAGRFTLDRKNINLEPIISE 628

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            IR +   AQ+K I +   I  +L  N D R +K+I   ++SN++KFT + G + IR  +
Sbjct: 629 TIRTLTPQAQAKKISLTTNIEQKLHANVDCRAMKQIFLNLISNAVKFTPSGGSIDIRAFQ 688

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
               +I +I DTG+GIP+ A++K+GQPFE + NQ+ ++  G GLGLAIS +L  LH G+L
Sbjct: 689 KNNNLIFSIKDTGVGIPQEAIKKLGQPFEQVENQFTKTHPGSGLGLAISRSLLELHKGKL 748

Query: 749 KIISQEGKGTIVTICMP 765
           +I S+E KGTIVTI MP
Sbjct: 749 EITSKEAKGTIVTIIMP 765


>gi|90420832|ref|ZP_01228737.1| putative histidine kinase [Aurantimonas manganoxydans SI85-9A1]
 gi|90334807|gb|EAS48579.1| putative histidine kinase [Aurantimonas manganoxydans SI85-9A1]
          Length = 782

 Score =  607 bits (1565), Expect = e-171,   Method: Composition-based stats.
 Identities = 258/731 (35%), Positives = 419/731 (57%), Gaps = 3/731 (0%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
                L     +  ++IP++ + FL   A   +  +       E+   +   + T  +  
Sbjct: 37  PAYRQLLRSEKALRRSIPILIVSFLALAAVIRLATLVEERMALEEGAVRDLTIATALMRA 96

Query: 96  IFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKI 155
                    D  +               R     F +++  + ++ A+     + +G  +
Sbjct: 97  ESHAIEADGDGVALAADLLASALPAELLRH--GRFAVVSDSDGMIVAAMPGFENLVGGDL 154

Query: 156 GEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEV 215
             +I E        +   + +     +P  V S  L  N G +  +     LL  WR  V
Sbjct: 155 KRLIGEHQELLMFGERAGVQDTRFGSEPALVASARLADNQGILTFVQRETDLLSEWRHSV 214

Query: 216 TLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDN 275
           ++ V  F++ S ++L +L++Y+RQA + ++ D + LE +  V+TALSRG CGLW+++   
Sbjct: 215 SVNVTLFALTSTIMLVVLYAYFRQATRAQDADALYLETHQRVDTALSRGHCGLWDWDIAR 274

Query: 276 KKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMR 335
            + + SRSMYEI+ +   +  L+F  IA L+H D+  + E+AR V    +  LD++F MR
Sbjct: 275 GRMYWSRSMYEILDLCPRDSVLAFGDIAPLMHPDDGSLFEVARQVAAGKITSLDRVFRMR 334

Query: 336 HASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
           H  G+ +W++ RA++ RT    +++IG+A+D++E+  L +R  EA+ +L+ AIE  SE  
Sbjct: 335 HRDGSYVWLRARAEVSRTAENEVHLIGVAVDVSEQQELARRTDEANTQLNNAIENISETF 394

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQDMS 454
           VL D  DRLV+CN+ Y++ +GL +  +  G   + +     +PI  +  + P   S + +
Sbjct: 395 VLCDSQDRLVLCNSKYRETFGLTEADVARGTPLATVMAKARKPIDSHAVTSPTFASGERA 454

Query: 455 KEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
            E  L D RWL ++E  T D G +S+GTD+T LK +QA+L +S+RRL A I+DLS +R+ 
Sbjct: 455 SEALLPDGRWLLLSERRTADDGFVSIGTDVTQLKLHQARLSDSERRLMAVIDDLSIARRD 514

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
            ER+  +L+  N  Y  EKERAETA+  K+ FLA MSHELRTPLNAILGFSE++++  FG
Sbjct: 515 AERKAVQLTEMNQNYAAEKERAETASSAKTTFLANMSHELRTPLNAILGFSEIMRQGTFG 574

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
            +G  KY EYA+DIH SG +LL +IN+IL+M+KIE  ++ ++ +  DL  I  E  ++I 
Sbjct: 575 PIGCPKYGEYAEDIHQSGHYLLKLINDILDMAKIEAGRLVLNHETVDLSEIATETGKIIE 634

Query: 635 SSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI 694
             A  K I ++  +P  +    D+R  K+I+  +LSN++KFT+N G + ++   +G   +
Sbjct: 635 VQADQKAICLDADVPERMELTVDRRATKQIVLNLLSNAVKFTDNGGTVKMKLRTVGDAAL 694

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
           ITIAD G+GIP++AL+ +G+PFE + N+  ++  G GLGLAI+ +L  L GGR++I SQ 
Sbjct: 695 ITIADNGMGIPRAALKSLGKPFEQIENELTRTNKGTGLGLAIARSLVALQGGRMRISSQV 754

Query: 755 GKGTIVTICMP 765
           G+GTIV I +P
Sbjct: 755 GEGTIVAIRLP 765


>gi|114705118|ref|ZP_01438026.1| putative sensor histidine kinase transmembrane protein [Fulvimarina
           pelagi HTCC2506]
 gi|114539903|gb|EAU43023.1| putative sensor histidine kinase transmembrane protein [Fulvimarina
           pelagi HTCC2506]
          Length = 774

 Score =  576 bits (1485), Expect = e-162,   Method: Composition-based stats.
 Identities = 240/727 (33%), Positives = 397/727 (54%), Gaps = 4/727 (0%)

Query: 40  HLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQN 99
            + S      + IP + ++FL+ +A      +       E    Q   + +  +    Q 
Sbjct: 41  QIASTERFLRRVIPALLIIFLILVALVRFGSLIEYRGAIESDVEQDLHVASRFLAAESQ- 99

Query: 100 NNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEII 159
             +    A      ++L   L K       FIL++  + ++ A+S  + + IG  +   +
Sbjct: 100 -LLTESQAEVDPLNALLTSRLPKGLLQPGRFILVSGTDGIITAASPGSEYLIGTDLVTEL 158

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
                +    +       +L+++     S+ L    G   I+    P L  WRE + + V
Sbjct: 159 ALSPTAIQLGRGETTVPGTLNEEAIETSSMMLADGLGLGTIVQIERPALSAWREALAVNV 218

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
             FS+ S ++L I+ +Y+RQA +  E  T  LE +  V+TALS GR GLW++N    +  
Sbjct: 219 TLFSLTSFVVLAIVLAYFRQASRANEAQTAYLETHELVDTALSLGRSGLWDWNVTRGEVQ 278

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASG 339
           LSRS+YE++G   +  ++ F  +   +H  +  +      V   +V + D+ F +RH  G
Sbjct: 279 LSRSLYELLGFSPKTASIGFAELEHRLHPADIGVKHRLCRVVVGNVDRFDKTFRLRHRDG 338

Query: 340 ADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWD 399
             +W++  A+  RT SG  +++GIAMD++E+    +R  EA  +L  AIE   E  VL D
Sbjct: 339 HFVWLRAHAEATRTSSGERHLVGIAMDVSEQQAFAERTKEAHHQLHSAIENIPETFVLCD 398

Query: 400 KNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK-EIK 458
             D +++ N+ Y+  +GL +    PG   + +     +PI   + S     +D S  EIK
Sbjct: 399 NEDDIILANSRYRTVFGLSEEDTKPGTNLAQVMRKSRKPIESAQVSGSSSKRDDSSSEIK 458

Query: 459 LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
           + D RWL ++E  T +G  I++G DIT LK +Q +L ES+RRL   I+ LS +R   ER+
Sbjct: 459 MPDGRWLLLSERRTAEG-FIAIGADITQLKMHQTRLHESERRLTDIIHALSETRSDAERK 517

Query: 519 KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
             +L   N  +++EK +AE A++ K+ FLA MSHELRTPLNAILGFS+++++++ G +GS
Sbjct: 518 AAQLEELNHSFRIEKNKAEAASRAKTTFLANMSHELRTPLNAILGFSDIMRQQMLGPIGS 577

Query: 579 VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
            KY  YA DIH SG+ LL +I++IL+M KIET + ++ ++  DL   + E  R+I +S  
Sbjct: 578 EKYTGYAHDIHESGEFLLQLIDDILDMQKIETGRTTMLRRIFDLTEAVAESARMIEASVA 637

Query: 639 SKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIA 698
            + I +  + P +L   AD+R + +IL  ++SN++KF++  G++ +   +    V+++I 
Sbjct: 638 RRQIDLVVEQPEKLNIYADRRAVTQILMNLMSNAVKFSDAGGEVRVSVKERSGAVLLSIT 697

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           D G GI +  L KIG+PFE   +++ ++  G GLGLAI+ +LT LHGGR +I S  G+GT
Sbjct: 698 DRGEGISQCNLAKIGRPFEQTESEWTRTKKGTGLGLAIARSLTELHGGRFRIASTLGEGT 757

Query: 759 IVTICMP 765
           IV I +P
Sbjct: 758 IVAIRLP 764


>gi|217976388|ref|YP_002360535.1| multi-sensor signal transduction histidine kinase [Methylocella
           silvestris BL2]
 gi|217501764|gb|ACK49173.1| multi-sensor signal transduction histidine kinase [Methylocella
           silvestris BL2]
          Length = 795

 Score =  574 bits (1480), Expect = e-161,   Method: Composition-based stats.
 Identities = 241/726 (33%), Positives = 390/726 (53%), Gaps = 8/726 (1%)

Query: 45  FSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKF 104
                + +P + ++F+  +A  ++      Y +    +     +L   +    +      
Sbjct: 40  EIWVRRAVPAMVILFICALAAMTVAMARESYERAISDSLSDLELLAAVVADDLRETLKHT 99

Query: 105 DLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSR 164
                  A   L   +           ++      + AS+       G  + + +     
Sbjct: 100 PAGDIPTA---LTDAMPSRALARGQQAMITDLTGEIIASTPGARAIRG-PLLDFLGPSQP 155

Query: 165 SRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFS 223
               ++   +    L D          L    G + I+     +L  WR       V   
Sbjct: 156 LTIFAEKAGVLRIILPDGADALATVRTLNQPFGQLAIVYPMSAVLADWRAASLRTGVLLV 215

Query: 224 IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRS 283
             + +L+ +  +Y+ QA + +E D +       ++TALSRGRCGLW+++    + + S S
Sbjct: 216 ATALVLIALALAYFWQASRAREADRVCERVRDRIDTALSRGRCGLWDWDLARGRIYWSDS 275

Query: 284 MYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIW 343
           MY+I+G+      LSF  I  L+H  +  +  IA  +T    + +D  F M++  G  +W
Sbjct: 276 MYQILGLAPVGNFLSFGDINALVHPQDGDLAAIAEMLTASKAESVDHAFRMQNVKGEWVW 335

Query: 344 IQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
           ++ RA+++R  +G   +++GI +D+TE+  L +R A AD RL  AIE  SEA VLWD ++
Sbjct: 336 LRARAELVREQAGATPHLVGICVDITEQKTLAERTATADMRLRDAIESVSEAFVLWDADN 395

Query: 403 RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER--SQDMSKEIKLA 460
           +LVMCN+ +QK + L    ++ G   + + +  T P+I+ +T+  ER  +   + E +L 
Sbjct: 396 QLVMCNSKFQKFHNLSSEAVISGTPYAQVMEKGTPPMIQAQTALGERPQAGARTYEARLG 455

Query: 461 DSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKT 520
           D RWLQINE  T DGG +SVGTDIT LK ++ QL ES+RRL AT+ DL  SRQ LE+Q  
Sbjct: 456 DGRWLQINERRTKDGGYVSVGTDITALKRHEEQLMESERRLMATVADLRKSRQTLEQQAQ 515

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           +L+    +Y  +K  AETANK KSEFLA MSHELRTPLNAI+GFSEV+++E FG LGS K
Sbjct: 516 QLADLAERYLEQKAEAETANKAKSEFLANMSHELRTPLNAIIGFSEVMQQETFGPLGSKK 575

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y +Y+ DI  SG++LL +I+++L+MS++E+ ++ + K   +L   ++  +  +   A+ K
Sbjct: 576 YVDYSNDIKQSGEYLLGVISDVLDMSRLESGRVRLQKSEFELDAAVSGALATVEQIAREK 635

Query: 641 NIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADT 700
            I +  +       NAD+   +KIL  +L N++KFT  +G++ +R   +   + + I DT
Sbjct: 636 EITLVAEAMPGKRANADRAAFEKILAILLRNAVKFTPKDGRVSVRARFVQGALNVYIEDT 695

Query: 701 GIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIV 760
           GIGI  +A  ++G+PFE +    D  + G GLGLAI+ +L +LHGG ++I S  G GTIV
Sbjct: 696 GIGIAPAAQARLGRPFEQMGGSLDNGMKGSGLGLAIARSLVDLHGGSMRIRSTVGSGTIV 755

Query: 761 TICMPQ 766
            + +PQ
Sbjct: 756 LVHLPQ 761


>gi|315122620|ref|YP_004063109.1| two-component sensor histidine kinase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496022|gb|ADR52621.1| two-component sensor histidine kinase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 709

 Score =  573 bits (1477), Expect = e-161,   Method: Composition-based stats.
 Identities = 501/708 (70%), Positives = 601/708 (84%)

Query: 59  FLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQ 118
           FLV +A SSIIKV T+YAQQE+M +QT+L+LTE+IE +F+N++++F   S+KKAES+L +
Sbjct: 2   FLVLVAASSIIKVNTKYAQQEQMIHQTTLLLTESIESLFKNSSVQFKPESKKKAESILNE 61

Query: 119 LLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEAS 178
            L K +  S++FILLAQ N LVFASST NS YIG+KI EIIPEL    S SKT Q SE  
Sbjct: 62  FLLKIQPFSKAFILLAQSNGLVFASSTDNSPYIGEKISEIIPELHPLTSMSKTAQTSEVF 121

Query: 179 LDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYR 238
           L Q+PYHV S+ LP+N G +L+ NS++PLL  WR EVTLEV+FF+ ISA+LLF+L SYY+
Sbjct: 122 LSQEPYHVSSILLPNNDGLVLVANSKLPLLHFWRTEVTLEVIFFASISAILLFLLCSYYK 181

Query: 239 QAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLS 298
           Q K  +ENDT LLEAN C+ETALSRGRCG+W+FN  +KKFHLS+SM EI+GIP  +KTLS
Sbjct: 182 QIKSTEENDTNLLEANTCIETALSRGRCGIWDFNLASKKFHLSQSMCEILGIPATHKTLS 241

Query: 299 FRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM 358
           FR IARL+H+D K+I +IARS+T  H  QLD+IF + +++G D+WI+VRAQ+M T+SGGM
Sbjct: 242 FRTIARLVHFDGKEIYDIARSITKGHSTQLDKIFRVHYSTGRDVWIKVRAQVMNTLSGGM 301

Query: 359 NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLP 418
           N+IGIAMD+TE+Y+LEKRYAE DQRLSKAIECTSE+ VLWDKNDRLVMCNA YQ+ YGLP
Sbjct: 302 NVIGIAMDVTEQYYLEKRYAEVDQRLSKAIECTSESFVLWDKNDRLVMCNAKYQQVYGLP 361

Query: 419 DHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTI 478
           DHVL+PG  RSII +AQ  P++EY TSDP+R Q++SKEIKL DSRWLQINEW T D GTI
Sbjct: 362 DHVLIPGTKRSIINEAQINPVVEYYTSDPKRLQNISKEIKLVDSRWLQINEWHTPDAGTI 421

Query: 479 SVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAET 538
           SVGTDIT LK NQ +LRES+RRLKATINDLSTSRQILERQKTELSIANAKYQ EKERAE 
Sbjct: 422 SVGTDITQLKRNQKKLRESERRLKATINDLSTSRQILERQKTELSIANAKYQTEKERAEM 481

Query: 539 ANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
           AN+ KSEFLAKMSHELRTPLNAILGFSE+IK E FG+LGSVKYYEY +DIH SG+HLLN+
Sbjct: 482 ANRAKSEFLAKMSHELRTPLNAILGFSEIIKGETFGKLGSVKYYEYVKDIHDSGKHLLNL 541

Query: 599 INNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADK 658
           INNILEMSKIE+E I+I+K+N +LIPIINE ++ I SSAQ KNI IEK I  ELF NAD+
Sbjct: 542 INNILEMSKIESEHIAINKKNTNLIPIINESLQSIASSAQKKNIMIEKNISPELFCNADE 601

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEP 718
           RIIKKIL PI SNSIKFTNN GKM+++TS++   VIIT+ADTGIGIPKSAL+K+G+PFE 
Sbjct: 602 RIIKKILTPIFSNSIKFTNNGGKMIVQTSRVNDSVIITVADTGIGIPKSALKKVGKPFEQ 661

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           LHNQYDQ+ GG GLGLAISDALTNLHGG+L+I+SQEG+GT++ I MP+
Sbjct: 662 LHNQYDQNTGGSGLGLAISDALTNLHGGKLEILSQEGEGTVIKIGMPK 709


>gi|182678998|ref|YP_001833144.1| multi-sensor signal transduction histidine kinase [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182634881|gb|ACB95655.1| multi-sensor signal transduction histidine kinase [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 797

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 244/735 (33%), Positives = 404/735 (54%), Gaps = 9/735 (1%)

Query: 37  IISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEII 96
             S L +      + +P++   F+  +   +++     Y        +   ++   +   
Sbjct: 27  AFSRLIAHEVWIRRAVPVMVAFFVAALVALAVVIGRESYDHGVAEAMENLDLVGTLVAHD 86

Query: 97  FQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIG 156
              +  K  +      +  L Q+++ +       +L+A P+  +  +        G  + 
Sbjct: 87  LSAHLTKKGVV---PTDDGLRQMISPSLLARGQEVLVADPSGRIIGAYPAIPGLKG-TLA 142

Query: 157 EIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPH--NSGSILIINSRVPLLRLWREE 214
           + +       + ++   +   +L      + +V      ++G + +I+    +L  WR  
Sbjct: 143 DYLGPAQPLTTFAEKAGVLRITLADATEALATVRTLGLASAGQVALIHPMTEVLSEWRAN 202

Query: 215 VTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFD 274
                +     S +L+ +  +Y+ QA + KE           ++TAL+RGRCGLW+++  
Sbjct: 203 SWRAGLLLFSTSFVLVALACAYFWQATRAKEAGETCERMRERIDTALNRGRCGLWDWDLA 262

Query: 275 NKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM 334
             +   S+SMYEI+G+    + +SF  I  L+H  +  +  IA  +       +D  F M
Sbjct: 263 RGRVFWSQSMYEILGMSPSEQFISFGDINALMHPQDGDLAAIAEMLAASKTDAIDHAFRM 322

Query: 335 RHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
           R+ +G  +W++ RA+++R   S   +++GI +D+TE   L +R A AD RL  AIE  SE
Sbjct: 323 RNVAGDWVWLRARAELVRDHLSNTPHLVGICVDITEHKVLAERTATADMRLRDAIETVSE 382

Query: 394 ALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER--SQ 451
           A VLWD ++RLVMCN  +Q+ + L + +LVPG     +    T P+I+ + +  ER  + 
Sbjct: 383 AFVLWDADNRLVMCNEKFQRFHNLANDILVPGTPYMQVMAKGTPPLIQSQIALGERPQAG 442

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             + E +L D RWLQINE  T DGG +SVGTDIT LK ++ QL ES+RRL ATI DL  S
Sbjct: 443 ARTYEARLGDGRWLQINERRTKDGGYVSVGTDITTLKRHEEQLMESERRLMATIADLRKS 502

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           RQ LE Q  +L+    KY  +K  AETAN+ KSEFL  MSHELRTPLNAI+GFSE++ +E
Sbjct: 503 RQTLELQAQQLADLAEKYLEQKAEAETANRAKSEFLTNMSHELRTPLNAIIGFSELMGQE 562

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            +G LGS +Y +Y  DI  SGQ+LL +I+++L+MS++E  ++ ++K + ++  ++++ I 
Sbjct: 563 PYGPLGSPRYLDYCNDIRQSGQYLLGVISDVLDMSRLEAGRVRLEKTDFEIDTVVSKAIA 622

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
            + ++A+ K I +  +   +   +AD+  I+KIL  +L N+IKFT   G++ +RT  I  
Sbjct: 623 GVKATAEEKEITLLAETTPQTSVHADRGAIEKILLILLRNAIKFTPAQGRVTVRTRMIQG 682

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + I + DTG+GIP + L ++G+PFE LH      + G GLGLAI+ +L +LHGG ++I 
Sbjct: 683 ALNIYVEDTGMGIPPAPLARLGRPFEQLHGSMANGMKGSGLGLAIARSLVDLHGGSMRIR 742

Query: 752 SQEGKGTIVTICMPQ 766
           S  G GTIV + +P+
Sbjct: 743 STVGSGTIVLVRIPE 757


>gi|163849986|ref|YP_001638029.1| PAS sensor protein [Methylobacterium extorquens PA1]
 gi|163661591|gb|ABY28958.1| PAS sensor protein [Methylobacterium extorquens PA1]
          Length = 786

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 239/739 (32%), Positives = 393/739 (53%), Gaps = 13/739 (1%)

Query: 29  AFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLM 88
             +R   +  + L    +     +P + +VF++ +   + +++  R+ +  ++  +    
Sbjct: 20  GIQRTTGTAQARLIRAETWLRYALPALLVVFMLTLLGVAALQMRGRHDEAMRVATREVEA 79

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
                 +   N +          AE+ L ++L      +   +L+  P   + A+    +
Sbjct: 80  FARLSALALSNASSA--------AETRLERVLPVHLLPTGREVLVIGPGGRIRAAYPAPA 131

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLD-QQPYHVLSVNLPHNSGSILIINSRVPL 207
                     + +        ++      +L       V +  L H  G + ++    PL
Sbjct: 132 PAE--TFAGYLADGEPIAILGESAGAMTVNLQAGGQAVVAARRLSHGMGEVAVVQRFEPL 189

Query: 208 LRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCG 267
              W        V  S I+ +L  +  +Y  Q ++ +  D +       ++TAL RGRCG
Sbjct: 190 ADNWWRMFGHHAVSLSAIALVLAGMATAYILQTQRAQAADEVCDLVKQRLDTALGRGRCG 249

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ 327
           LW+++        S SMY ++G   E   LSF  +  L+H ++  +  +AR +   H   
Sbjct: 250 LWDWDIARGTIFWSDSMYALLGYTPEKDLLSFGDVNALLHAEDGDLYSLARHLAASHAT- 308

Query: 328 LDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
           +D  F +R ASG  IW++ RA+++     G  +++GIAMD+TE+  L +  A AD RL  
Sbjct: 309 VDHEFRIRDASGEWIWLRTRAEIVEDAVDGSRHLVGIAMDVTEQRRLAEFTATADMRLRD 368

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
           A+E  SEA VLWD ++RLV+CN+ ++  + L     VPG     I      P +      
Sbjct: 369 AVEAVSEAFVLWDASNRLVLCNSKFRDLHALASEDAVPGRRYDEIMGRGALPPVRRGIPG 428

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
            ER    + E++L D RWLQ++E  T DGG +SVGTDIT LK +Q QL  S+R L  T+ 
Sbjct: 429 SERGPSRTFEVELTDGRWLQVSERRTKDGGYVSVGTDITSLKRHQEQLVTSERELIETVK 488

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL  SR+ LE Q  +L+    ++  +K RAE AN+ KSEFLA MSHELRTPLNAI+GF+E
Sbjct: 489 DLKRSRRTLETQTQQLADLAERHLDQKARAEIANQAKSEFLANMSHELRTPLNAIMGFAE 548

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           +++ E++G LGS +Y +Y +DI  SG +LL++I++IL MS+IE +++ + +++ DL   +
Sbjct: 549 LMESEVYGSLGSPRYADYCRDIQQSGTYLLSVIDDILHMSRIEAKRVKLVRRDIDLGTAL 608

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
              + L+   A SK++ I+ ++   L   AD+R +++IL  I+ N++KFT   G++ +R 
Sbjct: 609 TSALTLVAKEAASKSVSIDLELAGTLHVLADERALQQILLNIIQNAVKFTPERGRIALRG 668

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                 V + I DTGIGIPK+A+ K+G+PFE +     +S  G GLGLAI+ +   LHGG
Sbjct: 669 RSCNGFVHLFIGDTGIGIPKTAISKLGRPFEQVETNLTRSYKGSGLGLAIARSTAELHGG 728

Query: 747 RLKIISQEGKGTIVTICMP 765
            L+I S+EG GT+V + +P
Sbjct: 729 SLRIRSEEGIGTLVLVRLP 747


>gi|188579782|ref|YP_001923227.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium populi BJ001]
 gi|179343280|gb|ACB78692.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium populi BJ001]
          Length = 786

 Score =  561 bits (1446), Expect = e-157,   Method: Composition-based stats.
 Identities = 236/739 (31%), Positives = 384/739 (51%), Gaps = 13/739 (1%)

Query: 29  AFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLM 88
             +R   +  + L    +     +P + +VF++ +   +++++  R+ +  +   +    
Sbjct: 20  GIQRTTGTAQARLIRAETWLRYALPALLVVFMLTLLGVAVLQLRGRHDEAVRAATREVEA 79

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
                 +   +             E+ L ++L      +   +LL  P   + A+  + +
Sbjct: 80  FARLAALALSSEAAAT--------ETQLERVLPVHLLPAGREVLLIGPTGRIRAAYPRPA 131

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLD-QQPYHVLSVNLPHNSGSILIINSRVPL 207
                     + E        ++      +L       V +  L    G + ++    PL
Sbjct: 132 PS--DTFASYLAEGEPIAFLGESAGAMTVNLQAGGQAVVATRRLADGLGEVAVLQRFEPL 189

Query: 208 LRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCG 267
              W        +  S I  +L  +  +Y  Q ++ +  D +       ++TAL RGRCG
Sbjct: 190 TANWWRMFGHHAISLSAIGLVLAGMATAYILQTQRAQAADEVCDLVKQRLDTALGRGRCG 249

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ 327
           LW+++        S SMY ++G   E   LSF  +  L+H ++  +  +AR +   H   
Sbjct: 250 LWDWDIARGTIFWSDSMYALLGYTPEKDLLSFGDVNALLHSEDGDLYSLARHLAASH-AT 308

Query: 328 LDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
           +D  F +R ASG  IW++ RA+++     G  +++GIAMD+TE+  L +  A AD RL  
Sbjct: 309 VDHEFRIRDASGDWIWLRTRAEIVEDALDGSRHLVGIAMDVTEQRRLAEFTATADMRLRD 368

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
           A+E  SEA VLWD  +RLV+CN+ ++  + L     VPG     I      P +      
Sbjct: 369 AVEAISEAFVLWDAGNRLVLCNSKFRDLHALDSEDAVPGRRYDEIMGRGALPPVRRGIPG 428

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
            ER    + E++L D RWLQ++E  T DGG +SVGTDIT LK +Q QL  S+R L  T+ 
Sbjct: 429 AERGTSRTFEVELTDGRWLQVSERRTKDGGYVSVGTDITSLKRHQEQLVASERELIETVK 488

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL  SR+ LE Q  +L+    ++  +K RAE AN+ KSEFLA MSHELRTPLNAI+GF+E
Sbjct: 489 DLKRSRRTLETQTQQLADLAERHLDQKARAEIANQAKSEFLANMSHELRTPLNAIMGFAE 548

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           +++ E++G LGS +Y +Y +DI  SG +LL++I++IL MS+IE  ++ + ++   L   I
Sbjct: 549 LMESEVYGSLGSPRYADYCRDIQQSGTYLLSVIDDILHMSRIEANRVKLVRREIGLDAAI 608

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
              + L+   A SK++ I+ ++   L   AD+R + +IL  I+ N++KFT   G++ +R 
Sbjct: 609 AAAVTLVSKEAASKSVAIDIELAGTLNVLADERALHQILLNIIQNAVKFTPEGGRVALRG 668

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                   + I DTGIGIPK+A+ K+G+PFE +     +S  G GLGLAI+ +   LHGG
Sbjct: 669 RSCNGFAHLFIGDTGIGIPKAAISKLGRPFEQVETNLTRSYKGSGLGLAIARSTAELHGG 728

Query: 747 RLKIISQEGKGTIVTICMP 765
            L+I S+EG GT+V + +P
Sbjct: 729 SLRIRSEEGVGTLVLVRLP 747


>gi|218528525|ref|YP_002419341.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium chloromethanicum CM4]
 gi|218520828|gb|ACK81413.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium chloromethanicum CM4]
          Length = 786

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 238/739 (32%), Positives = 392/739 (53%), Gaps = 13/739 (1%)

Query: 29  AFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLM 88
             +R   +  + L    +     +P + +VF++ +   + +++  R+ +  ++  +    
Sbjct: 20  GIQRTTGTAQARLIRAETWLRYALPALLVVFMLTLLGVAALQMRGRHDEAMRVATREVEA 79

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
                 +   N +          AE+ L ++L      +   +L+  P   + A+    +
Sbjct: 80  FARLSALALSNASFA--------AETRLERVLPVHLLPAGREVLVIGPGGRIRAAYPAPA 131

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLD-QQPYHVLSVNLPHNSGSILIINSRVPL 207
                     + +        ++      +L       V +  L    G + ++    PL
Sbjct: 132 PAE--TFAGYLADGEPIAILGESAGAMTVNLQAGGQAVVAARRLADGMGEVAVVQRFEPL 189

Query: 208 LRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCG 267
              W        V  S I+ +L  +  +Y  Q ++ +  D +       ++TAL RGRCG
Sbjct: 190 ADNWWRMFGHHAVSLSAIALVLAGMATAYILQTQRAQAADEVCDLVKQRLDTALGRGRCG 249

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ 327
           LW+++        S SMY ++G   E   LSF  +  L+H ++  +  +AR +   H   
Sbjct: 250 LWDWDIARGTIFWSDSMYALLGYTPEKDLLSFGDVNALLHAEDGDLYSLARHLAASHAT- 308

Query: 328 LDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
           +D  F +R ASG  IW++ RA+++     G  +++GIAMD+TE+  L +  A AD RL  
Sbjct: 309 VDHEFRIRDASGEWIWLRTRAEIVEDAVDGSRHLVGIAMDVTEQRRLAEFTATADMRLRD 368

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
           A+E  SEA VLWD ++RLV+CN+ ++  + L     VPG     I      P +      
Sbjct: 369 AVEAVSEAFVLWDASNRLVLCNSKFRDLHALASEDAVPGRRYDEIMGRGALPPVRRGIPG 428

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
            ER    + E++L D RWLQ++E  T DGG +SVGTDIT LK +Q QL  S+R L  T+ 
Sbjct: 429 SERGPSRTFEVELTDGRWLQVSERRTKDGGYVSVGTDITSLKRHQEQLVTSERELIETVK 488

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL  SR+ LE Q  +L+    ++  +K RAE AN+ KSEFLA MSHELRTPLNAI+GF+E
Sbjct: 489 DLKRSRRTLETQTQQLADLAERHLDQKARAEIANQAKSEFLANMSHELRTPLNAIMGFAE 548

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           +++ E++G LGS +Y +Y +DI  SG +LL++I++IL MS+IE +++ + +++ DL   +
Sbjct: 549 LMESEVYGSLGSPRYADYCRDIQQSGTYLLSVIDDILHMSRIEAKRVKLVRRDIDLGTAL 608

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
              + L+   A SK++ I+ ++   L   AD+R +++IL  I+ N++KFT   G++ +R 
Sbjct: 609 TAALTLVAKEAASKSVSIDLELAGTLHVLADERALQQILLNIIQNAVKFTPERGRVALRG 668

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                 V + I DTGIGIPK+A+ K+G+PFE +     +S  G GLGLAI+ +   LHGG
Sbjct: 669 RSCNGFVHLFIGDTGIGIPKTAISKLGRPFEQVETNLTRSYKGSGLGLAIARSTAELHGG 728

Query: 747 RLKIISQEGKGTIVTICMP 765
            L+I S+EG GT+V + +P
Sbjct: 729 SLRIRSEEGIGTLVLVRLP 747


>gi|254559131|ref|YP_003066226.1| PAS sensor signal transduction histidine kinase [Methylobacterium
           extorquens DM4]
 gi|254266409|emb|CAX22173.1| putative PAS sensor signal transduction histidine kinase
           [Methylobacterium extorquens DM4]
          Length = 786

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 238/739 (32%), Positives = 392/739 (53%), Gaps = 13/739 (1%)

Query: 29  AFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLM 88
             +R   +  + L    +     +P + +VF++ +   + +++  R+ +  ++  +    
Sbjct: 20  GIQRTTGTAQARLIRAETWLRYALPALLVVFMLTLLGVAALQMRGRHDEAMRVATREVEA 79

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
                 +   N +           E+ L ++L      +   +L+  P   + A+    +
Sbjct: 80  FARLAALALSNASSAA--------ETRLERVLPVHLLPAGREVLVIGPGGRIRAAYPAPA 131

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLD-QQPYHVLSVNLPHNSGSILIINSRVPL 207
                     + +        ++      +L       V +  L    G + ++    PL
Sbjct: 132 PAE--TFAGYLADGEPIAILGESAGAMTVNLQAGGQAVVAARRLSDGMGEVAVVQRFEPL 189

Query: 208 LRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCG 267
              W        V  S I+ +L  +  +Y  Q ++ +  D +       ++TAL RGRCG
Sbjct: 190 ADNWWRMFGHHAVSLSAIALVLAGMATAYILQTQRAQAADEVCDLVKQRLDTALGRGRCG 249

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ 327
           LW+++        S SMY ++G   E   LSF  +  L+H ++  +  +AR +   H   
Sbjct: 250 LWDWDIARGTIFWSDSMYALLGYTPEKDLLSFGDVNALLHAEDGDLYSLARHLAASHAT- 308

Query: 328 LDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
           +D  F +R ASG  IW++ RA+++     G  +++GIAMD+TE+  L +  A AD RL  
Sbjct: 309 VDHEFRIRDASGEWIWLRTRAEIVEDAVDGSRHLVGIAMDVTEQRRLAEFTATADMRLRD 368

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
           A+E  SEA VLWD ++RLV+CN+ ++  + L     VPG     I      P +      
Sbjct: 369 AVEAVSEAFVLWDASNRLVLCNSKFRDLHALASEDAVPGRRYDEIMGRGALPPVRRGIPG 428

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
            ER    + E++L D RWLQ++E  T DGG +SVGTDIT LK +Q QL  S+R L  T+ 
Sbjct: 429 SERGPSRTFEVELTDGRWLQVSERRTKDGGYVSVGTDITSLKRHQEQLVTSERELIETVK 488

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL  SR+ LE Q  +L+    ++  +K RAE AN+ KSEFLA MSHELRTPLNAI+GF+E
Sbjct: 489 DLKRSRRTLETQTQQLADLAERHLDQKARAEIANQAKSEFLANMSHELRTPLNAIMGFAE 548

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           +++ E++G LGS +Y +Y +DI  SG +LL++I++IL MS+IE +++ + +++ DL   +
Sbjct: 549 LMESEVYGSLGSPRYADYCRDIQQSGTYLLSVIDDILHMSRIEAKRVKLVRRDIDLGTAL 608

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
           N  + L+   A SK++ I+ ++   L   AD+R +++IL  I+ N++KFT   G++ +R 
Sbjct: 609 NSALTLVSKEAASKSVSIDLELAGTLHVLADERALQQILLNIIQNAVKFTPEQGRVALRG 668

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                 V + I DTGIGIPK+A+ K+G+PFE +     +S  G GLGLAI+ +   LHGG
Sbjct: 669 RSCNGFVHLFIGDTGIGIPKTAISKLGRPFEQVETNLTRSYKGSGLGLAIARSTAELHGG 728

Query: 747 RLKIISQEGKGTIVTICMP 765
            L+I S+EG GT+V + +P
Sbjct: 729 SLRIRSEEGIGTLVLVRLP 747


>gi|240137118|ref|YP_002961587.1| putative PAS sensor signal transduction histidine kinase
           [Methylobacterium extorquens AM1]
 gi|240007084|gb|ACS38310.1| putative PAS sensor signal transduction histidine kinase
           [Methylobacterium extorquens AM1]
          Length = 786

 Score =  552 bits (1422), Expect = e-154,   Method: Composition-based stats.
 Identities = 237/739 (32%), Positives = 391/739 (52%), Gaps = 13/739 (1%)

Query: 29  AFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLM 88
             +R   +  + L    +     +P + +VF++ +   + +++  R+ +  ++  +    
Sbjct: 20  GIQRTTGTAQARLIRAETWLRYALPALLVVFMLTLLGVAALQMRGRHDEAMRVATREVEA 79

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
                 +   N +           E+ L ++L      +   +L+  P   + A+    +
Sbjct: 80  FARLAALALSNASSAA--------ETRLERVLPVHLLPAGREVLVIGPGGRIRAAYPAPA 131

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLD-QQPYHVLSVNLPHNSGSILIINSRVPL 207
                     + +        ++      +L       V +  L    G + ++    PL
Sbjct: 132 PAE--TFAGYLADGEPIAILGESAGAMTVNLQAGGQAVVAARRLADGMGEVAVVQRFEPL 189

Query: 208 LRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCG 267
              W        V  S I+ +L  +  +Y  Q ++ +  D +       ++TAL RGRCG
Sbjct: 190 ADNWWRMFGHHAVSLSAIALVLAGMATAYILQTQRAQAADEVCDLVKQRLDTALGRGRCG 249

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ 327
           LW+++        S SMY ++G   E   LSF  +  L+H ++  +  +AR +   H   
Sbjct: 250 LWDWDIARGTIFWSDSMYALLGYTPEKDLLSFGDVNALLHAEDGDLYSLARHLAASHAT- 308

Query: 328 LDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
           +D  F +R ASG  IW++ RA+++     G  +++GIAMD+TE+  L +  A AD RL  
Sbjct: 309 VDHEFRIRDASGEWIWLRTRAEIVEDAVDGSRHLVGIAMDVTEQRRLAEFTATADMRLRD 368

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
           A+E  SEA VLWD ++RLV+CN+ ++  + L     VPG     I      P +      
Sbjct: 369 AVEAVSEAFVLWDASNRLVLCNSKFRDLHALASEDAVPGRRYDEIMGRGALPPVRRGIPG 428

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
            ER    + E++L D RWLQ++E  T DGG +SVGTDIT LK +Q QL  S+R L  T+ 
Sbjct: 429 SERGPSRTFEVELTDGRWLQVSERRTKDGGYVSVGTDITSLKRHQEQLVTSERELIETVK 488

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL  SR+ LE Q  +L+    ++  +K RAE AN+ KSEFLA MSHELRTPLNAI+GF+E
Sbjct: 489 DLKRSRRTLETQTQQLADLAERHLDQKARAEIANQAKSEFLANMSHELRTPLNAIMGFAE 548

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           +++ E++G LGS +Y +Y +DI  SG +LL++I++IL MS+IE +++ + +++ DL   +
Sbjct: 549 LMESEVYGSLGSPRYADYCRDIQQSGTYLLSVIDDILHMSRIEAKRVKLVRRDIDLGTAL 608

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
              + L+   A SK++ I+ ++   L   AD+R +++IL  I+ N++KFT   G++ +R 
Sbjct: 609 TSALTLVAKEAASKSVSIDLELAGTLHVLADERALQQILLNIIQNAVKFTPERGRVALRG 668

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                 V + I DTGIGIPK+A+ K+G+PFE +     +S  G GLGLAI+ +   LHGG
Sbjct: 669 RSCNGFVHLFIGDTGIGIPKTAISKLGRPFEQVETNLTRSYKGSGLGLAIARSTAELHGG 728

Query: 747 RLKIISQEGKGTIVTICMP 765
            L+I S+EG GT+V + +P
Sbjct: 729 SLRIRSEEGIGTLVLVRLP 747


>gi|304393603|ref|ZP_07375531.1| PAS/PAC sensor signal transduction histidine kinase [Ahrensia sp.
           R2A130]
 gi|303294610|gb|EFL88982.1| PAS/PAC sensor signal transduction histidine kinase [Ahrensia sp.
           R2A130]
          Length = 814

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 232/739 (31%), Positives = 401/739 (54%), Gaps = 9/739 (1%)

Query: 36  SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEI 95
            +    F+      + IP++    L+ +A      +    +  E        + T+  + 
Sbjct: 47  PVWMRFFASERVLRRLIPLLIGGLLLLVAAVRTQTLMIELSNIEIQARSEIALTTQLAQS 106

Query: 96  -IFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKK 154
            +  N+ +   L     A ++L   L     L +  I LA     + A     S   G  
Sbjct: 107 RLSANSELSTTLQDSDAALAVLRDALPARSALPDISIYLADSTGKIVAQRGGGSVVEGVL 166

Query: 155 IGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLP------HNSGSILIINSRVPLL 208
           +G +I       + ++  +   + L       L+ ++P        +G + +++    L 
Sbjct: 167 LGRLIGRDFVESAGTELEEDVRSILFDGTESALASSVPLELADKTIAGYVALVHPSASLF 226

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
             WR  V + V  F  I ++LL I+++Y+ Q  + +E +++  E N   +TAL+RGRCGL
Sbjct: 227 ESWRTAVKVNVTLFLAIGSVLLIIVYAYFVQGARTRETESLYFETNARFDTALARGRCGL 286

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           W+++        S SM++++G    ++ + +  +A L+H D++ + +IA     +  +Q+
Sbjct: 287 WDWDLSRGSIVWSPSMHQMLGRAGRSRAMGYGELAELLHPDDRNLLQIANETFQESSRQI 346

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
           D  F + HASG  + +++RA+++       ++IGIA+D++E+  L+++  +AD RL +AI
Sbjct: 347 DHRFRILHASGGWVSMRLRAELVHYRGAVPHLIGIAVDVSEQEALKRQSRDADIRLREAI 406

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
           +  SEA VLWD  +R+V+CN  YQ+ + LP   +  G  +  +   +  P++  + +   
Sbjct: 407 DNISEAFVLWDAKERMVLCNGKYQQLFNLPSSAIRHGVTKQDVAAIRKAPVMRSQVNTDR 466

Query: 449 RSQDM--SKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
             +    + E +L D RW QI+E  T DGG +SVGTDIT +K NQ++L +S+R   ATI 
Sbjct: 467 NQKHHSNTFEAQLDDGRWFQISERPTLDGGAVSVGTDITQIKRNQSKLEDSEREHLATIV 526

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           +L   +Q L     E          ++++A+ ANK+KS+FLA MSHELRTPLNAI+GFS+
Sbjct: 527 ELRKMQQNLVAFANEADDQRLLADEQRKQADEANKSKSQFLANMSHELRTPLNAIIGFSD 586

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           ++++ +FG LG+ KY EYA DI  SG  LL +IN++L+MSKIE  ++ I  +   +  ++
Sbjct: 587 IMREGMFGPLGNEKYTEYANDIRSSGGFLLGVINDVLDMSKIEAGRMQIYPEELAVSDLL 646

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            E +R+I + A    +++  +I + L   AD+R +K++L  +LSN++KFT   G + +  
Sbjct: 647 QETLRIIAAQADDGELQVTTEIETGLDIIADRRAVKQVLINLLSNAVKFTPKGGSIQVSA 706

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            ++   V + I D+GIGI + ALE+IG PFE   ++  +   G GLGLAI+ +L  LHGG
Sbjct: 707 RRLDDNVEMEILDSGIGISQDALERIGLPFEQAASELTRDHVGSGLGLAIAKSLAELHGG 766

Query: 747 RLKIISQEGKGTIVTICMP 765
            + I S EG GT V + +P
Sbjct: 767 SVDISSIEGIGTTVLVRLP 785


>gi|323137189|ref|ZP_08072268.1| multi-sensor signal transduction histidine kinase [Methylocystis
           sp. ATCC 49242]
 gi|322397547|gb|EFY00070.1| multi-sensor signal transduction histidine kinase [Methylocystis
           sp. ATCC 49242]
          Length = 814

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 245/724 (33%), Positives = 381/724 (52%), Gaps = 9/724 (1%)

Query: 46  SSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFD 105
           +   +   + S + L+ +    +   TT   Q          +    +        I+ D
Sbjct: 34  AWLRRLAFVASSICLMSLMAFVVSMATTMQDQLVDDATADLELFARVVSHELHE-KIRAD 92

Query: 106 LASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRS 165
             S  +    L Q++    F     +L+   +  V A+           + +++      
Sbjct: 93  AQSLGQP---LNQIVPHRAFARGRRVLVTDGHGRVAAAFPPIESK-NVTLADVLGAGQVL 148

Query: 166 RSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSI 224
              +    +   +L D  P       LP   G + +I     +L  WR       + F+ 
Sbjct: 149 TEFADKAGVMRVTLADGTPALATVHKLPTPFGQVAMIYPLDNVLGEWRAIAARYALLFAF 208

Query: 225 ISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSM 284
            + +LL I++ Y+RQ ++ +  + +       +ETALSRGRCGLW+++    + + S SM
Sbjct: 209 TTLMLLVIVYGYFRQTRRRQAVEHVNALIRKRLETALSRGRCGLWDWDIARGRIYWSDSM 268

Query: 285 YEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWI 344
           YE++G+P E + LSF  +  LIH ++  +  IA  V+    K +D  F  +HA G  IW+
Sbjct: 269 YEMLGLPAERRCLSFGELNALIHPEDGDLTVIAEMVSASRTKSVDHEFRAKHADGRWIWV 328

Query: 345 QVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDR 403
           + RAQ++   +  G +++GIA+D++E+  L +  A A+ RL  AI+  SEA VLWD  +R
Sbjct: 329 RARAQLVDEANDPGKHLVGIAVDVSEQRALAEHTATANMRLRDAIDAISEAFVLWDAQNR 388

Query: 404 LVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS--QDMSKEIKLAD 461
           LV CN+ +   +GL     + G   + I    T P+I+   S  E+      + E +LAD
Sbjct: 389 LVTCNSKFLDLHGLSADAAIAGATYAQIMMRATAPLIQTEISSAEQRAADARTYEARLAD 448

Query: 462 SRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
            RWLQINE  T DGG +SVG DIT LK N+ +L ES+RRL A++ DL+ SRQ LE Q  +
Sbjct: 449 GRWLQINERRTKDGGYVSVGADITALKRNEEKLLESERRLTASVTDLTRSRQTLEMQAQQ 508

Query: 522 LSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKY 581
           L+    +Y  +K  AE A   KSEFLA MSHELRTPLNAI+GFSE+++ E FG LGS KY
Sbjct: 509 LATLAEQYHHQKAEAEAAYLAKSEFLANMSHELRTPLNAIIGFSEMMQAEPFGSLGSPKY 568

Query: 582 YEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKN 641
            EY  +I   G +L  ++++IL+MS++E   + + ++  ++       I    S A +KN
Sbjct: 569 VEYCNNIRQGGAYLNEVLSDILDMSRLEAGLVRLAEREVNVADATRRAIASWRSRADAKN 628

Query: 642 IKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTG 701
           I+I  +    L    D+  I K L  +LSNSIKFT+  G + +R  + G  + I + DTG
Sbjct: 629 IQIVAEADDRLRCIGDESAIVKALGVLLSNSIKFTDAGGFIRLRARRHGAAIAIFVEDTG 688

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
            GI   A+ ++G+PFE   +  +  + G GLGLAI+ AL +LHGG L+I S+ G GTI  
Sbjct: 689 RGIDPRAISRLGRPFEQSADLMENGMKGSGLGLAIARALVDLHGGALRIRSRLGLGTIAM 748

Query: 762 ICMP 765
           + +P
Sbjct: 749 MRLP 752


>gi|170748787|ref|YP_001755047.1| multi-sensor signal transduction histidine kinase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655309|gb|ACB24364.1| multi-sensor signal transduction histidine kinase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 793

 Score =  520 bits (1339), Expect = e-145,   Method: Composition-based stats.
 Identities = 221/733 (30%), Positives = 375/733 (51%), Gaps = 19/733 (2%)

Query: 40  HLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE-IIFQ 98
            L          +P    VFL  +   + + +  + A+                   +  
Sbjct: 29  RLGQAERWLRYAVPGTLAVFLACLVGLAALHIQGQRAEILAGAKAEVEGFARLAARAVGP 88

Query: 99  NNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
              +  D          L  L+ ++       +L+ +P+  + A+           +  +
Sbjct: 89  AGTVAED----------LRALMPESERHPGRRLLVVRPDTRIVAAHPPLPAD-RTTLAAV 137

Query: 159 IPELSRSRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTL 217
           + +        +        L   +       +LP  +G + ++    PLLR W      
Sbjct: 138 LGDSEPLSGLGERAGAMALELPGGESVLAAMHSLPGGAGQVAVLQPVEPLLRGWSARTRD 197

Query: 218 EVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKK 277
           ++V  +  + +++ +  +Y  Q ++    D    +    +ETAL RG CGLW+++    +
Sbjct: 198 QIVLIAAAAIVIVGVGLAYGLQTRQAARADRAREQIRGRLETALRRGACGLWDWDIARGR 257

Query: 278 FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
            + S SMY ++G   +++ LSF  +  L+H D+  +  +AR +   +   +D  F MR A
Sbjct: 258 IYWSDSMYTLLGYRRQHEYLSFGDVNGLVHPDDGDLYSLARGLA-ANQTHVDHAFRMRGA 316

Query: 338 SGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV 396
            GA +W++ RA+++     GG +++GIA D++E+  LE+  A AD RL  A+E  SEA V
Sbjct: 317 DGAYVWLRARAEVVADAADGGRHLVGIANDISEQRALEETNAAADMRLRDAVEAISEAFV 376

Query: 397 LWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE----RSQD 452
           LWD  +RLV+CN+ ++  + L       G + + +      P +   + +          
Sbjct: 377 LWDTGNRLVLCNSKFRHLHALSPEDAQAGRSYTDVMGRGVLPQVRRESPEAGMALTGMAA 436

Query: 453 MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
            + E +L+D RWLQI+E  T DGG +SVGTDIT LK NQ QL  S+R L  T+ DL  SR
Sbjct: 437 RTFEAELSDGRWLQISERRTKDGGYVSVGTDITSLKRNQEQLLASERELIETVKDLKRSR 496

Query: 513 QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
           + LE Q  +L+    +Y  +K  AE AN+ K+EFLA MSHELRTPLNAI+GF++V++  +
Sbjct: 497 RTLELQTQQLADLAERYLDQKAAAEAANQAKAEFLANMSHELRTPLNAIIGFADVMENAV 556

Query: 573 FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
            G LG+ +Y EY +DI  SG HLL+MI++IL+M+++E  ++ +  +       ++  +  
Sbjct: 557 LGPLGTPRYTEYCRDIRESGSHLLSMIDDILDMARLEARRVRLSPRAISAETAVSAALAP 616

Query: 633 IGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
           + ++A+ K I +   +   L   AD + I +IL  ++ N++KFT   G++ +R  + G C
Sbjct: 617 VEAAAREKAITVSVDVVPGLELLADPQAIGQILANLVQNAVKFTPAGGRVAVRGRRAGAC 676

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             + I D GIGIP++ L ++G+PF  +  Q  +   G GLGLAI+ ++  LHGG L+I S
Sbjct: 677 THLYIEDNGIGIPRTDLARLGRPFTQVERQMTRCHKGSGLGLAITRSMVELHGGSLRIRS 736

Query: 753 QEGKGTIVTICMP 765
           +E  GTIV + +P
Sbjct: 737 EETVGTIVLVRLP 749


>gi|154251412|ref|YP_001412236.1| PAS/PAC sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
 gi|154155362|gb|ABS62579.1| PAS/PAC sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
          Length = 600

 Score =  511 bits (1316), Expect = e-142,   Method: Composition-based stats.
 Identities = 211/551 (38%), Positives = 325/551 (58%), Gaps = 1/551 (0%)

Query: 216 TLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDN 275
           +  ++F S++S   L + +   R  +   E +  L+E     + A +  RCG+W+++   
Sbjct: 45  SRTLLFSSLLSGGYLALAYMLVRLRESKLEAEAALVENQHRFDMAFAGARCGIWDWDLGE 104

Query: 276 KKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMR 335
            + + S +M++++G+   +K LS   I  + H D+    +   +   +  +  D  F +R
Sbjct: 105 NRIYWSSAMFDMVGLKQPSKRLSPNEIKAMAHPDDAGAIDEIANAASRPSRSYDTAFRLR 164

Query: 336 HASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA 394
           HA G+ +W+  + Q+     + G  ++GI +D+T++   E+R  EA++RL  AIE   EA
Sbjct: 165 HADGSWVWMHAKGQVWGGGRAAGERLVGITIDITDQKIAEERVHEANERLRDAIESVGEA 224

Query: 395 LVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMS 454
            VLWD   RL   N+ + +   L +  + PG  R  +            + D   +    
Sbjct: 225 FVLWDAEGRLATANSKFGEFLNLGEDYMHPGAPRGEMMQRAGVGDAWPVSQDGGEAGAGV 284

Query: 455 KEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
            EI+L   RWLQI+E  T  GG ++VGTDIT +K  +A L ++K  L+ T+ DL TSR+ 
Sbjct: 285 HEIRLPTGRWLQISERRTKSGGHVNVGTDITAIKEQEAALTDNKVALEKTVRDLETSRRK 344

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
           L+ Q  +L     KY  EK RAE AN++KSEFLA MSHELRTPLNAI+GFSE+++  +FG
Sbjct: 345 LQEQARQLVDLAEKYASEKTRAEAANRSKSEFLANMSHELRTPLNAIIGFSEIMESGLFG 404

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
           ELGS KY EYA DIH SG HLL +IN+IL+MSKIE  +++++ Q  +L  ++ E +RL+ 
Sbjct: 405 ELGSPKYKEYAGDIHASGTHLLELINDILDMSKIEAGRMTLETQPLELSEVVEESLRLVS 464

Query: 635 SSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI 694
             A+   + I  ++      +ADKR +K++L  +LSN++KFT   G + +R    G+ V 
Sbjct: 465 GRAEVAKVHIANEMGPLPTVDADKRAVKQVLLNLLSNAVKFTPAGGSIHLRGETSGRFVT 524

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
           I++ DTGIGIP SAL KIG+PFE + +Q+ +S  G GLGLA+S +L  LHGG L + S E
Sbjct: 525 ISVEDTGIGIPASALPKIGRPFEQVESQHSKSHKGTGLGLALSRSLVELHGGALVLESTE 584

Query: 755 GKGTIVTICMP 765
           G GT V+  +P
Sbjct: 585 GVGTKVSFTLP 595


>gi|114569501|ref|YP_756181.1| multi-sensor signal transduction histidine kinase [Maricaulis maris
           MCS10]
 gi|114339963|gb|ABI65243.1| multi-sensor signal transduction histidine kinase [Maricaulis maris
           MCS10]
          Length = 911

 Score =  501 bits (1291), Expect = e-139,   Method: Composition-based stats.
 Identities = 205/752 (27%), Positives = 360/752 (47%), Gaps = 27/752 (3%)

Query: 20  QKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSS-IIKVTTRYAQQ 78
           +  +  S +   RA  + I+           T   + +     IA  +    +       
Sbjct: 112 RDASPQSVEGLTRARLAAINESE------LVTDVALLLPGGQVIAVGTPADGLRDITGAA 165

Query: 79  EKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNE 138
               +  +  +T  +  +           +     + L    A   +  +  + LA    
Sbjct: 166 LDAPSGLTAQVTGGVAHLILAVPTPLSDGTVGAFVARLSTESALPDWGDDRVVALADAQG 225

Query: 139 LVFASSTKNSHY-IGKKIGE---IIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHN 194
            + A   +      G ++ E   + P    S +       S+A   ++        +   
Sbjct: 226 GMLAIRPRMPSARPGTQLAERFGLQPGFIDSLAAGGGGATSDARFGEERVTFAVAPITGT 285

Query: 195 SGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEAN 254
              +  + +       W   ++   + F     + L +    + Q  + +     L +  
Sbjct: 286 ELRVYALGAMRINQDAWYRTISFYGLMFIAPIFVALGLCALVFMQMGRLRSTRQQLEDNE 345

Query: 255 ICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC 314
                A+   RCG+W++N +     ++ S+  I+G+    +  + +   +L    +++  
Sbjct: 346 QRFRVAIEGARCGVWDWNPEADTVFVTDSLARILGLDAATEC-TGQQFLQLFSKPDRERL 404

Query: 315 EIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRT-ISGGMNIIGIAMDLTEKYHL 373
             A         ++D       A+ + +W+Q+R +++    +    IIG+A+D+TE+   
Sbjct: 405 RAAMRGAPA-GAEVDHE---VLAARSPVWLQMRGRILPGGEANHTRIIGVAIDVTERKGA 460

Query: 374 EKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD 433
           + R A A+ RL  A+E  SE+ VLWD   RLV+ N  ++  +   D +L PG +   ++ 
Sbjct: 461 QARVAAAENRLRAALESMSESFVLWDSRQRLVLWNRKFRDLFDFTDGMLKPGMSYDAVEQ 520

Query: 434 AQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
           A  R I   +T         + EI+L++ RWL  ++  T DGG +SVG DIT LKH++A 
Sbjct: 521 AAARAI---KTVHGGSEGKAAYEIELSNGRWLHYSDRPTADGGLVSVGADITDLKHHEAA 577

Query: 494 LRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
           L E++ +L+ T++D+  S+         ++    KY+ EK RAE AN++KSEFLA MSHE
Sbjct: 578 LTENESQLRKTVDDVKRSQ-------ARIADLAKKYEEEKIRAEEANRSKSEFLANMSHE 630

Query: 554 LRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKI 613
           LRTPLNAI GFSE++ +E+FG LG  +Y  Y +DI  SG+HLL +IN+IL+MSKIE  K+
Sbjct: 631 LRTPLNAINGFSEIMMQEMFGPLGDDRYVGYMKDILSSGRHLLELINDILDMSKIEAGKM 690

Query: 614 SIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSI 673
            +  +  D   ++ + IR++   A+ K +K+   +        D R  K+++  ++SN++
Sbjct: 691 QLQPEPTDASELVEQSIRIVRGRAEEKQLKLRADVSDLPEIEVDPRAFKQVMINLVSNAV 750

Query: 674 KFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLG 733
           KFT   G++ +R    G  V   ++DTGIGI K  L ++G+PFE + +Q+ +S  G GLG
Sbjct: 751 KFTPEGGRVTVRGFLSGLGVAFQVSDTGIGIAKDDLPRLGRPFEQIESQHSKSFQGSGLG 810

Query: 734 LAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           LA+S +L  LHGG L I S  G+GT V++ +P
Sbjct: 811 LALSKSLIELHGGTLSIDSVLGEGTTVSVVLP 842


>gi|83945614|ref|ZP_00957960.1| non-motile and phage-resistance protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83850980|gb|EAP88839.1| non-motile and phage-resistance protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 849

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 192/662 (29%), Positives = 332/662 (50%), Gaps = 22/662 (3%)

Query: 107 ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSR 166
            S     + L       R+  +   +L      + A +   + + G         L    
Sbjct: 178 GSVGALIASLTPQALLPRWNRDEVAMLTDAEGRLLALNPD-TPFTGAPFAAERLGLDPEA 236

Query: 167 SR---SKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFS 223
                     M  A L +    + +  +       L +       + W   +   ++ F 
Sbjct: 237 VSEMSRNGGAMRGAHLGEDARILGAAAINGAPLQALSLGPDGIDRQAWNSTLLFHLLLFL 296

Query: 224 IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRS 283
                   +      Q  +  +    L ++   +  A+   RCG+W+++ D  +  L+ S
Sbjct: 297 APLGTAGALSIVLRNQMGRLGDTQARLHDSEGRLHLAIEGARCGVWDWDLDTDEVVLTDS 356

Query: 284 MYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIW 343
             +++G       LS   +  L+  +++     A      + + +D       A+G  +W
Sbjct: 357 FAQLIGRARGES-LSGPELLLLLGKEDRPKVRAALRGA-ANAQDVDLEVR---AAGLPVW 411

Query: 344 IQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDR 403
           +Q+R +++        IIG+A+D+TE+   + R A A+ RL  A+E  SE+ VLWD   R
Sbjct: 412 LQLRGRLLP---HTRRIIGVAIDITERKGAQARVAAAESRLRAALESMSESFVLWDARGR 468

Query: 404 LVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSR 463
           LV+ N  ++  +G  +  L  G++   ++ A  R I     S+  +      +++L D R
Sbjct: 469 LVLWNRKFRDFFGFNEPDLRIGSSYEQVEAAAARAIKAAHASEDGQDD---YDLELNDGR 525

Query: 464 WLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELS 523
           W+   E  T DGG +SVG DIT LK  Q  L+++ R       ++  + + L R +  + 
Sbjct: 526 WIHYAERRTADGGLVSVGADITALKDQQRALKDNDR-------EMRRTVENLRRSQERVQ 578

Query: 524 IANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYE 583
              A Y+ EK RAE AN++KSEFLA MSHELRTPLNAI GFSE++  E+FG LG  +Y +
Sbjct: 579 ELAANYEQEKIRAEEANRSKSEFLANMSHELRTPLNAINGFSEIMAGEMFGPLGHERYQD 638

Query: 584 YAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK 643
           Y +DI  SGQHLL++IN+IL+MSKIE  K+ +  +      +I + +R++ + A+ K+I+
Sbjct: 639 YVRDILSSGQHLLSLINDILDMSKIEAGKMQLQPEPLMPAEVIEQCVRIMRARAEEKSIE 698

Query: 644 IEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIG 703
           +  +        AD R +K+++  ++SN++KFT   GK+ +R  +    V++ ++DTGIG
Sbjct: 699 LTVEGSELPEITADPRALKQVILNLMSNAVKFTPEGGKVKLRGFQAADGVVLQVSDTGIG 758

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           I +  L+++G+PFE + +Q+ +   G GLGLA+S +L  +HGG L+I S+ G+GT V+  
Sbjct: 759 ISEDDLQRVGRPFEQIESQHSKKHQGSGLGLALSKSLIEMHGGALRIDSRLGEGTTVSFT 818

Query: 764 MP 765
           +P
Sbjct: 819 LP 820



 Score = 37.7 bits (86), Expect = 7.3,   Method: Composition-based stats.
 Identities = 18/168 (10%), Positives = 45/168 (26%), Gaps = 19/168 (11%)

Query: 102 IKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSHYIGKKIGEI 158
           +  D+  +K A++ +    ++ R   ES     +L      +   + K   + G    ++
Sbjct: 428 VAIDITERKGAQARVAAAESRLRAALESMSESFVLWDARGRLVLWNRKFRDFFGFNEPDL 487

Query: 159 IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
                        +  S   ++      +        G               R     E
Sbjct: 488 ------------RIGSSYEQVEAAAARAIKAAHASEDGQDDYDLELNDG----RWIHYAE 531

Query: 219 VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRC 266
                     +   + +   Q +  K+ND  +      +  +  R + 
Sbjct: 532 RRTADGGLVSVGADITALKDQQRALKDNDREMRRTVENLRRSQERVQE 579


>gi|296446361|ref|ZP_06888306.1| PAS/PAC sensor signal transduction histidine kinase [Methylosinus
           trichosporium OB3b]
 gi|296256134|gb|EFH03216.1| PAS/PAC sensor signal transduction histidine kinase [Methylosinus
           trichosporium OB3b]
          Length = 750

 Score =  473 bits (1218), Expect = e-131,   Method: Composition-based stats.
 Identities = 225/678 (33%), Positives = 352/678 (51%), Gaps = 9/678 (1%)

Query: 91  EAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHY 150
            A ++      +  D+ +++   +                 ++   +  V A++      
Sbjct: 68  AAADLTIVARAVASDIETRR---AGAAPTPPDYAAARGRQAVVTNVDGRVLAATPPLP-- 122

Query: 151 IGKKIGEIIPELSRSRSRSKTVQMSEASL-DQQPYHVLSVNLPHNSGSILIINSRVPLLR 209
           IG  + ++I         ++       +L D         NL   SG I +I+    +L 
Sbjct: 123 IGGLLADLIGPQPLLTEFAEKAGTLRITLADGTRALATLRNLSDGSGQIALIHPHEAVLA 182

Query: 210 LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLW 269
            WR       +  +  +A+      +  RQ ++    +         V+ AL  GRCGLW
Sbjct: 183 DWRAATIRCAMVAAGSAAVTAAAGLALRRQTRRAALAERAHAAMRRRVDAALGSGRCGLW 242

Query: 270 NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD 329
           +++    + H S SM+E++G+  E + +SF  IA  +H  +  + E   +V   H    D
Sbjct: 243 DWDLARGRIHWSDSMFEMLGLDIERRPISFGEIALRLHPQDLDLAEKVEAVAATHGA-FD 301

Query: 330 QIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
             F +  A GA +W+++RA+++    G G  ++GIA+D+TE   L +  A AD RL  AI
Sbjct: 302 HQFRIADAVGAWVWLRMRAELIEEEGGAGPRLVGIAVDVTEHRALAEGAATADMRLRDAI 361

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
           E  SEA VLWD  +RLV+CN+ +   +GL   V  PG + + I  +           D  
Sbjct: 362 ETISEAFVLWDAQNRLVVCNSKFLGLHGLSADVATPGASYARIMASAVALEESEIIGDAA 421

Query: 449 -RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIND 507
             + +   E +LAD RWLQI+E  T DGG +SVG DIT LK NQ +L +S+RRL A++ D
Sbjct: 422 PTANERIYEARLADGRWLQISERRTKDGGYVSVGADITALKRNQEKLIDSERRLTASVAD 481

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L  SRQ LERQ  EL+    +Y ++K  AE AN  KS+FLA MSHELRTPLNAI+GFSE+
Sbjct: 482 LIGSRQALERQAQELATLAEQYHLQKGEAEAANLAKSQFLANMSHELRTPLNAIIGFSEM 541

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           ++ ++FG LGS KY EY   IH  G++LL+++ +IL+MS++E  ++ +++   DL     
Sbjct: 542 MQAQVFGALGSPKYVEYCSHIHQGGRYLLDVLTDILDMSRLEAGRVRLEESEIDLSGAAR 601

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
                   +A++K I++       L    D   I K +  ++SNS+KFT   G + +R  
Sbjct: 602 ATAERSRRAAEAKGIELIVDAREGLRCCGDHDAIVKAIAVLVSNSLKFTAAGGCVRLRAR 661

Query: 688 KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
           +  + V+I + DTG GI   A+  +G+PFE      +  + G GLGLAI+ +L  LHGG 
Sbjct: 662 RSYRAVLIFVEDTGCGIDARAVAALGRPFEQPATVMENGMKGSGLGLAIARSLMALHGGS 721

Query: 748 LKIISQEGKGTIVTICMP 765
           L+I S+ G GTI  + +P
Sbjct: 722 LRIRSRVGVGTIAMLRIP 739


>gi|315498970|ref|YP_004087774.1| multi-sensor signal transduction histidine kinase [Asticcacaulis
           excentricus CB 48]
 gi|315416982|gb|ADU13623.1| multi-sensor signal transduction histidine kinase [Asticcacaulis
           excentricus CB 48]
          Length = 864

 Score =  473 bits (1218), Expect = e-131,   Method: Composition-based stats.
 Identities = 196/683 (28%), Positives = 327/683 (47%), Gaps = 18/683 (2%)

Query: 86  SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASST 145
           +L L   +    +   ++     + +A + L   L       ++ I+L      + ++S 
Sbjct: 171 ALALGSRLTRTARAYLVRTPAPGRVRAVARLNNPLRDAENTRDNQIVLINAAGDILSASD 230

Query: 146 KNSHYIG-KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSR 204
           +    +  +K   + PE  R  + S  +                    +   ++ +  S 
Sbjct: 231 ERLTGLNIRKALTVTPEQIRDNANSARISQGTLEEKGFVRIAAVREGENGLTTLYVEPSN 290

Query: 205 VPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRG 264
               R W          F     +          Q+++N E              A+   
Sbjct: 291 AAAARNW----LTTATLFIGPLIIGALFGMLLIVQSRRNSEAARQYEAKETRYRLAVEAA 346

Query: 265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKH 324
           RCG+W ++ ++ +  +S     + G    +   +   +   I  ++++    A      H
Sbjct: 347 RCGIWEWDLESDQVFMSEVTGVMFGW-GGSGVATTNEVLLRIAPEHRETVRKALLNARGH 405

Query: 325 VKQLDQIFHMRHASGADIWIQVRAQMM--RTISGGMNIIGIAMDLTEKYHLEKRYAEADQ 382
              LD  F +   +G  IWI  R Q    R  +G   + G+A+D++E+   + R   A+ 
Sbjct: 406 GA-LDVSFRVPGDNGRAIWIDARGQATGPRGPAGFTRLSGVALDVSEERAAQSRAQRAEA 464

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
           RL+ AI   S+A VLWD+  RLVM NA + + + +    L  G +R +I+      I   
Sbjct: 465 RLTGAINSVSDAFVLWDRRGRLVMWNAVFGRTFSIDPRFLKAGTSRELIEKVMA--IAIR 522

Query: 443 RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
           R       ++   E +L D RW+QI+E  T +GGT+  G DIT +K  +   R ++    
Sbjct: 523 RQEPVIDGREGVVEAELNDGRWIQISESRTLEGGTVVTGADITAIKVQEEMSRRNE---- 578

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
                L      LE+ +   +    KY++ K RAE AN  KSEFLA MSHELRTPLNAI 
Sbjct: 579 ---EQLQAMVDKLEQSRRIQTDLAKKYEMAKIRAEQANHAKSEFLANMSHELRTPLNAIN 635

Query: 563 GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
           GFSE++  E+FG LG  +Y EYA DI  SGQHLL +IN+IL+MSKIE  K+++  +   +
Sbjct: 636 GFSEIMAGEMFGPLGHARYKEYAGDILSSGQHLLALINDILDMSKIEAGKMTLRFEPVSV 695

Query: 623 IPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKM 682
             ++++ +RL+   A+   +K+   +P      AD R +K+IL  IL+N+IKFT + G +
Sbjct: 696 EEVVDDTLRLVRQRAEKAGLKMRVHLPQLPDIQADYRALKQILLNILTNAIKFTPSGGTI 755

Query: 683 MIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
            +        + + +ADTGIGI    +E++ +PFE + NQ+ ++  G GLGLA++ +L  
Sbjct: 756 TVSAVPTDSFMHLYVADTGIGIAPKDMERLARPFEQIENQFSRTKEGTGLGLALTKSLIE 815

Query: 743 LHGGRLKIISQEGKGTIVTICMP 765
           +H GRL++ S  G+GT V++ +P
Sbjct: 816 MHSGRLEVDSTVGQGTTVSVILP 838


>gi|283850587|ref|ZP_06367875.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
 gi|283574158|gb|EFC22130.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
          Length = 1093

 Score =  465 bits (1197), Expect = e-128,   Method: Composition-based stats.
 Identities = 128/681 (18%), Positives = 252/681 (37%), Gaps = 53/681 (7%)

Query: 96  IFQNNNIKFDLASQKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIG 152
                 ++      ++  + +GQ   + R L   + S I+       V   +       G
Sbjct: 302 AVLRRTVRRQTGKLQELLAAVGQSEERYRELVENAGSVIVRLDLLGRVVFCNAFGQRLFG 361

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
           +   ++      S         +E+  D       S      + +    +        W 
Sbjct: 362 QTQDQMFGRTIASLIDPPDDDEAESWDDILADVAGSAI---GTRAFDRRHRTRNGEAAWL 418

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
                 +   S  +A +L +         + K+ +  L  +             G+W+++
Sbjct: 419 AWSLRALRAPSGQAAEILCVG----ADITERKQVEEALAASEARYALVTRGANDGIWDWD 474

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC-EIARSVTGKHVKQLDQI 331
                 + S    EI+G   +          +LIH D+  I     +      V      
Sbjct: 475 LVTDTVYFSPRYLEILGFSPDAMPPRAETWTKLIHPDDADIVLRENKRCADGEVDNFVVE 534

Query: 332 FHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           + MRH  G+  WI  R   +R   G +  + G   D+T +   E+   E+  +L+K    
Sbjct: 535 YRMRHKDGSYRWILGRGASLRDKYGRIVRMAGTHTDVTRRKRDEEALRESQDQLAKIFRY 594

Query: 391 TSEAL-VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
           +   + V   ++ R++  N    + +G     ++   +         RP           
Sbjct: 595 SPVGISVTTRRDGRILDVNETGARMFGHNKADVIGRTSTE--IGLWARPEDRGALMAEMA 652

Query: 450 SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
           +       +L         +    +G  +        ++        +            
Sbjct: 653 AAGSVVAKEL---------DLRHKNGSPVVTLYSAVPIQVYGESGILAVLV--------- 694

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
                     TE        +  KE AETAN+ KSEFL+ MSHE+RTP+N ILG + V+ 
Sbjct: 695 --------DITERKAMEQALRRSKEAAETANRAKSEFLSTMSHEIRTPMNTILGMAGVLA 746

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
                     K+ E  + I  +G  LL ++N+IL++S+IE   + ++++  D++ +  + 
Sbjct: 747 ASDLPP----KHTEALRAIEAAGGTLLALLNDILDLSQIEAGGLIMEEKACDIVALAGKL 802

Query: 630 IRLIGSSAQSKNIKIEKKIPSELFFN--ADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
             ++   A  K + +   +   L          I+++L  +L N++KFT+  G++++   
Sbjct: 803 TDMMRPDAARKGLALRLDVQGTLPARLSCSPDRIRQVLVNLLGNAVKFTDQ-GEIVLELG 861

Query: 688 KIGQ-----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
           +         + + + DTGIGIP      I   F  ++    +  GG GLGLAI + L +
Sbjct: 862 REDHADTGAWLRLAVRDTGIGIPADKQTVIFDRFTQVNASASRHYGGVGLGLAICNKLVH 921

Query: 743 LHGGRLKIISQEGKGTIVTIC 763
           + GG +++ S  G+G++ T+ 
Sbjct: 922 MMGGSIRVDSTPGQGSVFTVS 942


>gi|288941099|ref|YP_003443339.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM 180]
 gi|288896471|gb|ADC62307.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM 180]
          Length = 1650

 Score =  460 bits (1185), Expect = e-127,   Method: Composition-based stats.
 Identities = 139/678 (20%), Positives = 268/678 (39%), Gaps = 46/678 (6%)

Query: 102  IKFDLASQKKAESMLGQLLAK---TRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
            I  D+  ++K E  L +  ++       S   I +    +     S  ++     +  + 
Sbjct: 620  IALDITERRKIERALEERESRLQFIIANSPDLIFIQDLEQRYIWLSHPSAPL---RPEDC 676

Query: 159  IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
            +    R     +                    +                   WR+     
Sbjct: 677  LGHTDRDLLLPEEGARLMRIKQDVLDTGRRTTIELPLTLDGQRRVFDATYEPWRDANG-- 734

Query: 219  VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
                       L  L  Y R   + K+ +      N  +  AL     G W+++      
Sbjct: 735  ----------TLVGLAGYVRDITERKQAEIAHQADNQRLHWALQAAHGGAWDWDLSTDVA 784

Query: 279  HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS 338
              S  MY + G+  E K +       L+   ++           +  + L   F +RH  
Sbjct: 785  WWSPEMYALWGVEPETKMV-LDNSLSLVADQDRASLRANVERAIQDGRDLQCEFRIRHPQ 843

Query: 339  GADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
              + W+    +++    G  +++G++ D+T++  +E+   +++ R    +E  +  ++  
Sbjct: 844  HGERWMASWGRLVTDADGLSHLLGLSFDITDQKRMEQALKDSESRYRDLVENVNSVILRL 903

Query: 399  DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK 458
              +  +   N    + +G     L+ G   +++             S  +    M +EI 
Sbjct: 904  APDGLIAFANEYALRFFGYAAEELI-GRPVTVLVPTVD--------STGQNLSAMVQEIL 954

Query: 459  LADSRWLQI-NEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILER 517
                R++   NE   HDG  + +      L  ++ +L            +     Q L+R
Sbjct: 955  ANSERYVHHINENLCHDGRRVWMAWTNKALYDDRGRLIGVLAVGNDI-TERRRLEQELDR 1013

Query: 518  QKTELS----IANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
             +  L        A+    + RAE AN+ KS FLA MSHE+RTP+NA+LGF  ++++   
Sbjct: 1014 HRRHLEALVDERTAQLTEARARAEAANQAKSAFLANMSHEIRTPMNAVLGFCYLLEQHAL 1073

Query: 574  GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
                +       + IH +GQ LL++IN+IL+ SKIE  ++ ++     L  +++    ++
Sbjct: 1074 DPASAD----LVRKIHNAGQALLDLINDILDFSKIEAGRLELEAAPFRLSELLDTLAGIM 1129

Query: 634  GSSAQSKNIKIEKKIPS-ELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
             ++A  K +++    P  ++     D   ++++L  +L N+IKFT   G++ +R   + +
Sbjct: 1130 TAAAGDKPLELILTPPEADIEGLIGDAGRLRQVLINLLGNAIKFT-ARGEVELRIECLAE 1188

Query: 692  C-----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                  +   + DTGIGI   + E++ QPF        +  GG GLGL+IS  L  L GG
Sbjct: 1189 HDDAVELRFAVRDTGIGIDPESQERLFQPFTQADVSTTRRFGGTGLGLSISRQLVRLMGG 1248

Query: 747  RLKIISQEGKGTIVTICM 764
             L+I SQ G+G+     +
Sbjct: 1249 TLEIESQPGQGSTFHFSL 1266



 Score = 99.3 bits (246), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/404 (10%), Positives = 106/404 (26%), Gaps = 25/404 (6%)

Query: 117 GQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSE 176
              L      +   + +        A S +     G +  ++I                 
Sbjct: 385 EARLRLFFDHAPVALAMFDRQMRYLAISRRWLADFGLEDSDLIGRGHYETFP-----DIP 439

Query: 177 ASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSY 236
               +     L+  +      + +      L R W          F       L  +  +
Sbjct: 440 ERWREAHRRALAGEVLGCDDDVFVRQDGTVLRRCW---ELRPWYEFDGT----LGGIVLF 492

Query: 237 YRQAKKNKENDTIL---LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYE 293
                  K+ +       E      + +       W  +   +  + +R   +   + +E
Sbjct: 493 TDDVSPRKQAEQAQAAQRETENRFRSFMDHTPVLAWLKDDQGRHVYANRGFEQHFRLNWE 552

Query: 294 NKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRT 353
           +          L   +  ++            + L+ I       G   +          
Sbjct: 553 DWQGKTD--FELWPIEIAEVFRRNDQQVLATGQALETIEESVDPDGQPHFWLTTKFTFDD 610

Query: 354 ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQK 413
            +G   + GIA+D+TE+  +E+   E + RL   I  + + + + D   R +  +     
Sbjct: 611 QTGQTFVGGIALDITERRKIERALEERESRLQFIIANSPDLIFIQDLEQRYIWLSHPSAP 670

Query: 414 AYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKL---ADSRWLQINEW 470
                    +    R ++   +   ++  +    +  +  + E+ L      R       
Sbjct: 671 L---RPEDCLGHTDRDLLLPEEGARLMRIKQDVLDTGRRTTIELPLTLDGQRRVFDATYE 727

Query: 471 CTHD--GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
              D  G  + +   +  +   +      +   +     L  + 
Sbjct: 728 PWRDANGTLVGLAGYVRDITERKQAEIAHQADNQRLHWALQAAH 771



 Score = 66.9 bits (162), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/254 (9%), Positives = 64/254 (25%), Gaps = 9/254 (3%)

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
            +  +++ L L +    +   ++ +   + L      +          L  F+   +   
Sbjct: 351 PWPVLVALLGLGVAVLVFVLLRERRRATSRLRRQEARLRLFFDHAPVALAMFDRQMRYLA 410

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASG 339
           +SR      G+   +              D  +    A                     G
Sbjct: 411 ISRRWLADFGLEDSDLIGRG---HYETFPDIPERWREAHRRALAGEVLGCDDDVFVRQDG 467

Query: 340 ADIWIQVRAQMMRTISGGMNIIGIAM-DLTEKY---HLEKRYAEADQRLSKAIECTSEAL 395
             +      +      G +  I +   D++ +      +    E + R    ++ T    
Sbjct: 468 TVLRRCWELRPWYEFDGTLGGIVLFTDDVSPRKQAEQAQAAQRETENRFRSFMDHTPVLA 527

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIE--YRTSDPERSQDM 453
            L D   R V  N  +++ + L            +              +     ++ + 
Sbjct: 528 WLKDDQGRHVYANRGFEQHFRLNWEDWQGKTDFELWPIEIAEVFRRNDQQVLATGQALET 587

Query: 454 SKEIKLADSRWLQI 467
            +E    D +    
Sbjct: 588 IEESVDPDGQPHFW 601


>gi|329849802|ref|ZP_08264648.1| non-motile and phage-resistance protein [Asticcacaulis biprosthecum
           C19]
 gi|328841713|gb|EGF91283.1| non-motile and phage-resistance protein [Asticcacaulis biprosthecum
           C19]
          Length = 836

 Score =  460 bits (1185), Expect = e-127,   Method: Composition-based stats.
 Identities = 191/623 (30%), Positives = 301/623 (48%), Gaps = 13/623 (2%)

Query: 145 TKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSR 204
           + +   IG  I + +             +            V   + P   G I +    
Sbjct: 208 SSDERLIGLDIKDALSVSYAQLRARADSRDLIQGARDGDGFVKLASAPQGDGRIAVAGVP 267

Query: 205 VPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRG 264
                         ++F      +          QA+K   ++            A+   
Sbjct: 268 TQQFYSSSAAWIKGLIFVGGPLLIGALFGVLLVFQARKTHTDNLQFQANEQRYRLAVEAA 327

Query: 265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKH 324
           RCG+W+++ +    ++S     ++         +       +  +++     A       
Sbjct: 328 RCGIWDWDLEQDLIYMSDVTGVML-GWGGGGVATTGEFVNRVAPEHRADVMKALDSARLK 386

Query: 325 VKQLDQIFHMRHASGADIWIQVRAQMM--RTISGGMNIIGIAMDLTEKYHLEKRYAEADQ 382
               D  F + +A G  IW+ VR Q +  R   G + + G+A+D++++   + R   A+ 
Sbjct: 387 GA-FDVSFRVPNAEGKSIWVDVRGQSVGARNQLGFLRLNGVALDVSDERMAQSRAQRAEA 445

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
           RL  AI   S+A VLWD+  RL+M N  + + +G+ +  L  G  R +I       I   
Sbjct: 446 RLLDAINSVSDAFVLWDRRHRLLMWNKTFGETFGIDERFLRVGTPRELIDQVMQ--IAIR 503

Query: 443 RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
           R      ++D   E +L + RW+QI E  T +GG +  GTDIT +K  +   R       
Sbjct: 504 RHQPAPDARDGVYEAELNNGRWIQIAESRTLEGGRVLTGTDITAVKIQEEFRRR------ 557

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
               +L    Q LE+ + +  I   KY++ K RAE AN  KSEFLA MSHELRTPLNAI 
Sbjct: 558 -NEEELQALVQKLEQARQQQMILARKYEMAKIRAEAANHAKSEFLANMSHELRTPLNAIN 616

Query: 563 GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
           GFSE++  E+FG LG  +Y EYA DI  SGQHLL++IN+IL+MSKIE  K+++  +   L
Sbjct: 617 GFSEIMATEMFGPLGHARYKEYAGDILGSGQHLLSLINDILDMSKIEAGKMTLRIEPVSL 676

Query: 623 IPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKM 682
             +I + +RL+   A+   +KI   +P      AD R +K+IL  +L+N+IKFT  +G +
Sbjct: 677 DEVIEDTLRLVRQRAEKAGLKIRVHMPQLPEIEADFRALKQILLNLLTNAIKFTPQHGTV 736

Query: 683 MIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
            I  +     V I +ADTGIGI    +E++ +PFE + NQ+ ++  G GLGLA++ +L  
Sbjct: 737 TISAAMTDNNVHIAVADTGIGIAAKDMERLARPFEQIENQFSKTKEGTGLGLALTKSLIE 796

Query: 743 LHGGRLKIISQEGKGTIVTICMP 765
           +H GRL+I S EG+GT V + +P
Sbjct: 797 MHSGRLEIDSTEGQGTTVNVILP 819


>gi|239907994|ref|YP_002954735.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239797860|dbj|BAH76849.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 1093

 Score =  460 bits (1185), Expect = e-127,   Method: Composition-based stats.
 Identities = 133/681 (19%), Positives = 253/681 (37%), Gaps = 50/681 (7%)

Query: 94  EIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGK 153
            +  Q++ +   L +  ++E    +L+      + S IL       V   +     + G 
Sbjct: 302 TVRRQSSRLDQLLVAVGQSEERHRELVQS----AASVILRLDHQGRVVFCNAFGLEFFGF 357

Query: 154 KIGEIIPELSRSRS-RSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
            + E+I                 +++        L+        +  +            
Sbjct: 358 TLEEMIGRDIGLLIDLPDVPGTEDSADAASWPQALTAIAQAPESAAALTRQHRRKNGELA 417

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
                     +    +   +         + K  +  L  +             G+W+++
Sbjct: 418 WIAWSLRGLRAATGGVSEILCIG--NDITERKRIEEALRASEARYTLVARGANDGIWDWD 475

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC-EIARSVTGKHVKQLDQI 331
                 + S    EI+G   +          + IH D+ +      +      V      
Sbjct: 476 LRTNIVYYSPRYLEILGYTPDEVQSLLDEWTKRIHPDDAENVIRANKRCADGEVDNFAVE 535

Query: 332 FHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           + MRH  GA  WI  R   ++   G  + + G   D+T +   E+   E+  +L+K    
Sbjct: 536 YRMRHKDGAYRWILGRGASLKDERGVVIRMAGTHTDVTRRKRDEEALRESQDQLAKIFRF 595

Query: 391 TSEALVLW-DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
           T   + +   ++ R+V  N    + +G     ++   A  +                 E 
Sbjct: 596 TPVGIAITTRRDGRIVDVNETGARMFGHVKSEVIGRTAHEVGL-----------WRRTEE 644

Query: 450 SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
            + +  E+  A S + +  +    +G T++V                S            
Sbjct: 645 REALLAEMARAGSIFGKELDLRHKNGSTVTVLYSAVANHAYGEPCILSVLV--------- 695

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
                     TE        +  KE AE+AN+ KSEFL+ MSHE+RTP+N ILG  +V+ 
Sbjct: 696 --------DITERKAMEQALRRSKEAAESANRAKSEFLSTMSHEIRTPMNTILGMVDVL- 746

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
               G   +       + I  +G  LL ++N+IL++S+IE   + I++++ D++ +  + 
Sbjct: 747 ---AGTSLTSDQTHAVKSIELAGAGLLGLLNDILDLSQIEAGGMVIEEKSCDIVELTTQL 803

Query: 630 IRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
             ++   A  K +++  +I  +L          I++IL  +L N+IKFT   G +++  +
Sbjct: 804 ADMMRPDADRKGLELRLEIRGDLPPRLFCCPDRIRQILVNLLGNAIKFTQQ-GHVVLEVA 862

Query: 688 K-----IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
                  G  + + + DTGIGIP      I   F  ++   ++  GG GLGLAI   L  
Sbjct: 863 STPSLTDGPRLRLAVRDTGIGIPADKQAVIFDRFTQINASANRQFGGVGLGLAICKKLAE 922

Query: 743 LHGGRLKIISQEGKGTIVTIC 763
           L GGR+ + S  G+G+  T+ 
Sbjct: 923 LMGGRIAVESAPGQGSTFTLS 943


>gi|167647393|ref|YP_001685056.1| PAS/PAC sensor signal transduction histidine kinase [Caulobacter
           sp. K31]
 gi|167349823|gb|ABZ72558.1| PAS/PAC sensor signal transduction histidine kinase [Caulobacter
           sp. K31]
          Length = 844

 Score =  460 bits (1184), Expect = e-127,   Method: Composition-based stats.
 Identities = 191/636 (30%), Positives = 314/636 (49%), Gaps = 21/636 (3%)

Query: 137 NELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSG 196
           N  + A+        G         LS          +   S+D +   V +  L     
Sbjct: 208 NGKILAA--AGRPIEGATTLREAFSLSIEDLGDGPAALRGQSVDGRALDVAAQPLAQGDL 265

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
                     +  + R+ +   V   + ++ + + +      Q+++ +      +++   
Sbjct: 266 LAAAAAQPRTVANVDRQIMEGAVSLLAPLA-VGIALALMLMLQSRRVEMAQREFVDSEQR 324

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
              A+   RCG+W +     +  +S     +         ++ + +   +  D++     
Sbjct: 325 FRLAVEAARCGIWEWELGADQVFMSDVTGAMF-GWGGGGVVAGQELLDRVSVDHRDKVRQ 383

Query: 317 ARSVTGKHVKQLDQIFHMRHASGAD-IWIQVRAQMM--RTISGGMNIIGIAMDLTEKYHL 373
           A +    +    D  F +    G   IWI  R Q        G   IIG+A+D+TE+   
Sbjct: 384 ALANAATYGA-FDVSFRVPSRDGGRAIWIDARGQGFGKPGEDGYSRIIGVALDVTEERLA 442

Query: 374 EKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD 433
           + R   A+ RL  AIE  SEA VLWD+  RL+MCN NY+  + L   +L PG  R+ +  
Sbjct: 443 QARAQAAENRLRDAIESVSEAFVLWDRQGRLLMCNRNYRNVFNLEPKLLKPGAPRNEVNR 502

Query: 434 AQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
                I               +E +L D RW+QI+E  T +GG +    DIT +K+ +  
Sbjct: 503 FAALAI--KHDQPAPDGAKGVREAELNDGRWIQISERRTAEGGLVMTAADITAIKNQEEA 560

Query: 494 LRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
            R ++ +L+        +   LER + +L+    KY++EK +AE ANK KSEFLA MSHE
Sbjct: 561 RRLNEEQLQH-------AVAGLERSQEQLAELARKYEMEKVKAEGANKAKSEFLANMSHE 613

Query: 554 LRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKI 613
           LRTPLNAI GFSE++  E+FG LG  +Y  Y+ DIH SGQHLL +IN+IL+MSKIE  K+
Sbjct: 614 LRTPLNAINGFSEIMMNEMFGPLGDQRYKGYSLDIHNSGQHLLALINDILDMSKIEAGKM 673

Query: 614 SIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSI 673
           ++  +   L  +  + +RL+ + A++  +K+E   P      AD R +K++L  +LSN+I
Sbjct: 674 NLKFEPLSLEDVTEDAVRLVRNRAEAAGLKLEIDFPPLPEVEADYRAVKQVLLNLLSNAI 733

Query: 674 KFTNNNGKMMIRTSKI----GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           KFT   G++++R        G+ V +++ DTGIGI    L ++ +PFE + +Q+ ++  G
Sbjct: 734 KFTPRAGRIVVRAEVRRDPLGERVRVSVTDTGIGIAAEDLARLARPFEQVESQHAKTTQG 793

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GLGLA++ +L  +H G L++ S  G+GT V+  +P
Sbjct: 794 TGLGLALTKSLVEMHDGALEMTSTPGEGTTVSFILP 829


>gi|288962975|ref|YP_003453269.1| two-component hybrid sensor and regulator [Azospirillum sp. B510]
 gi|288915241|dbj|BAI76725.1| two-component hybrid sensor and regulator [Azospirillum sp. B510]
          Length = 1310

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 160/719 (22%), Positives = 282/719 (39%), Gaps = 73/719 (10%)

Query: 82  TNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSE-------SFILLA 134
             + +  LT+   ++     ++ ++A +++AE+ L           E           + 
Sbjct: 173 DEREAETLTQLARLVVDELTLRREVALRERAEAELRDRSRLLNLAEEVGQFGHWYIDFVT 232

Query: 135 QPNELVFASSTKNSHYIGKKIGEIIPEL-------SRSRSRSKTVQMSEASLDQQPYHVL 187
                    S +    +G    +  P +                     A    + + V 
Sbjct: 233 DTR----RWSDEVYRILGLPPQQEPPTVELSRASYHPDDLPLLARMAERARRTGEGFSVE 288

Query: 188 SVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKEND 247
           +  +  + G   +                L                    +     K  +
Sbjct: 289 ARVVRRDGGMRHVFVRASVECGADGRPAGL----------------LGVVQDITDAKREE 332

Query: 248 TILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIH 307
             L      ++  +   R G+W++N +      S +  E +G   +    S    A LI 
Sbjct: 333 AELRSNRELLDLTVQATRDGIWDWNLETGGIWFSPTWKEQLGYRDDELENSLEMWAGLIF 392

Query: 308 YDNK-KICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAM 365
            +++    E  R+     +   + +   RH  G  ++I  RA  +R  +G +  ++G   
Sbjct: 393 EEDRFTALETVRAYNAGLIPNFEAVQRFRHKRGHTVYILSRAIHIRDAAGRVVRMVGAHT 452

Query: 366 DLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG 425
           D+T +   E+    A Q L  AIE   E L  +D +DRL++CN  Y++A+ L   +  PG
Sbjct: 453 DITREKLTEEELRLAKQTLDDAIEAVPEGLAYFDADDRLILCNERYREAHPLTAPLFTPG 512

Query: 426 NARSIIQDAQTR----------PIIEYRTSDPERSQD---MSKEIKLADSRWLQINEWCT 472
                I  A             P  E                 E +L D RW+ + E  T
Sbjct: 513 RPFEEILRAAVANGEFAGNPDGPSDEAWIQAELAQHRNPGAPFERELPDGRWIVVAENRT 572

Query: 473 HDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE 532
             G  +   TDIT  K  +A+L+     + A    L  +R               +    
Sbjct: 573 SSGSLVCTRTDITERKRFEAELQRQAADMCALAEGLDAAR--------------EEADAL 618

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           + RAE A + KSEFLA MSHE+RTP+N I+G +E++    F    + +  ++AQ I  S 
Sbjct: 619 RARAEAATQAKSEFLAAMSHEIRTPMNGIMGMTELL----FDTPLTEEQRQFAQAIRSSS 674

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
             LL +IN+IL++SK+E  +++I+    D   ++   + L+   A  K I+I   I   L
Sbjct: 675 NALLTIINDILDISKLEAGRVTIETLPFDPADLVEGVVELLTPRAHEKGIEIGFYIDPPL 734

Query: 653 --FFNADKRIIKKILFPILSNSIKFTNNNGK-MMIRTSKIGQC---VIITIADTGIGIPK 706
                 D   I++IL  ++ N++KFT+     + +   +       + +T+ DTGIGIP 
Sbjct: 735 RRTLLGDPTRIRQILVNLVGNAVKFTDQGSVAVELEAREATDAHLVLRMTVTDTGIGIPA 794

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            A+  +   F+ +     +  GG GLGLAI   L+ L GG + + S+ G G+   + +P
Sbjct: 795 EAMPTLFNKFQQVDGSITRKFGGTGLGLAICRQLSELMGGSIAVESRLGSGSRFLVDLP 853


>gi|332706440|ref|ZP_08426501.1| PAS domain S-box protein [Lyngbya majuscula 3L]
 gi|332354324|gb|EGJ33803.1| PAS domain S-box protein [Lyngbya majuscula 3L]
          Length = 1299

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 131/529 (24%), Positives = 243/529 (45%), Gaps = 33/529 (6%)

Query: 242  KNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRA 301
            + K+    L ++      A+     G+W+ N    + +LS     ++G   +  T +F +
Sbjct: 500  QRKQAQQELQDSKERFALAVEGVNDGIWDCNLQTGEMYLSPRWKSMLGYKDDEITNTFES 559

Query: 302  IARLIHYDNKKICEIARS-VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMN 359
              ++IH D+ +   ++ +     +  Q  + F   H  G+  W+  R   +   +G    
Sbjct: 560  WTQIIHPDDLEQTLLSFNNYLEGNFFQYQEEFRALHKDGSYRWLLTRGAALWDKTGKPYR 619

Query: 360  IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPD 419
            I G   D++E+   E+           A+E  ++ + L +        N  + + +G   
Sbjct: 620  IAGSHTDISERKKAEEALKSQL----TALEAATDGIALVNPAGEYFYLNQTHLELFGYTQ 675

Query: 420  HVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTIS 479
               + G    II   +    IE                     +W         DG T +
Sbjct: 676  PNELVGRQWHIIYPPEEIERIEKSV----------FPQLFKTGKWSGEATAVRKDGSTFA 725

Query: 480  VGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETA 539
                +TLL+           R+   I     + + +++    L++ANA+        E A
Sbjct: 726  EEFSLTLLED------GGLIRVCRDITQRKQAEEQMQQNHQRLAMANAQL-------ERA 772

Query: 540  NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
             + K EFLA MSHELRTPLNAILG SE +++E++G + + +  +    I  SGQHLL +I
Sbjct: 773  TRLKDEFLASMSHELRTPLNAILGLSEALQEEVYGSI-TDRQRKSLSTIQGSGQHLLELI 831

Query: 600  NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADK 658
            N++L+++KIE+ K+ +      L  + N  +  + + A  KNIK+  ++  +L+    D+
Sbjct: 832  NDLLDLAKIESGKMELHICAVSLQKLCNSSLMFVRNQAHHKNIKLTSQVTEKLWEIEVDE 891

Query: 659  RIIKKILFPILSNSIKFTNNNGKMMIRTSKI--GQCVIITIADTGIGIPKSALEKIGQPF 716
            R I+++L  +LSN++KFT   G ++++  +      +  ++ DTGIGI K  + K+ Q F
Sbjct: 892  RRIRQVLINLLSNAVKFTPTGGSVILKAEEDLLRNTICFSVMDTGIGIAKENMPKLFQSF 951

Query: 717  EPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              + ++  +   G GLGLA+      +HGGR+ + S+ G+G+   + +P
Sbjct: 952  VQIDSRLSRRYAGTGLGLALVQRTIEIHGGRVDVESEVGQGSCFRVTLP 1000



 Score = 97.7 bits (242), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 47/339 (13%), Positives = 101/339 (29%), Gaps = 30/339 (8%)

Query: 65  TSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR 124
             S+  +  +  +      Q   ++  AI +  Q          +K+A+  L     +  
Sbjct: 467 MGSLCVLYQQQVEPSTEDKQLLNLIASAIGVEEQ----------RKQAQQELQDSKERFA 516

Query: 125 FLSE---SFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQ 181
              E     I            S +    +G K  EI              Q+      +
Sbjct: 517 LAVEGVNDGIWDCNLQTGEMYLSPRWKSMLGYKDDEITNT------FESWTQIIHPDDLE 570

Query: 182 QPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAK 241
           Q     +  L  N          +     +R  +T     +        + +   +    
Sbjct: 571 QTLLSFNNYLEGNFFQYQEEFRALHKDGSYRWLLTRGAALWDKTGKP--YRIAGSHTDIS 628

Query: 242 KNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRA 301
           + K+ +  L        TAL     G+   N   + F+L+++  E+ G    N+ +  R 
Sbjct: 629 ERKKAEEALKSQL----TALEAATDGIALVNPAGEYFYLNQTHLELFGYTQPNELVG-RQ 683

Query: 302 IARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNII 361
              +   +  +  E +         +           G+    +    ++        +I
Sbjct: 684 WHIIYPPEEIERIEKSVFPQLFKTGKWSGEATAVRKDGSTFAEEFSLTLLEDGG----LI 739

Query: 362 GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDK 400
            +  D+T++   E++  +  QRL+ A      A  L D+
Sbjct: 740 RVCRDITQRKQAEEQMQQNHQRLAMANAQLERATRLKDE 778



 Score = 77.3 bits (189), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 43/310 (13%), Positives = 96/310 (30%), Gaps = 36/310 (11%)

Query: 102 IKFDLASQKKAESMLGQ---LLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
           I  D+  +K+ E++L +   LL   +  S   IL+   N+ +   + +          EI
Sbjct: 62  IARDITERKQGENLLKRTKFLLKAQQEASIDGILVIDENQKIIWHNRRFGQMWNIP-EEI 120

Query: 159 IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSI-LIINSRVPLLRLWREEVTL 217
           +             ++ ++ L +       ++           ++     L   R     
Sbjct: 121 LNSS------GDDQKLLKSVLSKLNKPKEFIHRLKYLCEHPSEVSRDEIYLNDGRIFDRY 174

Query: 218 EVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICV------------ETA----- 260
                S  S     I   Y+R   + K+ +  + + N  +            E A     
Sbjct: 175 SGSVVSEASDYYTRIW--YFRDITQRKQVEAQVTQLNQELSNHALELEVANTELAATKDF 232

Query: 261 ----LSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
               ++     ++  +   K    + S  E +G   E       +       +  ++   
Sbjct: 233 ITNIINAVSDPIFVKDKHYKWKFFNDSFCEFIGYSREQLLGHSDS--EFFVSEEAEVFRK 290

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
              +  K+    +   +   A+G   +I  +            I+G+  DLT +  LE R
Sbjct: 291 TDQLVMKNGVVNENEEYFTDANGILHFISTKKTRFFDSKNNPYIVGVIRDLTHRKQLEDR 350

Query: 377 YAEADQRLSK 386
            A+ ++    
Sbjct: 351 LAKLNECFLD 360



 Score = 71.2 bits (173), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 30/265 (11%), Positives = 75/265 (28%), Gaps = 33/265 (12%)

Query: 238 RQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTL 297
           R   + K+ + +L      ++        G+   + + K    +R   ++  I  E    
Sbjct: 64  RDITERKQGENLLKRTKFLLKAQQEASIDGILVIDENQKIIWHNRRFGQMWNI-PEEILN 122

Query: 298 SFRAIARLIHY------DNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM 351
           S     +L+          K+     + +     +       +    G     +    ++
Sbjct: 123 SSGDDQKLLKSVLSKLNKPKEFIHRLKYLCEHPSEVSRDE--IYLNDGRIFD-RYSGSVV 179

Query: 352 RTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK---------------------AIEC 390
              S     I    D+T++  +E +  + +Q LS                       I  
Sbjct: 180 SEASDYYTRIWYFRDITQRKQVEAQVTQLNQELSNHALELEVANTELAATKDFITNIINA 239

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTR--PIIEYRTSDPE 448
            S+ + + DK+ +    N ++ +  G     L+  +        +       +       
Sbjct: 240 VSDPIFVKDKHYKWKFFNDSFCEFIGYSREQLLGHSDSEFFVSEEAEVFRKTDQLVMKNG 299

Query: 449 RSQDMSKEIKLADSRWLQINEWCTH 473
              +  +    A+     I+   T 
Sbjct: 300 VVNENEEYFTDANGILHFISTKKTR 324



 Score = 65.8 bits (159), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 65/179 (36%), Gaps = 16/179 (8%)

Query: 363 IAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVL 422
           IA D+TE+   E         L    E + + +++ D+N +++  N  + + + +P+ +L
Sbjct: 62  IARDITERKQGENLLKRTKFLLKAQQEASIDGILVIDENQKIIWHNRRFGQMWNIPEEIL 121

Query: 423 -----VPGNARSIIQDAQTRPIIEYRTSD--PERSQDMSKEIKLADSRWLQINEWCTHDG 475
                     +S++          +R        S+    EI L D R         + G
Sbjct: 122 NSSGDDQKLLKSVLSKLNKPKEFIHRLKYLCEHPSEVSRDEIYLNDGRIFD-----RYSG 176

Query: 476 GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
             +S  +D     + +        + K     ++   Q L     EL +AN +    K+
Sbjct: 177 SVVSEASD----YYTRIWYFRDITQRKQVEAQVTQLNQELSNHALELEVANTELAATKD 231


>gi|302037237|ref|YP_003797559.1| putative sensor histidine kinase [Candidatus Nitrospira defluvii]
 gi|300605301|emb|CBK41634.1| putative Sensor histidine kinase [Candidatus Nitrospira defluvii]
          Length = 1013

 Score =  454 bits (1167), Expect = e-125,   Method: Composition-based stats.
 Identities = 124/687 (18%), Positives = 259/687 (37%), Gaps = 57/687 (8%)

Query: 90  TEAIEIIFQNNNIKF--DLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVFASS 144
             A+E    +       DLA++ +AE  L +   + R     S +   +          +
Sbjct: 65  MRALEQTLADTRRDRALDLAARTQAEESLRESEERFRSFMDHSPAIAWMKDDQGRHVYVN 124

Query: 145 TKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSR 204
               H      G+ +   +      +  +  +            +         + +   
Sbjct: 125 RVFEHRFQMVSGQWLGRTNFELFPEEVARRFQTHDQ-------MILADGLPKEFVEVAPD 177

Query: 205 VPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRG 264
               +             +    +    +          K  +  LL +   +  AL   
Sbjct: 178 PDGTQRDWWTFKFPFRGPAGRRYVGGVAI-----DITDRKRMEAALLVSEERLRLALGAA 232

Query: 265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKH 324
           + G+W+++        S ++  I G+  E    ++ A   L+   +      A   + + 
Sbjct: 233 QAGIWDWDIRTNAVQWSDNVSTIFGLSRETFVGTYEAYLALVDPQDLDRLLQAIRQSIQA 292

Query: 325 VKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQR 383
             +      +    G   W+  R  ++R   G  + ++G  +D+T +  ++ + A ++ +
Sbjct: 293 NVEYQIEHRILWPDGTVHWLACRGDVLRDADGTPVRMVGTVLDVTARKEMDLKLANSEAQ 352

Query: 384 LSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYR 443
           L   ++ +   + L D+  R +  N  +++A+ L    ++      +    Q        
Sbjct: 353 LRAILDHSPALIFLKDREGRYLDVNRQFERAFNLSREAILGKTDTELFSPKQAAVFQTND 412

Query: 444 TSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKA 503
               E  + +  E                            T   H+  +     +    
Sbjct: 413 RLVLEAKRPLRFEE---------------------------TADYHDGPRTSIVFKFPLL 445

Query: 504 TINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILG 563
             + +  +   +    T+   A     + +++A  A + KSEFLA MSHE+RTP+N ++G
Sbjct: 446 DRDRMLYAVGGVATDITDRKRAEEALALARDQAMEAARLKSEFLATMSHEIRTPMNGVIG 505

Query: 564 FSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLI 623
            + ++ +         +  E A+ +  SG HLL +IN+IL+ SKIE  +++++  + D  
Sbjct: 506 MTNLLLESALTP----EQRECAEVVRNSGDHLLMIINDILDFSKIEAGRLTLETIDFDFR 561

Query: 624 PIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGK 681
            +I++ + LI   A+ K + +   I + +      D   ++++L  +L N+IKFT + G+
Sbjct: 562 GMIDDTLDLIAEQARQKGLDLVGLIDASVPSAVRGDPGRLRQVLINLLGNAIKFT-DRGE 620

Query: 682 MMIRTSKIGQ---CVIIT--IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAI 736
           +++R +        V++   + DTGIGI      K+ Q F  +     +  GG GLGLAI
Sbjct: 621 VVLRMTVAQDAQSHVVLRGDVTDTGIGISPEGRNKLFQTFSQVDASTTRRYGGTGLGLAI 680

Query: 737 SDALTNLHGGRLKIISQEGKGTIVTIC 763
              LT L  G + + S  GKG+     
Sbjct: 681 CKRLTELMQGEIGMESAPGKGSRFWFT 707


>gi|241763479|ref|ZP_04761532.1| multi-sensor hybrid histidine kinase [Acidovorax delafieldii 2AN]
 gi|241367320|gb|EER61651.1| multi-sensor hybrid histidine kinase [Acidovorax delafieldii 2AN]
          Length = 1618

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 130/683 (19%), Positives = 250/683 (36%), Gaps = 61/683 (8%)

Query: 102  IKFDLASQKKAESMLGQLLAKTRFLSESFILLAQ--------PNELVFASSTKNSHYIGK 153
            +  D+  + +A+  L +       L E    +           +  +   +      +  
Sbjct: 457  LHEDVTERMRAQKELQRRERLLNELLEQQTAIFDNAPPILLVCDGRIRQFNPAFVELMRG 516

Query: 154  KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
               E++           +                +  +         +     L RL   
Sbjct: 517  TATELLGRDIAVLFNGASSSER-----------FTARVAPRLAQGQALREEATLCRLDGS 565

Query: 214  EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF 273
                 +    +     L           + ++ +  + EA   +E A   G+ G+++ N 
Sbjct: 566  SYAARLAGRGLKMEGCLTASIWVIEDITEARQAEVAMREAAERLEIAQEAGKVGVFDVNL 625

Query: 274  DNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIAR-SVTGKHVKQLDQIF 332
            ++ +   S  +  +MG+P  ++     A    +H D++                     +
Sbjct: 626  ESGRVLWSDKLVAMMGLPPGDQPRGKDAWLACLHPDDRDRARTHFDECLAGTATTARASW 685

Query: 333  HMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
             +    G   W    A++ R   G  + ++G+ +D+ ++  LE + AE        I+  
Sbjct: 686  RIVRPGGEVRWFLEAARIFRNADGKAVRVVGVYVDIHDQKQLEAQVAEQLDFQQALIDAI 745

Query: 392  SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS--IIQDAQTRPIIEYRTSDPER 449
               L   D   R +  NA Y++A+G+    L+         +  A+         +    
Sbjct: 746  PVPLFYKDAQGRYIGFNAAYEQAFGVRREDLIGKTVLDLQFLAQAERERFDSDTGAAVAG 805

Query: 450  SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
             Q + +E+ L              DG                           +  +   
Sbjct: 806  EQAVHREVDL-----------PYADGA---------------MHHTLFWLHGFSRADGSP 839

Query: 510  TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
                      T+   A    ++ KE AE     KS FLA MSHE+RTP+NAI+G S +  
Sbjct: 840  GGAIGTFVDITDRQKAEQDLRLAKELAEETTALKSNFLANMSHEIRTPMNAIIGMSHLAL 899

Query: 570  KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
            K         + ++Y   I  +GQHLL +IN+IL+ SKIE  K++++K    L  ++   
Sbjct: 900  KSGLNP----RQHDYVSKIQQAGQHLLGVINDILDFSKIEAGKLTVEKHPFVLDRMLEGV 955

Query: 630  IRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
              ++G  A +K +++   + +++      D   + +IL    +N+IKFT   G++ I   
Sbjct: 956  ADVVGYKAGAKGLELVCDVAADVPPNLVGDSLRLGQILINFSNNAIKFT-ERGEISIAVR 1014

Query: 688  KIGQ-----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
               Q      +   + DTGIG+    + ++ + F+       +  GG GLGLAI  +L  
Sbjct: 1015 VQEQDAQRVRLRFEVRDTGIGLTPEQMGRLFESFQQADASTTRRYGGTGLGLAICKSLAE 1074

Query: 743  LHGGRLKIISQEGKGTIVTICMP 765
            L GG + + S+ GKG+   + +P
Sbjct: 1075 LMGGEVGVDSEYGKGSTFWVSLP 1097



 Score = 97.0 bits (240), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/389 (12%), Positives = 104/389 (26%), Gaps = 33/389 (8%)

Query: 120 LAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASL 179
           L      S   +++   + L+   + +     G  + E+  +     S  +       + 
Sbjct: 352 LGAALESSPVAVVITDADGLIDWVNPQYERNTGYPLKEVRGKKPSLVSSGQ-------TP 404

Query: 180 DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQ 239
            +    + S  L   S     +N R      + E     V   +         +   +  
Sbjct: 405 QRTYQQMWSTLLSGQSWQGQFVNQRRDGSIYYDEATLSPVFDKAGKR----IGMVGLHED 460

Query: 240 AKKNKENDTILLEANICVETALSRGRCGLWNFNFD------NKKFHLSRSMYEIM-GIPY 292
             +       L      +   L + +  +++           +    + +  E+M G   
Sbjct: 461 VTERMRAQKELQRRERLLNELLEQ-QTAIFDNAPPILLVCDGRIRQFNPAFVELMRGTAT 519

Query: 293 ENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR 352
           E        +        +    +A  +      + +    +    G+    ++  + ++
Sbjct: 520 ELLGRDIAVLFNGASSSERFTARVAPRLAQGQALREEAT--LCRLDGSSYAARLAGRGLK 577

Query: 353 TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQ 412
                   I +  D+TE    E    EA +RL  A E     +   +     V+ +    
Sbjct: 578 MEGCLTASIWVIEDITEARQAEVAMREAAERLEIAQEAGKVGVFDVNLESGRVLWSDKLV 637

Query: 413 KAYGLPDHVLVPGN--ARSIIQDAQT---RPIIEYRTSDPERSQDMSKEIKLADS--RWL 465
              GLP      G     + +        R   +   +    +   S  I       RW 
Sbjct: 638 AMMGLPPGDQPRGKDAWLACLHPDDRDRARTHFDECLAGTATTARASWRIVRPGGEVRWF 697

Query: 466 QINEW--CTHDG---GTISVGTDITLLKH 489
                     DG     + V  DI   K 
Sbjct: 698 LEAARIFRNADGKAVRVVGVYVDIHDQKQ 726



 Score = 50.8 bits (120), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 51/147 (34%), Gaps = 12/147 (8%)

Query: 382 QRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIE 441
             L  A+E +  A+V+ D +  +   N  Y++  G P   +              +P + 
Sbjct: 350 HVLGAALESSPVAVVITDADGLIDWVNPQYERNTGYPLKEVRGK-----------KPSLV 398

Query: 442 YRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRL 501
                P+R+        L+   W         DG        ++ +   +A  R     L
Sbjct: 399 SSGQTPQRTYQQMWSTLLSGQSWQGQFVNQRRDGSIYYDEATLSPVFD-KAGKRIGMVGL 457

Query: 502 KATINDLSTSRQILERQKTELSIANAK 528
              + +   +++ L+R++  L+    +
Sbjct: 458 HEDVTERMRAQKELQRRERLLNELLEQ 484


>gi|197106142|ref|YP_002131519.1| sensor histidine kinase (non-motile and phage-resistance protein )
           [Phenylobacterium zucineum HLK1]
 gi|196479562|gb|ACG79090.1| sensor histidine kinase (non-motile and phage-resistance protein )
           [Phenylobacterium zucineum HLK1]
          Length = 621

 Score =  450 bits (1158), Expect = e-124,   Method: Composition-based stats.
 Identities = 182/560 (32%), Positives = 292/560 (52%), Gaps = 19/560 (3%)

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
           +    ++ + +    + + +      ++ + +       ++      A+   RCG+W ++
Sbjct: 55  QSAAEQLAWIAAPLLVAIGLGVLLLVESLRVERAHAAFSDSEQRFRMAVEAARCGIWEWD 114

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               K  +S     + G       +  + +   +   ++     A +    +    D  F
Sbjct: 115 LAADKIFMSEVTAALFGW--RGGVVDGQQVLDRVSPGHRDGLREALANAAIYGD-FDVSF 171

Query: 333 HMRH-ASGADIWIQVRAQMMRT--ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
            +   A G  IWI  R +        G   IIG+A+D+TE+   + R  +A+ RL  AIE
Sbjct: 172 RVPSLAGGRPIWIDARGRGFGEAPEGGYARIIGVALDVTEERLAQARAQQAESRLRDAIE 231

Query: 390 CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
             SEA VLWD++ RL+MCN NY+  + L   +L+ G  R  ++ A    + +   +  +R
Sbjct: 232 SVSEAFVLWDRHGRLLMCNRNYRDYFKLESGLLLAGVGREQVERAARMAVRQEYPAPGDR 291

Query: 450 SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
                +E +LAD RW+QI+E  T +GG +    DIT+LK  +   R           +L 
Sbjct: 292 RG--VREAELADGRWVQISERPTAEGGLVVTAADITVLKAQEEARRL-------KEEELR 342

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
            +   LER + +LS    KY+ EK RAE A++ KSEFLA MSHELRTPLNAI GFSE++ 
Sbjct: 343 RAVFNLERSQEQLSELARKYEAEKIRAEGASQAKSEFLANMSHELRTPLNAINGFSEIMV 402

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
            E++G LG  +Y +YA+DI  SGQHLL +IN+IL+MSKIE  K+S+      L  I  + 
Sbjct: 403 AEMYGPLGDARYRDYARDILNSGQHLLALINDILDMSKIEAGKMSLRFDPCSLEEIAEDA 462

Query: 630 IRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
           +RL+ + A+S  + +           AD R +K++L  +LSN+IKFT   G++ +R  + 
Sbjct: 463 LRLVRNRAESAGLTLVLDFVELPEVEADYRAVKQVLLNLLSNAIKFTPRGGRITLRAERR 522

Query: 690 GQ----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
                  V +++ DTGIGI    LE++ +PFE + +Q+ ++  G GLGLA++ A   LHG
Sbjct: 523 DDPLGQRVRVSVQDTGIGIAPEDLERLARPFEQVESQHAKTQQGTGLGLALTKAFVELHG 582

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G L + S  G+GT  +  +P
Sbjct: 583 GLLDLKSAPGQGTTASFSLP 602


>gi|288941100|ref|YP_003443340.1| signal transduction histidine kinase with CheB and CheR activity
            [Allochromatium vinosum DSM 180]
 gi|288896472|gb|ADC62308.1| signal transduction histidine kinase with CheB and CheR activity
            [Allochromatium vinosum DSM 180]
          Length = 1994

 Score =  450 bits (1157), Expect = e-124,   Method: Composition-based stats.
 Identities = 132/680 (19%), Positives = 259/680 (38%), Gaps = 58/680 (8%)

Query: 104  FDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
             D++   +AES       + R     +   +LL   +  +   +       G   GE++ 
Sbjct: 823  SDISELHRAESAHAGSEQRFRQVWESANEGMLLTDESGCMVLVNPALERMFGYGPGELVG 882

Query: 161  ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
            +        ++ ++                      ++             R +      
Sbjct: 883  Q-PVEILVPESRRIRHRIDR-----AAFAAGSERGRAMDHARDLQG-----RCKEGTLFD 931

Query: 221  FFSIISALLLFIL---FSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKK 277
                +S + +       +      + K  +  L E+   +  AL   + G W +N D+ +
Sbjct: 932  VAIGLSNIAMDGGRFTLASVEDITERKRAERALRESEQRLRLALDAAQAGTWEWNLDSDR 991

Query: 278  FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
             + S   +E+ G+  +    S++A    +H ++ +  E       +     +  + ++  
Sbjct: 992  NYWSGRNWELYGLKQDECEPSYQAWRGSVHPEDLERVERIIREAVEQETGFEVEWRVKRP 1051

Query: 338  SGA-DIWIQVRAQMM-RTISGGMNIIGIAMDLTEKYHLEKRYAEADQ--RLSKAIECTSE 393
             G    W+  RAQ +          IG  +D+T++    +R A A +   L   ++ +  
Sbjct: 1052 PGEPTRWLLSRAQPIASDSDQPRRYIGAVIDITDQKEAVQRAALAGELKILQTLLDTSFA 1111

Query: 394  ALVLWDKNDRLVMCNANYQKAYGLPDHVLV--PGNARSIIQDAQTRPIIEYRTSDPERSQ 451
                W+  +     +  +++ +G  D  L   P + + +I       + E          
Sbjct: 1112 GYFDWNIAEGTEYLSPTFKRMFGYADDELPNTPESWQRLIFPEDLPGVFEVYERHVRSHG 1171

Query: 452  DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             +    ++          +   DG TI V                +   +  T +     
Sbjct: 1172 SVPYHNEVR---------YRHKDGRTIWVIC--------------AGLVVDWTPDGEPRR 1208

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
                    T L          +++A  +N  KS FLA MSHE+RTP+NA+LGF  ++++ 
Sbjct: 1209 LIGYHIDITALKQVEQALSEARDQANASNLAKSAFLANMSHEIRTPMNAVLGFCYLLEQR 1268

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
                  +       + IH +GQ LL +IN+IL+ SKIE   + I+     L  +++    
Sbjct: 1269 ALDPTSAD----LVRKIHGAGQALLGLINDILDFSKIEAGHLEIESTPFQLSELLDTLAG 1324

Query: 632  LIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++ ++A  K +++    P E       D   ++++L  +L N+IKFT   G++ +R  ++
Sbjct: 1325 IMTAAAGDKPLELVLTPPGEGIEGLIGDAGRLQQVLINLLGNAIKFT-ARGEVELRVEQV 1383

Query: 690  GQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
             +      +  T+ DTGIGI       I   F    N   +  GG GLGLAIS  L ++ 
Sbjct: 1384 AEHGDRLDLRFTVRDTGIGIAPEHQTNIFNAFSQADNSIGRRFGGTGLGLAISQRLVHMM 1443

Query: 745  GGRLKIISQEGKGTIVTICM 764
            GGRL++ S  G+G+     +
Sbjct: 1444 GGRLELESTLGQGSAFYFTL 1463



 Score =  113 bits (283), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/411 (11%), Positives = 104/411 (25%), Gaps = 41/411 (9%)

Query: 94   EIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGK 153
            E+   N+ ++       +  + L  +    R      +++      +   +       G 
Sbjct: 700  ELTTLNDELRLKTNESTELSTTLANIQNSIRT----ALIVVDREGRITRFNALAVRIFG- 754

Query: 154  KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
             + + I           T+      L++      SV    + G    +    P    +R+
Sbjct: 755  IVDDDIGNHLVGIPCHLTLPYLPDCLERVVSQGESVIERVHQGDFHYLMQIDP----YRD 810

Query: 214  EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF 273
            E               +      +    +    ++    +             G+   + 
Sbjct: 811  EFGQ------------VVGAVLNFSDISELHRAESAHAGSEQRFRQVWESANEGMLLTDE 858

Query: 274  DNKKFHLSRSMYEIMGIPYENKTLSFRAI-----ARLIHYDNKKICEIARSVTGKHVKQL 328
                  ++ ++  + G            I      R+ H  ++                 
Sbjct: 859  SGCMVLVNPALERMFGYGPGELVGQPVEILVPESRRIRHRIDRAAFAAGSERGRAMDHAR 918

Query: 329  DQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
            D         G    + +    +    G   +     D+TE+   E+   E++QRL  A+
Sbjct: 919  DLQGR--CKEGTLFDVAIGLSNIAMDGGRFTL-ASVEDITERKRAERALRESEQRLRLAL 975

Query: 389  ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGN--ARSIIQDAQTRPIIE--YRT 444
            +        W+ +      +    + YGL      P     R  +       +       
Sbjct: 976  DAAQAGTWEWNLDSDRNYWSGRNWELYGLKQDECEPSYQAWRGSVHPEDLERVERIIREA 1035

Query: 445  SDPERSQDMSKEIKLADS---RWLQINEWCTHDGG-----TISVGTDITLL 487
             + E   ++   +K       RWL                 I    DIT  
Sbjct: 1036 VEQETGFEVEWRVKRPPGEPTRWLLSRAQPIASDSDQPRRYIGAVIDITDQ 1086


>gi|295688681|ref|YP_003592374.1| PAS/PAC sensor signal transduction histidine kinase [Caulobacter
           segnis ATCC 21756]
 gi|295430584|gb|ADG09756.1| PAS/PAC sensor signal transduction histidine kinase [Caulobacter
           segnis ATCC 21756]
          Length = 843

 Score =  449 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 192/633 (30%), Positives = 310/633 (48%), Gaps = 24/633 (3%)

Query: 141 FASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILI 200
              +          + +          R        AS  +     +         ++  
Sbjct: 212 LIVAQGGRAQGATAVRQAFALKPADLRRPADDLRGRASDGKPLDVAVKPVGEGALTAVFA 271

Query: 201 INSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETA 260
             S           ++L +   + I   LL ++     Q++K++      +++      A
Sbjct: 272 APSSGDGGVPTSSALSLLIPLAAGIGLALLLVV-----QSRKSEAAQREFIDSEQRFRLA 326

Query: 261 LSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSV 320
           +   RCG+W ++ +  +  LS     +         +S + +   I  D+++    A + 
Sbjct: 327 VEAARCGIWEWDLNADEVFLSDVTGAMF-GWGGGGVVSGQDLLDRIAPDHRERLRKALAN 385

Query: 321 TGKHVKQLDQIFHM--RHASGADIWIQVRAQMMR--TISGGMNIIGIAMDLTEKYHLEKR 376
              +    D  F +         +WI  R Q        G   IIG+A+D+TE+   + R
Sbjct: 386 AALYGA-FDVSFRVPAVGQGQRSLWIDARGQGFGRADADGYSRIIGVALDVTEERVAQAR 444

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
              A+ RL  AIE  SEA VLWD++ RL+MCN NY+  + L   +L PG AR+ I     
Sbjct: 445 AQAAENRLRDAIESVSEAFVLWDRHGRLLMCNRNYRNVFSLDPKLLKPGAARAEINRRAA 504

Query: 437 RPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRE 496
             I +  ++         +E +L D RW+QI+E  T +GG +    DIT +K+     R 
Sbjct: 505 LAIKQDHSAPDAAKG--VREAELMDGRWIQISERRTAEGGLVMTAADITAIKNQDEARRL 562

Query: 497 SKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
           ++         L  +   LER + +L+    KY+ EK RAE AN+ KSEFLA MSHELRT
Sbjct: 563 NQ-------EQLQNAVAGLERSQEQLAELARKYETEKVRAEGANRAKSEFLANMSHELRT 615

Query: 557 PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
           PLNAI GFSE++  E+FG LG  +Y  Y+QDIH SGQHLL +IN+IL+MSKIE  K+++ 
Sbjct: 616 PLNAINGFSEIMMNEMFGPLGDERYKGYSQDIHSSGQHLLALINDILDMSKIEAGKMNLK 675

Query: 617 KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFT 676
            +   +  +  + +RL+ + A++  + +    P      AD R IK++L  +LSN+IKFT
Sbjct: 676 FEPMHVEDVAEDAVRLVRNRAEAAGLNLRIDFPPLPEIEADYRAIKQVLLNLLSNAIKFT 735

Query: 677 NNNGKMMIRTSKI----GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGL 732
              G + +         G  V +++ADTGIGI K  L ++ +PFE + +Q+ ++  G GL
Sbjct: 736 PRAGSVTLTAEVRRDAFGDMVRVSVADTGIGIAKEDLARLARPFEQVESQFSKTTQGTGL 795

Query: 733 GLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GLA++ +L ++H G L++ S  G+GT V+  +P
Sbjct: 796 GLALTKSLISMHDGALEMTSTPGEGTTVSFALP 828


>gi|302382006|ref|YP_003817829.1| PAS/PAC sensor signal transduction histidine kinase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192634|gb|ADL00206.1| PAS/PAC sensor signal transduction histidine kinase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 792

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 186/649 (28%), Positives = 312/649 (48%), Gaps = 28/649 (4%)

Query: 120 LAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASL 179
           +A+T   +   +L+  P+  V   +T     +G +   ++   +               +
Sbjct: 154 IARTALPASDNVLVVGPDGRVLGMTTTLKARLGVEPRALVGTETPLA----------GRI 203

Query: 180 DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQ 239
             +        +       +    +         ++ L +    +   +L   L   +RQ
Sbjct: 204 ADKRVTAAGAAVGETGLVAVAWRPQSTGAAALISDLWLIMAPIGLGVLVLGLALMQGWRQ 263

Query: 240 AKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSF 299
           +        +  E+      A+   RCG+W ++ D +   +S  M  ++G+P     ++ 
Sbjct: 264 S----RASRVWAESEHRFRVAVEAARCGVWEWDLDRETVDVSDYMAALLGLPTGGS-VTS 318

Query: 300 RAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM--RTISGG 357
            A+   IH   + + E A           +  F +    G   WI  R Q    R   G 
Sbjct: 319 AAVIERIHPRYRDLVEHALRQAATFGA-FEVTFAVPLEGGGARWIDARGQARGRRGDDGY 377

Query: 358 MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL 417
             I+G+AMD+TE      +   A+ RL   IE  S+A VL+DK+ RL++ N  ++ A+G 
Sbjct: 378 GMILGVAMDITEARRARAQLQAAEGRLRDGIESVSDAFVLFDKHGRLILWNQAFKDAFGF 437

Query: 418 PDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGT 477
            D  +  G  +  +       I   R S   R+     E++L D R LQ+ E  T DGGT
Sbjct: 438 ADEAVRKGAQKDELNRIAALAIKADRPSPEGRAGAR--EVELYDGRVLQLAERFTGDGGT 495

Query: 478 ISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAE 537
           +    D+T +       R  +   + + + L  +   LE  + +LS+   KY++   RAE
Sbjct: 496 VITAADVTAI-------RRQEVERQRSADSLRKTVDELEASQEKLSLLARKYEIAMTRAE 548

Query: 538 TANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLN 597
            AN+ KSEFLA MSHELRTPLNAI GFSE++  E+FG LG  KY  YA DI  SGQHLL+
Sbjct: 549 AANQAKSEFLANMSHELRTPLNAINGFSEIMAGEMFGPLGHEKYKGYAHDILKSGQHLLS 608

Query: 598 MINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNAD 657
           +IN+IL+M+KIE  K+++  +   L  +  + IRL+   AQ   + +  +        AD
Sbjct: 609 LINDILDMAKIEAGKMTLHYEAVSLTELCEDAIRLMRGKAQDCGLTLSLEAGDVPEIEAD 668

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ-CVIITIADTGIGIPKSALEKIGQPF 716
            R +K+++  ++SN++KFT   G++ +  ++     + I + DTGIGI  + L ++ QPF
Sbjct: 669 YRGLKQVMLNLISNAVKFTPEGGEITVSVTRQNAVTMRIAVTDTGIGIAAADLARLAQPF 728

Query: 717 EPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           E +  Q+ ++  G GLGLA++ +L  LHGG + ++S+ G+GT V+  +P
Sbjct: 729 EQVEGQHSKTTQGTGLGLALTKSLIELHGGEMTMVSEPGEGTTVSFDIP 777


>gi|144273|gb|AAA23052.1| non-motile and phage-resistance protein [Caulobacter crescentus
           CB15]
          Length = 842

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 191/638 (29%), Positives = 315/638 (49%), Gaps = 22/638 (3%)

Query: 136 PNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNS 195
           P+  + A+  +     G         LS          +   + D     V    +   +
Sbjct: 204 PDGKLIAARGRGVQGAGALREAF--ALSIEDLGDGPAAVRGQAADGALLDVAVRPVAQGA 261

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI 255
              +       +  L R+ +         +  + + +      Q++K +      +++  
Sbjct: 262 LLAVAAAPTRSVANLDRQVMEGAFSLLVPLG-VGIALALLLMIQSRKAEVAHREFIDSER 320

Query: 256 CVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE 315
               A+   RCG+W ++ +  + +LS     +         +S + +   I  D+++   
Sbjct: 321 RFRLAVEAARCGIWEWDLNGDQVYLSDVTGAMF-GWGGGGVVSGQDLLERISIDHRERVR 379

Query: 316 IARSVTGKHVKQLDQIFHMRHASGADI--WIQVRAQMMRTIS--GGMNIIGIAMDLTEKY 371
            A +    +    D  F +  +       WI  R Q        G   IIG+A+D+TE+ 
Sbjct: 380 QALANAAMYGA-FDVSFRVPASEQGARSLWIDARGQGFGKPGSEGHARIIGVALDVTEER 438

Query: 372 HLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSII 431
             + R   A+ RL  AIE  SEA VLWD+  RL+MCN NY+  + L   +L PG AR+ +
Sbjct: 439 IAQARAQAAENRLRDAIESVSEAFVLWDRQGRLLMCNRNYRSVFSLEPKILKPGAARAEV 498

Query: 432 QDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQ 491
                  I +   +         +E ++ D RW+QI+E  T +GG +    DIT +K  +
Sbjct: 499 NRFAALAIKQDHPAPDGAKG--VREAEMMDGRWIQISERRTAEGGLVMTAADITAIKTQE 556

Query: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMS 551
              R ++         L  +   LER + +L+    KY+ EK +AE+ANK KSEFLA MS
Sbjct: 557 EARRRNE-------EQLQNAVAGLERSQEQLAELARKYETEKVKAESANKAKSEFLANMS 609

Query: 552 HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETE 611
           HELRTPLNAI GFSE++  E+FG LG  +Y  Y+QDIH SGQHLL +IN+IL+MSKIE  
Sbjct: 610 HELRTPLNAINGFSEIMMNEMFGPLGDQRYKGYSQDIHSSGQHLLALINDILDMSKIEAG 669

Query: 612 KISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSN 671
           K+++  ++  L  +  + +RL+ + A++  +K++   P      AD R +K++L  +LSN
Sbjct: 670 KMNLKFESMHLEDVAEDAVRLVRNRAEAAGLKLDIDFPQLPEIEADYRAVKQVLLNLLSN 729

Query: 672 SIKFTNNNGKMMIRTSKI----GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSI 727
           +IKFT   G + +R        G  + +++ DTGIGI K  L ++ +PFE + +Q+ ++ 
Sbjct: 730 AIKFTPRAGSVTVRVEVRRDPFGDLIKVSVTDTGIGIAKEDLARLAKPFEQVESQFSKTT 789

Query: 728 GGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            G GLGLA++ +L  +H G L++ S  G+GT V+  +P
Sbjct: 790 QGTGLGLALTKSLITMHDGVLEMHSTPGEGTTVSFTLP 827


>gi|153870360|ref|ZP_01999777.1| sensory box histidine kinase/response regulator [Beggiatoa sp. PS]
 gi|152073175|gb|EDN70224.1| sensory box histidine kinase/response regulator [Beggiatoa sp. PS]
          Length = 1105

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 136/684 (19%), Positives = 270/684 (39%), Gaps = 71/684 (10%)

Query: 98  QNNNIKFDLASQKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKK 154
               I  D+  +K+AE+ L +   + R L   +   I +          +      +G  
Sbjct: 216 HLLAIIRDVTERKRAENALKESEERFRSLVEQAADAIFVHDLEGRFVDVNQSACKSVGYS 275

Query: 155 IGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREE 214
             E++              +S  +L++         +       + +   V L    R +
Sbjct: 276 RSELL-------------NLSVTNLEKGVSLEQLKTV----WQHIKVGESVTLEGTHRHK 318

Query: 215 VTLEVVFFSIISALL---LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF 271
              ++     +  +       + +  R   + K  + IL +  I  + A      G +  
Sbjct: 319 TGKKIPVEVRLGLIKWDGTQYILAAARDITERKRVEEILKKRAIEFKMAQEIANLGSYTI 378

Query: 272 NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
           N    +   S  ++ I+GI  +  + S     + +  ++K++ E          K LD  
Sbjct: 379 NLLTSEQEWSDQIFHILGIDRKEVSPSHENFMQFVPPEDKELLERESQAAFTGQKTLDAY 438

Query: 332 FHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           + +    G   ++     +        + + G   D+TE+   E++        +K +E 
Sbjct: 439 YRIIRKDGEVRFLHTGGIVEYNDKKIPVRMYGFTQDITERKRAEEKLL----IQAKILEN 494

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG--NARSIIQDAQTRPIIEYRTSDPE 448
            +E + L  ++  +++ N    + +G  ++ L+    +  + +   +    + +  +D +
Sbjct: 495 MAEGVNLTTESGLMLLTNRLLTRMFGYDENELIGQHVSILNSLSPEENMVFVNHVIADLQ 554

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
             +    E                 DG        I+ L  +                  
Sbjct: 555 TKEIWEGEF-----------NNQKKDGTHFISYAYISALDISGQHYF------------- 590

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
                 ++   TE   A    Q  KE+AE+AN+ KSEFLA MSHE+RTP+NA+LGFSE++
Sbjct: 591 ----VTVQEDITERKQAEIALQQAKEQAESANRAKSEFLATMSHEIRTPMNAVLGFSELL 646

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
            + +     + +   Y   I  +G+ LL +I++IL+++KIE  ++ I  +  +   I  E
Sbjct: 647 SELV----TNKQQKSYLDSIKMAGKTLLTLIDDILDLAKIEAGRLDIQYEAVNPYNIFEE 702

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFF--NADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
             ++       K +     I   L      D+  ++++L  ++ N++KFT   G + +  
Sbjct: 703 LKQIFVLKIVDKQLDFIVDIDENLPLALILDETRLRQVLLNLIGNAVKFT-EKGYIKLGA 761

Query: 687 SKIGQC------VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDAL 740
            KI +       ++I++ DTGIGIP +  E I + F     Q ++  GG GLGLAI+  L
Sbjct: 762 QKIDKMDKSKIDLLISVEDTGIGIPLAQQEMIFEAFRQQDGQSNRKYGGTGLGLAITRRL 821

Query: 741 TNLHGGRLKIISQEGKGTIVTICM 764
             +  G + +    GKG+I  I +
Sbjct: 822 VEMMNGDISVTGTVGKGSIFNISL 845



 Score =  124 bits (312), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 50/438 (11%), Positives = 122/438 (27%), Gaps = 35/438 (7%)

Query: 102 IKFDLASQKKAESMLGQLLA---KTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
           +  D+   K+AE  L +           +    ++A     +   +       G    E 
Sbjct: 97  VMLDITQWKQAEQTLKENEQNLQAIFNSTTDAFIIADLEGKIVDINQSAIQMYGYSKAEF 156

Query: 159 IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
           +   +      +     +  +               SG I    S             + 
Sbjct: 157 VTLHANQVICPEYQSRLKEFIQ-----------TAQSGKIASAQSVDLRKDGTFFYTEIN 205

Query: 219 VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
                         L +  R   + K  +  L E+     + + +    ++  + + +  
Sbjct: 206 GTTLEYNGQK---HLLAIIRDVTERKRAENALKESEERFRSLVEQAADAIFVHDLEGRFV 262

Query: 279 HLSRSMYEIMGIPYENKT-LSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
            +++S  + +G        LS   + + +  +  K       V       L+      H 
Sbjct: 263 DVNQSACKSVGYSRSELLNLSVTNLEKGVSLEQLKTVWQHIKV--GESVTLEGTHR--HK 318

Query: 338 SGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL 397
           +G  I ++VR  +++   G   I+  A D+TE+  +E+   +       A E  +     
Sbjct: 319 TGKKIPVEVRLGLIK-WDGTQYILAAARDITERKRVEEILKKRAIEFKMAQEIANLGSYT 377

Query: 398 WDKNDRLVMCNANYQKAYGLPDHVLVPGN-ARSIIQDAQTRPIIEYRTSDPERSQDMSKE 456
            +        +       G+    + P +         + + ++E  +      Q     
Sbjct: 378 INLLTSEQEWSDQIFHILGIDRKEVSPSHENFMQFVPPEDKELLERESQAAFTGQ----- 432

Query: 457 IKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
                 + L          G +       ++++N  ++          I +   + + L 
Sbjct: 433 ------KTLDAYYRIIRKDGEVRFLHTGGIVEYNDKKIPVRMYGFTQDITERKRAEEKLL 486

Query: 517 RQKTELSIANAKYQVEKE 534
            Q   L        +  E
Sbjct: 487 IQAKILENMAEGVNLTTE 504



 Score =  121 bits (303), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 48/399 (12%), Positives = 120/399 (30%), Gaps = 41/399 (10%)

Query: 140 VFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSIL 199
               S +   ++G    +    L  +                           H     +
Sbjct: 12  FTFVSQQAEPFLGYPCED---WLEPTFWVEHLHPEDRTWAPGFCMEATFKKQDHEFEYRM 68

Query: 200 IINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVET 259
           I      +       +   V         +            + K+ +  L E    ++ 
Sbjct: 69  ITADNRIIW------LRDLVSVIIENDQPVKICGVML--DITQWKQAEQTLKENEQNLQA 120

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
             +         + + K   +++S  ++ G              ++I  + +   +    
Sbjct: 121 IFNSTTDAFIIADLEGKIVDINQSAIQMYGYSKAEFVTLHA--NQVICPEYQSRLKEFIQ 178

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAE 379
                     Q   +R   G   + ++    +   +G  +++ I  D+TE+   E    E
Sbjct: 179 TAQSGKIASAQSVDLR-KDGTFFYTEINGTTL-EYNGQKHLLAIIRDVTERKRAENALKE 236

Query: 380 ADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPI 439
           +++R    +E  ++A+ + D   R V  N +  K+ G     L+   + + ++   +   
Sbjct: 237 SEERFRSLVEQAADAIFVHDLEGRFVDVNQSACKSVGYSRSELLN-LSVTNLEKGVSLEQ 295

Query: 440 IEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKR 499
           ++      +  + ++ E                  G  I V   + L+K +  Q   +  
Sbjct: 296 LKTVWQHIKVGESVTLEG-----------THRHKTGKKIPVEVRLGLIKWDGTQYILA-- 342

Query: 500 RLKATINDLSTSRQILERQKTE--LSIANAKYQVEKERA 536
                      +R I ER++ E  L     ++++ +E A
Sbjct: 343 ----------AARDITERKRVEEILKKRAIEFKMAQEIA 371



 Score =  117 bits (294), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 86/262 (32%), Gaps = 14/262 (5%)

Query: 268 LWNFNFDN-KKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK 326
           +W  +    +   +S+     +G       L        +H +++              +
Sbjct: 2   VWEADAKTFQFTFVSQQAEPFLGY-PCEDWLEPTFWVEHLHPEDRTWAPGFCMEATFKKQ 60

Query: 327 QLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
             +  + M  A    IW++    ++      + I G+ +D+T+    E+   E +Q L  
Sbjct: 61  DHEFEYRMITADNRIIWLRDLVSVIIENDQPVKICGVMLDITQWKQAEQTLKENEQNLQA 120

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
               T++A ++ D   ++V  N +  + YG      V  +A  +I       + E+  + 
Sbjct: 121 IFNSTTDAFIIADLEGKIVDINQSAIQMYGYSKAEFVTLHANQVICPEYQSRLKEFIQTA 180

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
                  ++ + L              DG       + T L++N  +   +  R      
Sbjct: 181 QSGKIASAQSVDL------------RKDGTFFYTEINGTTLEYNGQKHLLAIIRDVTERK 228

Query: 507 DLSTSRQILERQKTELSIANAK 528
               + +  E +   L    A 
Sbjct: 229 RAENALKESEERFRSLVEQAAD 250


>gi|16126721|ref|NP_421285.1| non-motile and phage-resistance protein [Caulobacter crescentus
           CB15]
 gi|221235503|ref|YP_002517940.1| sensory transduction histidine kinase pleC [Caulobacter crescentus
           NA1000]
 gi|13638405|sp|P37894|PLEC_CAUCR RecName: Full=Non-motile and phage-resistance protein
 gi|13424035|gb|AAK24453.1| non-motile and phage-resistance protein [Caulobacter crescentus
           CB15]
 gi|220964676|gb|ACL96032.1| sensory transduction histidine kinase pleC [Caulobacter crescentus
           NA1000]
          Length = 842

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 191/638 (29%), Positives = 315/638 (49%), Gaps = 22/638 (3%)

Query: 136 PNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNS 195
           P+  + A+  +     G         LS          +   + D     V    +   +
Sbjct: 204 PDGKLIAARGRGVQGAGALREAF--ALSIEDLGDGPAAVRGQAADGALLDVAVRPVAQGA 261

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI 255
              +       +  L R+ +         +  + + +      Q++K +      +++  
Sbjct: 262 LLAVAAAPTRSVANLDRQVMEGAFSLLVPLG-VGIALALLLMIQSRKAEVAHREFIDSER 320

Query: 256 CVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE 315
               A+   RCG+W ++ +  + +LS     +         +S + +   I  D+++   
Sbjct: 321 RFRLAVEAARCGIWEWDLNGDQVYLSDVTGAMF-GWGGGGVVSGQDLLERISIDHRERVR 379

Query: 316 IARSVTGKHVKQLDQIFHMRHASGADI--WIQVRAQMMRTIS--GGMNIIGIAMDLTEKY 371
            A +    +    D  F +  +       WI  R Q        G   IIG+A+D+TE+ 
Sbjct: 380 QALANAAMYGA-FDVSFRVPASEQGARSLWIDARGQGFGKPGSEGHARIIGVALDVTEER 438

Query: 372 HLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSII 431
             + R   A+ RL  AIE  SEA VLWD+  RL+MCN NY+  + L   +L PG AR+ +
Sbjct: 439 IAQARAQAAENRLRDAIESVSEAFVLWDRQGRLLMCNRNYRSVFSLEPKILKPGAARAEV 498

Query: 432 QDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQ 491
                  I +   +         +E ++ D RW+QI+E  T +GG +    DIT +K  +
Sbjct: 499 NRFAALAIKQDHPAPDGAKG--VREAEMMDGRWIQISERRTAEGGLVMTAADITAIKTQE 556

Query: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMS 551
              R ++         L  +   LER + +L+    KY+ EK +AE+ANK KSEFLA MS
Sbjct: 557 EARRRNE-------EQLQNAVAGLERSQEQLAELARKYETEKVKAESANKAKSEFLANMS 609

Query: 552 HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETE 611
           HELRTPLNAI GFSE++  E+FG LG  +Y  Y+QDIH SGQHLL +IN+IL+MSKIE  
Sbjct: 610 HELRTPLNAINGFSEIMMNEMFGPLGDQRYKGYSQDIHSSGQHLLALINDILDMSKIEAG 669

Query: 612 KISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSN 671
           K+++  ++  L  +  + +RL+ + A++  +K++   P      AD R +K++L  +LSN
Sbjct: 670 KMNLKFESMHLEDVAEDAVRLVRNRAEAAGLKLDIDFPQLPEIEADYRAVKQVLLNLLSN 729

Query: 672 SIKFTNNNGKMMIRTSKI----GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSI 727
           +IKFT   G + +R        G  + +++ DTGIGI K  L ++ +PFE + +Q+ ++ 
Sbjct: 730 AIKFTPRAGSVTVRAEVRRDPFGDLIKVSVTDTGIGIAKEDLARLAKPFEQVESQFSKTT 789

Query: 728 GGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            G GLGLA++ +L  +H G L++ S  G+GT V+  +P
Sbjct: 790 QGTGLGLALTKSLITMHDGVLEMHSTPGEGTTVSFTLP 827


>gi|298528782|ref|ZP_07016186.1| PAS/PAC sensor hybrid histidine kinase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298512434|gb|EFI36336.1| PAS/PAC sensor hybrid histidine kinase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 1037

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 140/679 (20%), Positives = 255/679 (37%), Gaps = 55/679 (8%)

Query: 103 KFDLASQKKAESMLGQLLA---KTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEII 159
             D+   KK  + L +      +T       ++    +  V   +       G    E  
Sbjct: 246 ARDITEHKKVLAKLQESEQSLARTLQAIGDGVISTDMDSRVVQMNPVAEKLCGWDEAEAR 305

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
             L     R           +       + +    +  +++++       +      +  
Sbjct: 306 GRLLSDVLRIVNADTRAVVDNPLQKVFATGHTLGLASHVMLLSRTGEEYHIADSAAPIRD 365

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
              +I  A+L+      +R   +       L  +   ++ A++    G+W++N    + +
Sbjct: 366 SHGNITGAVLV------FRDVTREHAQAERLRTSEERLDRAMAVKNEGIWDWNLVTNETY 419

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS-VTGKHVKQLDQIFHMRHAS 338
                Y + G         F   A  +H ++ +    A         +  D  F  +H  
Sbjct: 420 FDDRYYTMAGYSPNEFPQHFSGWAERVHPEDLQKATSAIEDCIAGKTETFDIEFRFKHKD 479

Query: 339 GADIWIQVRAQMMRT--ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV 396
           G+ IWIQ + ++M        + +IG   D+TE+   E+   E+++   K ++   + +V
Sbjct: 480 GSWIWIQGQGKIMERNPDDSPLRMIGTHTDITERKLAEEALLESEEMQRKILQAVPDLIV 539

Query: 397 LWDKNDRLVMCNA-NYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS-QDMS 454
             D    +   N   Y     +P   +   +  S I         E      E++     
Sbjct: 540 RTDLEGIITFVNELAYPGLSYIPQASIYGRSLFSFIDARDLPRAQENALKRLEKNIGPQE 599

Query: 455 KEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
             +   +                IS+ T+I                +      +      
Sbjct: 600 YRLNFEEG---------------ISIDTEI-------------NGAVVYDKESMPVGMVY 631

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
           + R  T+      +    KE+AE AN+ KS FLA MSHELRTP N I+G  ++++     
Sbjct: 632 VIRDITDRKRDKKELLKAKEQAEAANQAKSRFLANMSHELRTPFNGIMGMMQLLQTTTLD 691

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
                +  EY      S Q    ++++IL++S +ET ++SI     DL   +     +  
Sbjct: 692 ----EEQQEYVDMAIKSSQRFARLLSDILDLSSVETGRMSIFNSEFDLGEALGSIHDIFD 747

Query: 635 SSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK---- 688
           +SA+ K + +E     ++      D   +K+IL  ++SN++KFT   G + IR       
Sbjct: 748 ASAREKGVFLEYLPGDDVPAKVIGDAVRVKQILITLVSNALKFT-EKGVVEIRLDALCAA 806

Query: 689 IGQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            G  V I   ++DTGIGIP+  L+ +  PFE L   Y +   G GLGL+I   L  L  G
Sbjct: 807 KGGDVRIKFAVSDTGIGIPEDQLKNLFTPFEQLDGSYTRKHQGAGLGLSIVKRLVELMNG 866

Query: 747 RLKIISQEGKGTIVTICMP 765
            + I S  G+GT V + +P
Sbjct: 867 NIDIDSLPGEGTTVHVVLP 885



 Score =  144 bits (364), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 48/382 (12%), Positives = 122/382 (31%), Gaps = 30/382 (7%)

Query: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
            +    +   +  + P      ++   +   G    + + +     +        E+S  
Sbjct: 19  QELLIKAPMGVFTSTPEGRFLTANPAMAKMFGYDTPQEMIDSITDIASEFYA---ESSDR 75

Query: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
            +   +L V+    +    +I         W       +       ++       +    
Sbjct: 76  NKILQLLEVHQQVENFECRLIRRD----GSWLWSSIDVLAMRDESGSIT--HYHGFITDI 129

Query: 241 KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR 300
            ++K+    + + +  +E   +     L   N D +   L+    +++G   +       
Sbjct: 130 TEHKQAQDQIEKKSEELELYFNSSLDLLCIANVDGRFLRLNPEWEKVLGYTTQELEGRM- 188

Query: 301 AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI 360
                +H D+ +    A S      + L+ +       G+  WI+ R++ +     G  I
Sbjct: 189 -FLDFVHPDDVESTVAAVSRLENQEQVLNYVNRFCCKDGSYRWIEWRSRPL-----GRQI 242

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
              A D+TE   +  +  E++Q L++ ++   + ++  D + R+V  N   +K  G  + 
Sbjct: 243 YAAARDITEHKKVLAKLQESEQSLARTLQAIGDGVISTDMDSRVVQMNPVAEKLCGWDEA 302

Query: 421 VLVPGNARSI--IQDAQTRPIIEYRTSDPERSQDMSKEI-------KLADSRWLQINEWC 471
                    +  I +A TR +++        +              +  +   +  +   
Sbjct: 303 EARGRLLSDVLRIVNADTRAVVDNPLQKVFATGHTLGLASHVMLLSRTGEEYHIADSAAP 362

Query: 472 THDG-----GTISVGTDITLLK 488
             D      G + V  D+T   
Sbjct: 363 IRDSHGNITGAVLVFRDVTREH 384



 Score =  133 bits (336), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 62/464 (13%), Positives = 141/464 (30%), Gaps = 39/464 (8%)

Query: 85  TSLMLTEAIEIIFQNNNIKFDLASQKKAESMLG---QLLAKTRFLSESFILLAQPNELVF 141
             L + +    I   +    D+   K+A+  +    + L      S   + +A  +    
Sbjct: 108 DVLAMRDESGSITHYHGFITDITEHKQAQDQIEKKSEELELYFNSSLDLLCIANVDGRFL 167

Query: 142 ASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILII 201
             + +    +G    E+   +         V         +        L +    +  +
Sbjct: 168 RLNPEWEKVLGYTTQELEGRMFLDFVHPDDV---------ESTVAAVSRLENQEQVLNYV 218

Query: 202 NSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETAL 261
           N        +R                    +++  R   ++K+    L E+   +   L
Sbjct: 219 NRFCCKDGSYRWIEWRSRPL--------GRQIYAAARDITEHKKVLAKLQESEQSLARTL 270

Query: 262 SRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLS-FRAIARLIHYDNKKICEIARSV 320
                G+ + + D++   ++    ++ G             + R+++ D + + +     
Sbjct: 271 QAIGDGVISTDMDSRVVQMNPVAEKLCGWDEAEARGRLLSDVLRIVNADTRAVVDNPLQK 330

Query: 321 --TGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRY 377
                H   L     +   +G +  I   A  +R   G +   + +  D+T ++   +R 
Sbjct: 331 VFATGHTLGLASHVMLLSRTGEEYHIADSAAPIRDSHGNITGAVLVFRDVTREHAQAERL 390

Query: 378 AEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGN--ARSIIQDAQ 435
             +++RL +A+   +E +  W+        +  Y    G   +            +    
Sbjct: 391 RTSEERLDRAMAVKNEGIWDWNLVTNETYFDDRYYTMAGYSPNEFPQHFSGWAERVHPED 450

Query: 436 TRP---IIEYRTSDPERSQDMSKEIKLADSRWLQINEW-----CTHDGG---TISVGTDI 484
            +     IE   +    + D+    K  D  W+ I           D      I   TDI
Sbjct: 451 LQKATSAIEDCIAGKTETFDIEFRFKHKDGSWIWIQGQGKIMERNPDDSPLRMIGTHTDI 510

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTS--RQILERQKTELSIAN 526
           T  K  +  L ES+   +  +  +     R  LE   T ++   
Sbjct: 511 TERKLAEEALLESEEMQRKILQAVPDLIVRTDLEGIITFVNELA 554



 Score =  118 bits (297), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/269 (13%), Positives = 82/269 (30%), Gaps = 14/269 (5%)

Query: 258 ETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIP-YENKTLSFRAIARLIHYDNKKICEI 316
           +  L +   G++    + +    + +M ++ G    +    S   IA   + ++      
Sbjct: 19  QELLIKAPMGVFTSTPEGRFLTANPAMAKMFGYDTPQEMIDSITDIASEFYAESSDR-NK 77

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEK 375
              +   H +  +    +    G+ +W  +    MR  SG + +  G   D+TE    + 
Sbjct: 78  ILQLLEVHQQVENFECRLIRRDGSWLWSSIDVLAMRDESGSITHYHGFITDITEHKQAQD 137

Query: 376 RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQ 435
           +  +  + L      + + L + + + R +  N  ++K  G     L        +    
Sbjct: 138 QIEKKSEELELYFNSSLDLLCIANVDGRFLRLNPEWEKVLGYTTQELEGRMFLDFVHPDD 197

Query: 436 TRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLR 495
               +   +    + Q ++   +            C  DG    +      L        
Sbjct: 198 VESTVAAVSRLENQEQVLNYVNRF-----------CCKDGSYRWIEWRSRPLGRQIYAAA 246

Query: 496 ESKRRLKATINDLSTSRQILERQKTELSI 524
                 K  +  L  S Q L R    +  
Sbjct: 247 RDITEHKKVLAKLQESEQSLARTLQAIGD 275


>gi|254420304|ref|ZP_05034028.1| PAS fold family [Brevundimonas sp. BAL3]
 gi|196186481|gb|EDX81457.1| PAS fold family [Brevundimonas sp. BAL3]
          Length = 759

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 181/659 (27%), Positives = 298/659 (45%), Gaps = 29/659 (4%)

Query: 114 SMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQ 173
             L   +  +   +   + +     +V AS       +G+    +I              
Sbjct: 106 RRLEARILPS-LPASGAVRIVSKTGVVLASPNAAE--VGRSATPLIG-----VQAGDLAS 157

Query: 174 MSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFIL 233
           ++           +        G  ++     P        +  E    +    L L +L
Sbjct: 158 LTTPVATPGGRASVVAAPITPDGPYVVALQSGPPAGA--AGLLGEAWVLAAPVLLGLGVL 215

Query: 234 FSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYE 293
             +  Q  +          +      A+   RCG+W ++ D  +  LS  M  ++G    
Sbjct: 216 ALFLFQGLRRARASREWASSEKRFRIAVEAARCGVWEWDLDGAEVTLSDYMATLLGFETG 275

Query: 294 NKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM-- 351
               +  A+   IH   +   + A      +    +  F +    G   WI  R Q    
Sbjct: 276 GVVPA-EAVMARIHPRYRDEVQHALRQATAYGA-FEVTFPVPGDGGRTRWIDARGQARGA 333

Query: 352 RTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANY 411
           R  +G   I+G+A+D+TE    +     A+ RL   +E  S+A VL+D+  RL++ N  +
Sbjct: 334 RGEAGFSAILGVALDITEARRAKAAAQSAESRLRDGVESISDAFVLFDRQGRLILWNQAF 393

Query: 412 QKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWC 471
           + A+     V+  G A+  +       I         R+     E++L D RWLQ++E  
Sbjct: 394 EDAFDFQSGVVRRGAAKEELNRIAALAIKAEHAPTDGRAGLR--EVELHDGRWLQLSERF 451

Query: 472 THDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQV 531
           T +GG++    DIT +K  + + R +         DLS +   LE  +  LS    KY++
Sbjct: 452 TSEGGSVVTAADITAIKREETERRRAV-------EDLSRTVAQLEASQQMLSQLARKYEI 504

Query: 532 EKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYS 591
              RAE AN+ KSEFLA MSHELRTPLNAI GFSE++  E+FG +G  KY  YA DI  S
Sbjct: 505 AMTRAEAANQAKSEFLANMSHELRTPLNAINGFSEIMAAELFGPIG-EKYKGYAGDILKS 563

Query: 592 GQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE 651
           GQHLL++IN+IL+M+KIE  K+++  +   L  +  +  RL+        + +E +    
Sbjct: 564 GQHLLSLINDILDMAKIEAGKMTLHYEPVSLRDVCEDAARLMRGKVLESGLTLEIEAGDL 623

Query: 652 LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK-----IGQCVIITIADTGIGIPK 706
               AD R +K+++  ++SN++KFT   G + +  +          V +  ADTGIGI  
Sbjct: 624 PDIEADHRGVKQVMLNLISNAVKFTPEGGTVTLSLTPFKGAAGEDRVRVACADTGIGIAP 683

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             + ++ +PFE +  Q+ ++  G GLGLA++ +L  +HGGRL I S+ G GT+V+  +P
Sbjct: 684 EHMVRLARPFEQVEGQHSKTTQGTGLGLALTKSLIEMHGGRLNIESEPGVGTVVSFDLP 742



 Score = 41.5 bits (96), Expect = 0.56,   Method: Composition-based stats.
 Identities = 13/164 (7%), Positives = 36/164 (21%), Gaps = 18/164 (10%)

Query: 102 IKFDLASQKKAESMLGQLLAKTRFLSE---SFILLAQPNELVFASSTKNSHYIGKKIGEI 158
           +  D+   ++A++      ++ R   E      +L      +   +              
Sbjct: 345 VALDITEARRAKAAAQSAESRLRDGVESISDAFVLFDRQGRLILWNQAFEDAFDF----- 399

Query: 159 IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
                    R    +     +               +G   +           R     E
Sbjct: 400 ----QSGVVRRGAAKEELNRIAALAIKAEHAPTDGRAGLREVELHDG------RWLQLSE 449

Query: 219 VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALS 262
                  S +    + +  R+  + +     L      +E +  
Sbjct: 450 RFTSEGGSVVTAADITAIKREETERRRAVEDLSRTVAQLEASQQ 493


>gi|108805455|ref|YP_645392.1| multi-sensor hybrid histidine kinase [Rubrobacter xylanophilus DSM
           9941]
 gi|108766698|gb|ABG05580.1| multi-sensor hybrid histidine kinase [Rubrobacter xylanophilus DSM
           9941]
          Length = 1369

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 126/686 (18%), Positives = 258/686 (37%), Gaps = 70/686 (10%)

Query: 100 NNIKFDLASQKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKIG 156
             I  D+  + + E  L    A+ R L    +  +L           +  N   + +   
Sbjct: 228 RGILRDITERLRMEERLRSSEAELRALFAAIDDIVLKLDREGRCLDIAPSNPSPLYRPGR 287

Query: 157 EIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
           E++    R                ++P       +                L   R    
Sbjct: 288 EMVGRNVREIFPVDE---------KEPLLDSVRRVLQTGRP--AAMECSMQLGYRRLYFD 336

Query: 217 LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
           + +      +A+L+       R   + +  +  L  A       + +    ++  +    
Sbjct: 337 VSISPEGEGAAVLVA------RDVTRERLAEQELRRAEERYRRLIEQIPGIVYTEDARTG 390

Query: 277 K-FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMR 335
           +  + S  + EI+G P +          ++IH +++++         +  K L   + + 
Sbjct: 391 ETLYDSPRVEEILGYPADTYRKDPNYWQKIIHPEDRELLRALEERASREGK-LSAEYRVF 449

Query: 336 HASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA 394
            A G  +W++    ++    G      GI +D+TE+   E+   E++QR  +A +     
Sbjct: 450 AADGRVVWVREEGALIPGEEGRPDVWQGIILDITERKRAEQALHESEQRFRRAFDDAPIG 509

Query: 395 LVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMS 454
           + L   + R +  N    +  G P   L+    + I         +E       R     
Sbjct: 510 MALVGLDGRWLQANRALCEIVGYPRERLLQKTFQDITHPEDLDADLELLRRLVAREIPG- 568

Query: 455 KEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
                    +     +    G  + V   ++L+     +      ++             
Sbjct: 569 ---------YQMEKRYIHASGRIVWVLLSVSLVTGENDEPLYVIAQV------------- 606

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
             +  TE      + +  KE+AE A++ KSEF+A MSHE+RTP+N ++G +E++      
Sbjct: 607 --QDITERKRIEEELREAKEQAEAASRAKSEFVANMSHEIRTPMNGVIGMAELLLDTPLT 664

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
                +  EYA+ I  SG+ LL ++N+IL+ SKIE  ++S+++   ++   + E + L+ 
Sbjct: 665 P----EQREYARTIRSSGEALLAILNDILDFSKIEAGRLSLERIPFEIHKEVEEVVSLLA 720

Query: 635 SSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
             A +K +++   I   +      D   ++++L  ++ N+IKFT   G++++  S   + 
Sbjct: 721 PRAHAKGLELICFIEPGVPPLIKGDPFRLRQVLTNLIGNAIKFTEE-GEVVVSASLSKEE 779

Query: 693 ---------------VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAIS 737
                          +   + D+GIGI +   + + + F        +  GG GLGLAIS
Sbjct: 780 KKKSAPAGERGGEIELRFEVKDSGIGIQEEQQKHLFEAFSQADASTTRRYGGTGLGLAIS 839

Query: 738 DALTNLHGGRLKIISQEGKGTIVTIC 763
             L  + GG + + S   +G+     
Sbjct: 840 RQLVEMMGGEIGLKSSPKEGSTFHFS 865



 Score =  123 bits (308), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/410 (12%), Positives = 129/410 (31%), Gaps = 32/410 (7%)

Query: 117 GQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSE 176
                +    S   +L    +  +   +       G    E +   +R   ++++ +  E
Sbjct: 9   DAREKRLLEFSHDAVLARDEDGRISFWNRSAERLYGWSSSEALGRNARELLKTRSGEPLE 68

Query: 177 ASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSY 236
              ++                       + +   W       +V FS             
Sbjct: 69  EIEERVRSEGA---WEGELRQHARDGRPLVVECRWVRAGAGNIVEFS------------- 112

Query: 237 YRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT 296
            R   + ++ +           + L     G +  +        ++++  I+G P     
Sbjct: 113 -RDTAERQKAEE--------YRSVLEAIEDGYFETDLAGNLTFANQALGRILGYPASRLL 163

Query: 297 LSFRAIARLIHYDNKKICEIARSVTGKHVKQLD-QIFHMRHASGADIWIQVRAQMMRTIS 355
                  + +  +N +    A        +     ++ M   +G+   ++    ++R  S
Sbjct: 164 GKNS--RQYMDRENARKVHEAFKEVYATGRAARGLVWEMIPRTGSPRCVEGSVSLIRDGS 221

Query: 356 GG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKA 414
           G      GI  D+TE+  +E+R   ++  L        + ++  D+  R +    +    
Sbjct: 222 GRPCGFRGILRDITERLRMEERLRSSEAELRALFAAIDDIVLKLDREGRCLDIAPSNPSP 281

Query: 415 YGLPDHVLVPGNARSIIQDAQTRPIIE--YRTSDPERSQDMSKEIKLADSR-WLQINEWC 471
              P   +V  N R I    +  P+++   R     R   M   ++L   R +  ++   
Sbjct: 282 LYRPGREMVGRNVREIFPVDEKEPLLDSVRRVLQTGRPAAMECSMQLGYRRLYFDVSISP 341

Query: 472 THDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
             +G  + V  D+T  +  + +LR ++ R +  I  +       + +  E
Sbjct: 342 EGEGAAVLVARDVTRERLAEQELRRAEERYRRLIEQIPGIVYTEDARTGE 391



 Score = 99.3 bits (246), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 56/447 (12%), Positives = 129/447 (28%), Gaps = 34/447 (7%)

Query: 94  EIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGK 153
                      D A ++KAE     L A      E           +  ++      +G 
Sbjct: 103 AGAGNIVEFSRDTAERQKAEEYRSVLEAI-----EDGYFETDLAGNLTFANQALGRILGY 157

Query: 154 KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
               ++ + SR     +  +    +  +               +  ++   +P     R 
Sbjct: 158 PASRLLGKNSRQYMDRENARKVHEAFKEVY--------ATGRAARGLVWEMIPRTGSPRC 209

Query: 214 EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF 273
                 +          F      R   +    +  L  +   +    +     +   + 
Sbjct: 210 VEGSVSLIRDGSGRPCGFRGI--LRDITERLRMEERLRSSEAELRALFAAIDDIVLKLDR 267

Query: 274 DNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFH 333
           + +   ++ S    +      + +  R +  +   D K+    +     +  +       
Sbjct: 268 EGRCLDIAPSNPSPL-YRPGREMVG-RNVREIFPVDEKEPLLDSVRRVLQTGRPAAMECS 325

Query: 334 MRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
           M+         ++   +  +  G    + +A D+T +   E+    A++R  + IE    
Sbjct: 326 MQL---GYR--RLYFDVSISPEGEGAAVLVARDVTRERLAEQELRRAEERYRRLIEQIPG 380

Query: 394 ALVLWDKN-DRLVMCNANYQKAYGLPDHVLVPG-NARSIIQDAQTRPIIEYRTSDPERSQ 451
            +   D      +  +   ++  G P        N    I   + R ++        R  
Sbjct: 381 IVYTEDARTGETLYDSPRVEEILGYPADTYRKDPNYWQKIIHPEDRELLRALEERASREG 440

Query: 452 DMSKEIKL--ADSRWLQINEW----CTHDGG---TISVGTDITLLKHNQAQLRESKRRLK 502
            +S E ++  AD R + + E        +G       +  DIT  K  +  L ES++R +
Sbjct: 441 KLSAEYRVFAADGRVVWVREEGALIPGEEGRPDVWQGIILDITERKRAEQALHESEQRFR 500

Query: 503 ATINDLSTSRQILERQKTELSIANAKY 529
              +D      ++      L  AN   
Sbjct: 501 RAFDDAPIGMALVGLDGRWL-QANRAL 526


>gi|269839224|ref|YP_003323916.1| PAS/PAC sensor hybrid histidine kinase [Thermobaculum terrenum ATCC
            BAA-798]
 gi|269790954|gb|ACZ43094.1| PAS/PAC sensor hybrid histidine kinase [Thermobaculum terrenum ATCC
            BAA-798]
          Length = 1363

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 140/710 (19%), Positives = 276/710 (38%), Gaps = 69/710 (9%)

Query: 73   TRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF-- 130
             R+        +         E +     +  D+  +K AE  + Q+  + + + E    
Sbjct: 407  LRHRDGSLRFVEEYGQCVRVTEGMPLLEGLLTDVTDRKHAEQAVQQVQRRYQDIFERISE 466

Query: 131  -ILLAQPNELVFASSTKNSHYIGK-KIGEIIPELSRSRS-----RSKTVQMSEASLD-QQ 182
             I     +  +  ++   +  +G     E++ E+           +   +     L+  +
Sbjct: 467  GIFQTSLDGRLLLANPALARMLGYASPEELLSEVQDVARQIYARPADRDRYLRIMLEEGE 526

Query: 183  PYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKK 242
                    +  +   I +  S   LL   R                 + I+    +   +
Sbjct: 527  VRDFELEAVRKDGEHIWLSISSRWLLDEARG----------------MRIIEGTCQDITQ 570

Query: 243  NKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAI 302
             K  +  L E+     +A      G+     D +   ++ S+  ++G             
Sbjct: 571  RKRAEEALRESMELFVSAFDHAPIGMALVATDGRWLRVNPSLCRMLGYSERELLG--MTF 628

Query: 303  ARLIHYDNKKI-CEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NI 360
              + H D+ ++  +  R V    + Q +      H  G+ +W  +   ++R + G     
Sbjct: 629  QDITHPDDLELDLQHVRQVLDGEIAQYEMEKRYYHKHGSIVWALLSVSLVRDLDGQPLYF 688

Query: 361  IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
            +    D+T++  +E+   E+++R  + +E   + + +  ++ R+   N    +  G  D 
Sbjct: 689  VSQIQDITQRKEIERAITESEERYRRLVEAFPDLIAIV-QDGRVAYVNPAGARMLGAKDP 747

Query: 421  VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV 480
              + G +       + R  +  +             I+           + T DG  I  
Sbjct: 748  QELVGRSVLEFVHPERRGEVAAQIDSIGEGGPPPDSIE---------ERFITLDGREIYA 798

Query: 481  GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
               +                   T ++   + QI+ R  TE      + +  +++A  A+
Sbjct: 799  EVKVVP-----------------TSHEDRPASQIIARDITESRRVAEELRRARDQAIEAS 841

Query: 541  KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
            + KSEF+A MSHE+RTPLNAI+G +E+++        S +  E+ Q I  S Q LL++IN
Sbjct: 842  RLKSEFVANMSHEIRTPLNAIIGMTELLQDTPL----SERQREFVQTIQTSSQSLLSIIN 897

Query: 601  NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADK 658
            +IL+ SKIE  K+ +++ + DL+ ++     ++  +A+ K I +   +   +      D 
Sbjct: 898  DILDFSKIEAGKMVLEEVDFDLVSLVEGTSEMLAGAARGKGISLMTFVDPTIPRTLIGDP 957

Query: 659  RIIKKILFPILSNSIKFTNNNGKMMIRT---SKIGQCVI--ITIADTGIGIPKSALEKIG 713
              ++++L  +LSN++KFT   G++++R          V     + DTGIGI  + L K+ 
Sbjct: 958  ARLRQVLLNLLSNAVKFT-EQGEVLLRVLPHRAADSEVELLFEVRDTGIGIDSAHLGKLF 1016

Query: 714  QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
            QPF        +  GG GLGL IS  L  L GG +   SQ G G+     
Sbjct: 1017 QPFTQADASTTRRYGGTGLGLTISKTLVELMGGTIWAESQPGVGSTFRFT 1066



 Score =  135 bits (339), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 56/392 (14%), Positives = 124/392 (31%), Gaps = 44/392 (11%)

Query: 212 REEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN- 270
           R +    +V  S++S L    +    R  +++      L E+     T L+     ++  
Sbjct: 286 RVDTIPLIVGTSLMSILATVRMVGILRDHQRDY---DRLQESERRFATLLANTPAMVYRR 342

Query: 271 -----FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHV 325
                ++ +     +S    EI G           ++  L+H ++               
Sbjct: 343 RQDDRWSLE----FVSSYAREITGYSDAELLGGKVSLRELVHPEDLPAVTANLRGVSSPG 398

Query: 326 KQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLS 385
           ++    + +RH  G+  +++   Q +R   G   + G+  D+T++ H E+   +  +R  
Sbjct: 399 QRYRLEYRLRHRDGSLRFVEEYGQCVRVTEGMPLLEGLLTDVTDRKHAEQAVQQVQRRYQ 458

Query: 386 KAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTS 445
              E  SE +     + RL++ N    +  G      +    + + +    RP    R  
Sbjct: 459 DIFERISEGIFQTSLDGRLLLANPALARMLGYASPEELLSEVQDVARQIYARPADRDRYL 518

Query: 446 DPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATI 505
                +   ++ +L         E    DG  I +      L      +R  +       
Sbjct: 519 RIMLEEGEVRDFEL---------EAVRKDGEHIWLSISSRWLLDEARGMRIIEGTC---- 565

Query: 506 NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE-----LRTPLNA 560
                      +  T+   A    +   E   +A       +A ++ +     +   L  
Sbjct: 566 -----------QDITQRKRAEEALRESMELFVSAFDHAPIGMALVATDGRWLRVNPSLCR 614

Query: 561 ILGFS--EVIKKEIFGELGSVKYYEYAQDIHY 590
           +LG+S  E++                 Q +  
Sbjct: 615 MLGYSERELLGMTFQDITHPDDLELDLQHVRQ 646


>gi|17231589|ref|NP_488137.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17133232|dbj|BAB75796.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 965

 Score =  442 bits (1136), Expect = e-121,   Method: Composition-based stats.
 Identities = 154/686 (22%), Positives = 265/686 (38%), Gaps = 53/686 (7%)

Query: 111 KAESMLGQLLAKTRFLSES---FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS 167
           + ++ L Q   +   L+E     I     +      + + S   G+ I   +        
Sbjct: 139 QTKAALQQSEHRYATLAEVVPVAIFRLDADGNCIYVNDRWSQITGEPIQAALGRGCLDTI 198

Query: 168 RSKTVQMS-----EASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFF 222
             +          E    ++ Y      L  +  +I      +P        +       
Sbjct: 199 HPEDSDRLFHQWTEVLTQEKMYCYEGKFLRKDGTTIWFYMQILPETDQNVTTIGYVGTLT 258

Query: 223 SIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSR 282
            I       +            E +  L + +  +  A+S GR G+W F+   +K     
Sbjct: 259 DISEQ-QAALDDGLRPTIGDLIEAEAKLRKISERLTLAISSGRFGIWEFDCVQEKVIWDE 317

Query: 283 SMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADI 342
            MYE+ G+  E+   +F A    +H D++    +         ++ D  F +   SG   
Sbjct: 318 RMYELYGVHPEDFPGNFDAWLSFVHPDDQDYLLVTIQQVLHQNQEYDAEFQIIQPSGEIR 377

Query: 343 WIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKN 401
            I+    +     G  + ++GI +D+TE+   E+               +++AL L D  
Sbjct: 378 VIKAYGVLNCDEQGKPILMVGINIDITERKQAEQELIHNRDLREVIFNESADALFLVDPV 437

Query: 402 DRLV-MCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLA 460
             L   CN    + +   +   + G     +         + R         +  +++  
Sbjct: 438 TLLTLDCNRRTVELFEATNKGELLGIEGRTL---------QRRPFTSNEIDTIVTQMQTK 488

Query: 461 DSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKT 520
              W Q  E+ T  G           +       R         IN+   + + L R   
Sbjct: 489 -GFWSQEIEYVTLKGKLFWGNIAAKPITIAG---RTLNLVRVTDINERKQAEEKLLRTNE 544

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           +L+ ANA+          A + K EFLA MSHELRTPLNAILG SE   + +FG +   K
Sbjct: 545 QLAKANAELA-------RATRLKDEFLANMSHELRTPLNAILGMSEGFIEGVFGAIN-QK 596

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
             +    I  SG+HLL +IN+IL++SKIE+ K+ +   +  +  I +  +  I   A  K
Sbjct: 597 QAKAIATIKRSGKHLLELINDILDLSKIESGKLELQISDVSVRSICDGSLTFIQQMALKK 656

Query: 641 NIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG--------- 690
           NI +   I S L     D R ++++L  +LSN++KFT   G + +               
Sbjct: 657 NICLSTHIGSNLDTIQVDDRRLRQVLINLLSNAVKFTPEGGNVKLTVWLEEVGTNETLGA 716

Query: 691 -----------QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDA 739
                        +   + DTGIGI    + K+ QPF  L +  +++  G GLGLA+   
Sbjct: 717 EKLISQSSIPSPHICFRVTDTGIGIASEDISKLFQPFTQLDSSLNRNYTGTGLGLALVKR 776

Query: 740 LTNLHGGRLKIISQEGKGTIVTICMP 765
           +T LHGG + + S+ G+G+  T+ +P
Sbjct: 777 ITTLHGGTILVNSEVGQGSCFTVRIP 802


>gi|307824658|ref|ZP_07654882.1| multi-sensor hybrid histidine kinase [Methylobacter tundripaludum
            SV96]
 gi|307734312|gb|EFO05165.1| multi-sensor hybrid histidine kinase [Methylobacter tundripaludum
            SV96]
          Length = 1278

 Score =  440 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 155/677 (22%), Positives = 281/677 (41%), Gaps = 47/677 (6%)

Query: 97   FQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNEL---VFASSTKNSHYIGK 153
            +Q  +I+ D++  KKAE  L  LL +    S S I +   N+    +   +       G 
Sbjct: 490  YQYVSIRTDISRIKKAELRLR-LLERAVEASASSISMVDVNKPGMPLIYVNPAFERITGY 548

Query: 154  KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
               E I    R     +T Q     +        +V     +G  L+ N R      W +
Sbjct: 549  SRDEAIGRNPRFLQGKETDQPGVDEIR-------AVLQEGRAGGALLHNYRKNGTPYWND 601

Query: 214  EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF 273
                          L  FI  +      + ++    LL++   +  +      G W++N 
Sbjct: 602  L--RIAPVHDEQGRLSHFIGIAD--DVTERRDAGDALLKSEERLRRSQHYANIGTWDWNI 657

Query: 274  DNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFH 333
               K   S  +  + G P + + +SF+     IH D+++    A     +   + +    
Sbjct: 658  QTGKVICSERIGSLFGYPEDKREISFKYFLDGIHPDDRQKVIDAVDACVQQGAEYNIEHR 717

Query: 334  MRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRL---SKAIE 389
                 G   W+  R  ++R   G   N++G+  D+T +   E +  E   RL   +  IE
Sbjct: 718  CVWPDGTVRWLLERGDVVRDGDGTPLNMLGVVQDITHRKFAELKILEKQARLVIFNHIIE 777

Query: 390  CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
              ++A++  D    +   N   +K +G     ++     +++     R            
Sbjct: 778  NVADAVITIDSVGTISSFNPAAEKLFGYSAAEIIN-RNVNLLMPEPYRSKHGRYIDLHNA 836

Query: 450  SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
             Q      K               DG   S+   +TL++ + ++                
Sbjct: 837  GQPSGIIGK------QLELPGQHKDGTIFSLELAVTLMEIDDSKHF-------------- 876

Query: 510  TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
                 + R  +E      +    ++ AE+AN  KSEFL+ MSHELRTP+NAILGF ++++
Sbjct: 877  ---VGILRDISERKQYEQEIIAARDEAESANNAKSEFLSNMSHELRTPMNAILGFGQLLE 933

Query: 570  KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
             E      +    +Y  +I  +G HLL +IN +L++++IE+  I++  +      +I E 
Sbjct: 934  IEAG---LNEDQADYVDEILKAGHHLLELINEVLDLARIESGNINLSLEPLSCAELIGEC 990

Query: 630  IRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            + LI   AQ + I I      +    AD+  +K++L  +LSN+IK+    G+++++ +  
Sbjct: 991  LTLIKPIAQVRGITINDAAIGDYVIRADRTRLKQVLINLLSNAIKYNRPQGEVLVQVAVQ 1050

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
               V + ++DTG GIP +  +++ QPF  L  +    I G G+GL IS  L  + GG + 
Sbjct: 1051 DGFVRLEVSDTGYGIPATRRQELFQPFSRLGVEDA-DIEGTGIGLTISRRLMKMMGGAIG 1109

Query: 750  IISQEGKGTIVTICMPQ 766
            + S+EG+G    I +P+
Sbjct: 1110 MDSEEGRGCTFWIELPE 1126



 Score =  123 bits (308), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 54/421 (12%), Positives = 120/421 (28%), Gaps = 45/421 (10%)

Query: 93  IEIIFQNNNIKFDLASQKKAESML---GQLLAKTRFLSESFILLAQPNELVFASSTKNSH 149
             +       +      +   + L    +   +    + + +        +   + +   
Sbjct: 360 AAVALHARRFRQTREQTESLRATLYERERQQQQQALDAHAIVSATDAAGTLIYVNDRFCE 419

Query: 150 YIGKKIGEIIPELSR-----SRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSR 204
             G    E++ +  R            + M    +    +     N   +     +  S 
Sbjct: 420 ISGYSRNELVGQNHRIVKSSEHLPEFYLDMWNTIVCGNIWRGEVCNRRKDGRLYWVETSI 479

Query: 205 VPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRG 264
           VP L                          S      + K+ +  L      VE   S  
Sbjct: 480 VPFLDNTGRPYQY----------------VSIRTDISRIKKAELRLRLLERAVEA--SAS 521

Query: 265 RCGLWNFNFDNK-KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGK 323
              + + N       +++ +   I G   +          +     ++   +  R+V  +
Sbjct: 522 SISMVDVNKPGMPLIYVNPAFERITGYSRDEAIGRNPRFLQG-KETDQPGVDEIRAVLQE 580

Query: 324 H--VKQLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEA 380
                 L   +     +G   W  +R   +    G   + IGIA D+TE+        ++
Sbjct: 581 GRAGGALLHNYR---KNGTPYWNDLRIAPVHDEQGRLSHFIGIADDVTERRDAGDALLKS 637

Query: 381 DQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH--VLVPGNARSIIQDAQTRP 438
           ++RL ++    +     W+     V+C+      +G P+    +        I     + 
Sbjct: 638 EERLRRSQHYANIGTWDWNIQTGKVICSERIGSLFGYPEDKREISFKYFLDGIHPDDRQK 697

Query: 439 IIEYRTSDPERSQDMSKEIK--LADS--RWLQINEWCTHDG-----GTISVGTDITLLKH 489
           +I+   +  ++  + + E +    D   RWL        DG       + V  DIT  K 
Sbjct: 698 VIDAVDACVQQGAEYNIEHRCVWPDGTVRWLLERGDVVRDGDGTPLNMLGVVQDITHRKF 757

Query: 490 N 490
            
Sbjct: 758 A 758



 Score = 39.2 bits (90), Expect = 3.1,   Method: Composition-based stats.
 Identities = 22/159 (13%), Positives = 43/159 (27%), Gaps = 23/159 (14%)

Query: 375 KRYAEADQRLSKAIE-----------CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLV 423
           ++  E  + L   +                 +   D    L+  N  + +  G   + LV
Sbjct: 370 RQTREQTESLRATLYERERQQQQQALDAHAIVSATDAAGTLIYVNDRFCEISGYSRNELV 429

Query: 424 PGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTD 483
            G    I++ ++  P       +            +  + W         DG    V T 
Sbjct: 430 -GQNHRIVKSSEHLPEFYLDMWNT----------IVCGNIWRGEVCNRRKDGRLYWVETS 478

Query: 484 ITL-LKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
           I   L +     +    R   +    +  R  L  +  E
Sbjct: 479 IVPFLDNTGRPYQYVSIRTDISRIKKAELRLRLLERAVE 517


>gi|303248431|ref|ZP_07334690.1| multi-sensor hybrid histidine kinase [Desulfovibrio fructosovorans
           JJ]
 gi|302490142|gb|EFL50061.1| multi-sensor hybrid histidine kinase [Desulfovibrio fructosovorans
           JJ]
          Length = 1117

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 133/683 (19%), Positives = 260/683 (38%), Gaps = 53/683 (7%)

Query: 96  IFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSHYIG 152
                 ++   A  ++    +GQ   + R L E+    I+       V   +       G
Sbjct: 321 ALLRRTVRRQTARLEELLEAVGQSERRYRELVENAACLIVRLDLLGRVVFCNAWGQRVFG 380

Query: 153 KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
             +  ++     +   +     SE+         +    P  + ++   +       +W 
Sbjct: 381 LPLERMLGRDIDALGGAPGSDASESW---GAILAVLAEAPDGARTLDRRHIGENGRAIW- 436

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
                 +           F+      +  + K+ +  L  +       +     G+W+++
Sbjct: 437 -ITWSVIALRDPKGLPTEFLCVG--NEITQRKQAEKALAASEARYALVVRASNDGIWDWD 493

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC-EIARSVTGKHVKQLDQI 331
                 + S    EI+G+  +  + +     + IH D+ +      R             
Sbjct: 494 LRTDAVYFSPRYLEILGLAPDALSPTVTEWNQRIHPDDVEAVLRENRRCATGETDSFVVE 553

Query: 332 FHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           + MRHA G+  WI  R    +   G +  + G   D+T +   E    E+  +L+K    
Sbjct: 554 YRMRHADGSYRWIVGRGANSKDEKGQVVRMAGSHTDITRRKRDETALRESQDQLAKIFRL 613

Query: 391 TSEALVL-WDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
           +   L +   ++ R+V  N N  + +G     ++   +  +       P       D   
Sbjct: 614 SPVGLCVSAQRDSRVVDINENGARMFGYEKAAVIGRESLHLGVWP--HPEDRRALVD--- 668

Query: 450 SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
                 E+    S   +  E    +G T+ V      ++        S            
Sbjct: 669 ------ELVAKGSIVGKELELLHQNGSTVVVLYSAVPIQAYGETCLLSVLV--------- 713

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
                     TE        +  KE AE AN+ K+EFL+ MSHE+RTP+N ILG ++ + 
Sbjct: 714 --------DITERKAIERSLRRAKEAAEAANRAKTEFLSTMSHEIRTPMNTILGMAQALS 765

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
                     K  +  + I  +G  LL ++N+IL++S+IE+  + I+++  D+  +    
Sbjct: 766 AADLPP----KQTQAIRAIEIAGGSLLTLLNDILDLSQIESGGLIIEEKPCDIGKLAGRI 821

Query: 630 IRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
           + ++   A +K+I +   +  +L    +     I+++L  +L N++KFT+  G +++   
Sbjct: 822 VDMMRPDAAAKDIALRLDLAEDLPPSVSLSPDRIRQVLVNLLGNAVKFTHQ-GSIVLAVG 880

Query: 688 KI-----GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
           +      G  + + + DTGIGIP   L  I   F        +  GG GLGLAIS  L +
Sbjct: 881 REAGPTGGDWLRLDVRDTGIGIPVDKLPVIFDRFTQADATTSRLYGGVGLGLAISKKLVD 940

Query: 743 LHGGRLKIISQEGKGTIVTICMP 765
           L GG +++ +  G+G+  T+ +P
Sbjct: 941 LMGGSIRVETAVGQGSTFTVRLP 963


>gi|186683715|ref|YP_001866911.1| multi-sensor hybrid histidine kinase [Nostoc punctiforme PCC 73102]
 gi|186466167|gb|ACC81968.1| multi-sensor hybrid histidine kinase [Nostoc punctiforme PCC 73102]
          Length = 1504

 Score =  438 bits (1127), Expect = e-120,   Method: Composition-based stats.
 Identities = 135/668 (20%), Positives = 272/668 (40%), Gaps = 40/668 (5%)

Query: 104  FDLASQKKAESMLG---QLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
             D+  +++ E  L    +   +    S   I +   +  +   +T        +I ++  
Sbjct: 717  RDITVRQQTEEALRRSEEFKNRILDSSSDCIKVLSLDGRLLYMNTGGLCL--MEIDDLNS 774

Query: 161  ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
             L+       +    + +        L+                V     W E V   ++
Sbjct: 775  YLNTEWLCFWSGSYRQQAEQ-----ALAATKAGEISIFSGYCPTVKSTPKWWEVVVSPIL 829

Query: 221  FFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHL 280
              S     +L I     R     K+ + +L ++   ++ A    R GLW+++      H+
Sbjct: 830  DASGQLERILLIS----RDITDRKKTELLLQQSEARLKLAYKATRSGLWDWDIIRNSAHI 885

Query: 281  SRSMYEIMGIPYENKTLSFRAIARLIHYDNK-KICEIARSVTGKHVKQLDQIFHMRHASG 339
            S     + G     K++++      +H D++    E       +  +  +  F + H  G
Sbjct: 886  SEEYCHLFGFDPTTKSITYENWLSCLHPDDRTSTNETVNRTIQQQQEGYEDDFRILHPDG 945

Query: 340  ADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
               W+  + Q+        + ++G   D+TE+  +E+   ++++R     E   + +   
Sbjct: 946  -IRWLAAKGQVFYDTVGNAVRMLGNVQDITERKQVEEELRQSEERYRCLAELIPQLVWTA 1004

Query: 399  DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK 458
            +   RL+  N  + +  GL          R ++       +++  +   ++      E +
Sbjct: 1005 NPEGRLLDVNQRWLEFTGLTLEQAHTSGWREVVHPEDVLILVKEWSKAVQQGTSYQAEGR 1064

Query: 459  LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
            +              DG          L +    + R+ +            +++ LE +
Sbjct: 1065 M-----------RRADGVYRW-----HLHQAIPQKDRQGEIVKWFGSATDIEAQKQLEVE 1108

Query: 519  KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
            +  L       Q  +  AE AN+ K EFLA +SHELR+PLN ILG++++++   F E   
Sbjct: 1109 RDRLFQLE---QAARAEAERANRIKDEFLAILSHELRSPLNPILGWTKMLQSRKFNET-- 1163

Query: 579  VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
             K  +    I  + +    +I+++L+++KI   K+S+D    +L+ +I   I  + ++A 
Sbjct: 1164 -KTAQALASIERNVKLQTQLIDDLLDIAKILRGKLSLDVTPVNLLFVIESAIDTVNTAAI 1222

Query: 639  SKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIA 698
            +K+I++   +P+    + D   +++I++ +LSN+IKFT   G++ IR  ++ +   I ++
Sbjct: 1223 AKSIQLHPVLPNIGQVSGDSNRLQQIVWNLLSNAIKFTPKGGRVEIRLERVDEQAHIIVS 1282

Query: 699  DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ-EGKG 757
            DTG GI    L  I + F        +  GG GLGLAI   L   HGG +   S  EG G
Sbjct: 1283 DTGKGINPEFLPHIFESFRQEDVSITRKYGGLGLGLAIVRQLVEAHGGTITADSPGEGLG 1342

Query: 758  TIVTICMP 765
               T+ +P
Sbjct: 1343 ATFTVQLP 1350



 Score =  190 bits (484), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 44/243 (18%), Positives = 91/243 (37%), Gaps = 7/243 (2%)

Query: 239 QAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLS 298
           + K+ ++ +  L ++   +  ALS  R G WN+N    K   S ++  + G+       S
Sbjct: 329 ELKERQQVEAELCQSEEHLRLALSASRMGTWNWNIQTGKITWSDNLEALFGLQPGEFDGS 388

Query: 299 FRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG- 357
           F   A  +H +++       +      ++ D  F + + +G   W   + ++     G  
Sbjct: 389 FEMFAARVHPEDRDRVLATVNRAVATGEEYDIEFRVVYPNGTIRWALSQGKVFYDQHGQP 448

Query: 358 MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWD-KNDRLVMCNANYQKAYG 416
           M + GI +D+TE+    +   E+++R  +  E       + +   +R+   +  Y++ +G
Sbjct: 449 MQMAGIDIDVTERKRSAEALRESEERFRQLAENIDAVFWIREVSENRVSYVSPAYERLWG 508

Query: 417 LPDHVLVPGN--ARSIIQDAQTRPIIEYRT-SDPERSQDMSKEIKLADS--RWLQINEWC 471
           L    L  G       I         +           D    + L D   RW+    + 
Sbjct: 509 LNSEELYQGQQSWIDRIHPEDREATQKAFHEKAVAGKFDEEYRVILPDGSIRWVHDRCFG 568

Query: 472 THD 474
             D
Sbjct: 569 LRD 571



 Score = 93.1 bits (230), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 44/420 (10%), Positives = 108/420 (25%), Gaps = 51/420 (12%)

Query: 98  QNNNIKFDLASQKKAESMLGQLLAKTRFLSE--SFILLAQP--NELVFASSTKNSHYIGK 153
           Q   I  D+  +K++   L +   + R L+E    +   +      V   S       G 
Sbjct: 450 QMAGIDIDVTERKRSAEALRESEERFRQLAENIDAVFWIREVSENRVSYVSPAYERLWGL 509

Query: 154 KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
              E+           +       +  +                  +I     +    R 
Sbjct: 510 NSEELYQGQQS--WIDRIHPEDREATQK--AFHEKAVAGKFDEEYRVILPDGSI----RW 561

Query: 214 EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRC--GLW-- 269
                         +  F   +        K +   L E+     T++       G++  
Sbjct: 562 VHDRCFGLRDKTGEIYRFAGIAE--DISARKHSLAALQESEERFRTSVENMLDCFGVYRA 619

Query: 270 -------NFNFDNKKFHLSRSMY---EIMGIPYENKTLSFRAIARLIHY---DNKKICEI 316
                    +F  +  +++ +     ++     +        +    H    D+      
Sbjct: 620 VRNEQGQIVDFVTE--YVNDAACLNNQMT-YEQQIGRGLCELLPSHRHSGLFDDYCQVVE 676

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
                 K     +  +      G      V+A  +R    G   +    D+T +   E+ 
Sbjct: 677 TGQALIKDSLVYEDEY------GEQR--LVKAFDIRVAKFGDGFVATWRDITVRQQTEEA 728

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
              +++  ++ ++ +S+ + +   + RL+  N        + D                 
Sbjct: 729 LRRSEEFKNRILDSSSDCIKVLSLDGRLLYMNTGGLCLMEIDDLNSYLNTEWLCFWSGSY 788

Query: 437 RPIIEYRTSDPERSQDMSKEIKLA----DSRWLQINEWCTHDGG-----TISVGTDITLL 487
           R   E   +  +  +               +W ++      D        + +  DIT  
Sbjct: 789 RQQAEQALAATKAGEISIFSGYCPTVKSTPKWWEVVVSPILDASGQLERILLISRDITDR 848


>gi|117925672|ref|YP_866289.1| PAS/PAC sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117609428|gb|ABK44883.1| PAS/PAC sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 1177

 Score =  438 bits (1127), Expect = e-120,   Method: Composition-based stats.
 Identities = 128/716 (17%), Positives = 260/716 (36%), Gaps = 63/716 (8%)

Query: 60   LVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQL 119
            LV    + + ++   + +      Q     +E   +  +   +   +  ++K    L   
Sbjct: 351  LVSPLHTLLHEIQQFHQEGRIPPRQIRYGASEFRTLTLEFRTLAHSIIEREKRLRTL--- 407

Query: 120  LAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQM----- 174
             +     +   +L++     +   +       G    E++ +                  
Sbjct: 408  -STGLEQAPISVLISDTQGNIEYVNPYFEQLTGYYSHEVLGKNPNLLKSDLNPPELFRDL 466

Query: 175  SEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILF 234
                    P+    +N   N      +    P+L    +                     
Sbjct: 467  WRTISAGAPWRGEFINRKKNGALHWQMAHIAPVLDNDGQITH----------------FI 510

Query: 235  SYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYEN 294
            +   +    K+ D  L E+N    T       G++  + D +  +++ +   I G     
Sbjct: 511  ALSEEITARKQADAALNESNERFRTLAQVSPVGIFQTDHDGEYIYVNTTWESITGTTSPQ 570

Query: 295  KTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTI 354
               S       +H D++   +     T  H     + +      G   W+   A   R  
Sbjct: 571  ALSS--QWDIHLHPDDQPRVQQRWQETVLHGNAFHEEYRFLRGDGTIRWVIGSAAPQRDP 628

Query: 355  SGGMN-IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQK 413
               +   +G   D+TE+  +E    +    L   I+   + +     +   + CN  ++ 
Sbjct: 629  DRVIQGFVGTLTDITERKQMELELGKERALLRSLIDSIPDLIFYKRADGTYMGCNRAFEL 688

Query: 414  AYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTH 473
                P+  L+    +++      + +           +   + +   +S +         
Sbjct: 689  FCKRPEAALIGHTDQALFSPELAQLL-----------KSGDELVINKNSCFSHEATGLFG 737

Query: 474  DGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEK 533
            DG  +      + +                           + R  T+      + Q  K
Sbjct: 738  DGHQVPFLIQKSPMHG---------------YQGELLGLIGVARDITQRLRVEQELQQAK 782

Query: 534  ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQ 593
            E AE AN++KSEFLA MSHE+RTP+N ++G  E++ +       + +   Y   + ++G 
Sbjct: 783  EDAEAANRSKSEFLAAMSHEIRTPMNVVIGMGEILLETPL----NAEQTRYINSMQHAGD 838

Query: 594  HLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL- 652
             LL +I+NIL++SKIE  +++++++   L  ++          A + N+ +  +I  EL 
Sbjct: 839  ALLELIDNILDLSKIEAGRMTLEERAFRLDTMVISITDFFRLQALNHNLSLVVEIAPELE 898

Query: 653  --FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI-GQCVIITIADTGIGIPKSAL 709
              +   D   ++++L+ +L N++KFT   G + +  S    Q +   ++DTGIGI    L
Sbjct: 899  QQYVLGDAGRVRQVLYNLLGNALKFTEEGG-VSLHLSLDANQHIHTRVSDTGIGIAPQQL 957

Query: 710  EKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            E+I   F    +   +  GG GLGLAI    T L GGR+ + S EG+G+   + +P
Sbjct: 958  ERIFDNFTQEDSSVTRRFGGTGLGLAICRRFTELMGGRIWVESIEGQGSTFHMTLP 1013


>gi|186684333|ref|YP_001867529.1| PAS/PAC sensor hybrid histidine kinase [Nostoc punctiforme PCC
           73102]
 gi|186466785|gb|ACC82586.1| PAS/PAC sensor hybrid histidine kinase [Nostoc punctiforme PCC
           73102]
          Length = 1105

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 135/747 (18%), Positives = 281/747 (37%), Gaps = 63/747 (8%)

Query: 38  ISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIF 97
           ++ L ++F  FN   P   + F   I    +      +   + + ++T     + +  I 
Sbjct: 255 LARLPTYFERFNSAHPGEVLSFEYRIR--HVNGEWRWFCSYDTVHSRTVEGFPKYLLGIA 312

Query: 98  QNNNIKFDLASQKKAESMLGQLLAKTRFLSESF-ILLAQPN--ELVFASSTKNSHYIGKK 154
                  D+  ++  E  L Q   +    + +   L+            +   +  +G  
Sbjct: 313 F------DITERRHIEISLRQSNERFELAAAAVNCLIYDWEIHRSSVERTQGLTQVLGYT 366

Query: 155 IGEIIPE-------LSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPL 207
             E  P        +     +    Q   +  +   Y +       +   + + +    +
Sbjct: 367 QQEAEPTFEWWQQLIHPDDQQRVNNQFMASMANGNRYSIEYRIRHKDGRYVWVQDQGFAV 426

Query: 208 LRLWREEVTLEVVFFSIISA-LLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRC 266
                + V +      I     +L    +  R     ++ +T L E+   +  A S    
Sbjct: 427 RDTNGQVVRVVGASADITEQQAILREQQAALRD---RQQIETNLRESEERIRLATSAAEL 483

Query: 267 GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK 326
           G+W +N    +   +    E+ G+      +S+      IH ++++    A +   +   
Sbjct: 484 GMWFWNITTNELVWTEKCKELFGLGP-EVEMSYELFLNCIHPEDRQRLNEAIARCFQEKV 542

Query: 327 QLDQIFHMRHASGADIWIQVRAQMMRT-ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLS 385
           + D  +    + G+  WI  + ++          ++G A D+T +  +E    + + +L 
Sbjct: 543 EYDIEYRSLWSDGSIHWIAAKGRVFYEADDQPGRMMGTAQDITGRKQIENDLRQRETQLR 602

Query: 386 KAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS-IIQDAQTRPIIEYRT 444
           + ++     ++    +  +   N  + +  G     L+ G  R   +   +   + E   
Sbjct: 603 RLVDSNIIGIMFATPD-HITEANEAFLEMVGYTREELLAGKVRRKQMTPPEYHALDEQGI 661

Query: 445 SDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKAT 504
                                   E+   DG  I +     L++ +              
Sbjct: 662 EQLLTVGV----------CNPFEKEYIRKDGSRIPILIGGALVEKDPPSW---------- 701

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
                          T         + + E  + AN+ K EFLA +SHELR+PLN ILG+
Sbjct: 702 --------ICFILDLTPRKQLEQTLRQQTEELKQANQNKDEFLAILSHELRSPLNPILGW 753

Query: 565 SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIP 624
           S ++K   F E  + +     + I  + Q  + +I+ +L++S+I   K+++     +L  
Sbjct: 754 SSLLKSRKFDEATTNRA---LETIERNTQLQIKLIDELLDVSRIIRGKLNLTFATVNLAS 810

Query: 625 IINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMM 683
           +I+  +  +   A+SK+I+I+ ++   +   + D   +++++  +LSN++KFT  NG + 
Sbjct: 811 VIDAALETVRLIAESKSIQIKIQLDPNVGKVSGDYYRLQQVVGNLLSNAVKFTPPNGSVE 870

Query: 684 IRTSKIGQ----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDA 739
           +  S  G+      +I + DTG GI    L  + + F    +   +  GG GLGLAI   
Sbjct: 871 VSLSSSGELASHSALIQVKDTGQGISPEFLPHVFEYFRQADSSRTRKFGGLGLGLAIVRN 930

Query: 740 LTNLHGGRLKIISQ-EGKGTIVTICMP 765
           L  LHGG +   S  EG+G I T+ +P
Sbjct: 931 LVELHGGTVTAASPGEGQGAIFTVRLP 957



 Score =  173 bits (439), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 70/583 (12%), Positives = 178/583 (30%), Gaps = 51/583 (8%)

Query: 41  LFSFFSSFNQTI--PMISMVFLVFIATSSIIKVTTRYA-QQEKMTNQTSLMLTEAIEIIF 97
           L S    F   +  P   +   + I      ++  +    ++    +    L    + I 
Sbjct: 119 LLSSQPLFQGGVDTPFAIVTTFLDITEFKQAQLEEKGNCTEDTQQVEEESWLQPEAKSIV 178

Query: 98  QNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQP-NELVFASSTKNSHYIGKKIG 156
              ++  D+   ++              L    + +     +     + + +   G    
Sbjct: 179 PLASVI-DVNGSQQLWDSQRLFQQIAGTLPG-ILYIYDLIEQRNSYVNDEIAQGWGYTPA 236

Query: 157 EI--IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREE 214
           EI  + +   ++            L + P +    N  H    +        +   WR  
Sbjct: 237 EIQAMGKDLFTQLLHPED------LARLPTYFERFNSAHPGEVLSFEYRIRHVNGEWRWF 290

Query: 215 VTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFD 274
            + +    S         L        + +  +  L ++N   E A +   C ++++   
Sbjct: 291 CSYD-TVHSRTVEGFPKYLLGIAFDITERRHIEISLRQSNERFELAAAAVNCLIYDWEIH 349

Query: 275 NKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM 334
                 ++ + +++G   +    +F    +LIH D+++        +  +  +    + +
Sbjct: 350 RSSVERTQGLTQVLGYTQQEAEPTFEWWQQLIHPDDQQRVNNQFMASMANGNRYSIEYRI 409

Query: 335 RHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTE--------------KYHLEKRYAE 379
           RH  G  +W+Q +   +R  +G  + ++G + D+TE              +  +E    E
Sbjct: 410 RHKDGRYVWVQDQGFAVRDTNGQVVRVVGASADITEQQAILREQQAALRDRQQIETNLRE 469

Query: 380 ADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPI 439
           +++R+  A       +  W+     ++     ++ +GL   V +           + R  
Sbjct: 470 SEERIRLATSAAELGMWFWNITTNELVWTEKCKELFGLGPEVEMSYELFLNCIHPEDRQR 529

Query: 440 IEYRTS---DPERSQDMSKEIKLADSRWLQINEWCT-------HDGGTISVGTDITLLKH 489
           +    +     +   D+      +D     I              G  +    DIT  K 
Sbjct: 530 LNEAIARCFQEKVEYDIEYRSLWSDGSIHWIAAKGRVFYEADDQPGRMMGTAQDITGRKQ 589

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE----KERAETANKTKSE 545
            +  LR+ + +L+  ++       I+      ++ AN  +       +E        + +
Sbjct: 590 IENDLRQRETQLRRLVDSNIIG--IMFATPDHITEANEAFLEMVGYTREELLAGKVRRKQ 647

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
                 H L        G  +++   +          +    I
Sbjct: 648 MTPPEYHALDE-----QGIEQLLTVGVCNPFEKEYIRKDGSRI 685



 Score = 49.6 bits (117), Expect = 0.002,   Method: Composition-based stats.
 Identities = 42/322 (13%), Positives = 88/322 (27%), Gaps = 38/322 (11%)

Query: 280 LSRSMYEIMGIPYENKTLS--FRAIARLIHYDNKKI---CEIARSVTGKHVKQLDQIFHM 334
            + +   I+G+  E         +  + +H D   +      A +        L+ +   
Sbjct: 49  CNATCDRILGLTTEQLVGQNLLDSKWQFLHEDGSPLPNETHPAIAAQKTGKPCLNVVCGF 108

Query: 335 RHASGADIWIQVRAQMMRTI--SGGMNIIGIAMDLTEKYHLEKRYA----------EADQ 382
              +G  +W+ + +Q +          I+   +D+TE    +              E + 
Sbjct: 109 YKPNGQLVWLLLSSQPLFQGGVDTPFAIVTTFLDITEFKQAQLEEKGNCTEDTQQVEEES 168

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNAN--YQKAYGLPDHVLVPGNAR---------SII 431
            L    +       + D N    + ++   +Q+  G    +L   +            I 
Sbjct: 169 WLQPEAKSIVPLASVIDVNGSQQLWDSQRLFQQIAGTLPGILYIYDLIEQRNSYVNDEIA 228

Query: 432 QDAQTRPIIEYRTSDPERSQDMSKE--IKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
           Q     P           +Q +  E   +L        +      G  +S    I  +  
Sbjct: 229 QGWGYTPAEIQAMGKDLFTQLLHPEDLARLPTYFERFNSAHP---GEVLSFEYRIRHVNG 285

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
                         T+         +    TE        +   ER E A    +  +  
Sbjct: 286 EWRWFCSYDTVHSRTVEGFPKYLLGIAFDITERRHIEISLRQSNERFELAAAAVNCLIYD 345

Query: 550 -----MSHELRTPLNAILGFSE 566
                 S E    L  +LG+++
Sbjct: 346 WEIHRSSVERTQGLTQVLGYTQ 367


>gi|220907215|ref|YP_002482526.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219863826|gb|ACL44165.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 1501

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 130/680 (19%), Positives = 268/680 (39%), Gaps = 46/680 (6%)

Query: 102  IKFDLASQKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
            +  D+   K+ E +L Q   + R     ++        N      S  +   +G +    
Sbjct: 704  VATDVTEYKRTELLLRQSEERLRLAMAAAQMATWDVDLNTGKAFWSEHHFTMLGYEPVAG 763

Query: 159  IPEL--------SRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRL 210
                                     +A LD+  Y      +  ++G I  +         
Sbjct: 764  GEASEAMWSSCIHPEDLERVLQAWQQARLDRTLYRAEYRVIRVDNGQIAWLMGLGSFTYD 823

Query: 211  WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
               +    +     IS     +        ++ K  +  L E+   ++ A   GR G W+
Sbjct: 824  ETGQAIRSIGVLLDISEQQAAL--------QERKRVEDELRESEQRLQLAQQAGRIGTWD 875

Query: 271  FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ 330
            +N    +   S  ++ ++ +  ++           IH ++++       +          
Sbjct: 876  WNLLTNEVSWSDGIWPLLALEPKSVKPDLETFTHFIHPEDREQAFRTVKLALAEGDDYYD 935

Query: 331  IFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
             F +    GA  W+  + +++RT  G    ++GI +D+T++   E+   ++++RL  A+ 
Sbjct: 936  EFRVIRQDGAICWLLSKGRVIRTPEGQPQRLLGINVDITDRKQAEEALRQSEERLRLALL 995

Query: 390  CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGN--ARSIIQDAQTRPIIEYRTSDP 447
             +   +  WD  ++ +  +    + +GL             ++I       +        
Sbjct: 996  VSQSGIWDWDIVNKQITWSERIYQFHGLTPDTFGGTVAEFAALIHPEDRERVAAAIQRAL 1055

Query: 448  ERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIND 507
                    E +                G    + T   ++   Q Q            + 
Sbjct: 1056 AGESSYELEFRAVQ-----------PSGAIRWLSTTGGVIFDQQGQPVRMLGATNDITD- 1103

Query: 508  LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
                R+ +E    E        +  +E AE+AN+ K EFLA +SHELR+PLN ILG++++
Sbjct: 1104 ----RKAIE---AERERLLLSERRCREAAESANRIKDEFLAVLSHELRSPLNPILGWTKL 1156

Query: 568  IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
            ++   F      +  +  Q I  + +    +I ++L++S+I   K+ ++    +LI  I 
Sbjct: 1157 LQTRPFDP---QRTQQALQTIERNAKLQTQLIEDLLDISRILQGKMVLNTSPVNLITTIE 1213

Query: 628  EGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
              +  +  +A++K I+++  +   +     D   +++I++ +L+N++KFT   GK++IR 
Sbjct: 1214 AALDTVRLAAETKGIELQTCLSPAVGRVYGDSTRLQQIVWNLLTNAVKFTPAGGKVLIRL 1273

Query: 687  SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
             ++     I + DTG GI  + L  + + F    +Q  +  GG GLGLAI   LT  HGG
Sbjct: 1274 EQVDSFAQIQVQDTGKGISPAFLPHVFEYFRQEDSQTTRKFGGLGLGLAIVRYLTEQHGG 1333

Query: 747  RLKIISQ-EGKGTIVTICMP 765
             +++ S+ E +G   T+ +P
Sbjct: 1334 TVEVESRGEDQGASFTVHLP 1353



 Score =  186 bits (472), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 69/485 (14%), Positives = 144/485 (29%), Gaps = 34/485 (7%)

Query: 102  IKFDLASQKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
               D+  +K+AE+ L Q   + R L   +   I+    N      +      IG    ++
Sbjct: 577  STTDITDRKRAEAQLQQQEQEFRTLVENTPDVIIRYDRNLRYLYINPSIERIIGIPPEQL 636

Query: 159  IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
            I +                    Q ++     + +      +                  
Sbjct: 637  IGKTGIELGLIDPTS--------QAWYRTLEQVFNTGQHHWLEFEFPNPEGELHAYQARF 688

Query: 219  VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
            V        +   +  +      + K  + +L ++   +  A++  +   W+ + +  K 
Sbjct: 689  VPELVEGEQITTVLAVA--TDVTEYKRTELLLRQSEERLRLAMAAAQMATWDVDLNTGKA 746

Query: 279  HLSRSMYEIMGIPY-ENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
              S   + ++G         S    +  IH ++ +    A              + +   
Sbjct: 747  FWSEHHFTMLGYEPVAGGEASEAMWSSCIHPEDLERVLQAWQQARLDRTLYRAEYRVIRV 806

Query: 338  S-GADIWIQVRAQMMRTISGG-MNIIGIAMDLT-------EKYHLEKRYAEADQRLSKAI 388
              G   W+          +G  +  IG+ +D++       E+  +E    E++QRL  A 
Sbjct: 807  DNGQIAWLMGLGSFTYDETGQAIRSIGVLLDISEQQAALQERKRVEDELRESEQRLQLAQ 866

Query: 389  ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG--NARSIIQDAQTRPIIEYRTSD 446
            +        W+     V  +        L    + P        I               
Sbjct: 867  QAGRIGTWDWNLLTNEVSWSDGIWPLLALEPKSVKPDLETFTHFIHPEDREQAFRTVKLA 926

Query: 447  PERSQDM--SKEIKLADS--RWLQINEW--CTHDG---GTISVGTDITLLKHNQAQLRES 497
                 D      +   D    WL        T +G     + +  DIT  K  +  LR+S
Sbjct: 927  LAEGDDYYDEFRVIRQDGAICWLLSKGRVIRTPEGQPQRLLGINVDITDRKQAEEALRQS 986

Query: 498  KRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTP 557
            + RL+  +    +     +    +++ +   YQ      +T   T +EF A +  E R  
Sbjct: 987  EERLRLALLVSQSGIWDWDIVNKQITWSERIYQFHGLTPDTFGGTVAEFAALIHPEDRER 1046

Query: 558  LNAIL 562
            + A +
Sbjct: 1047 VAAAI 1051



 Score =  167 bits (422), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 47/389 (12%), Positives = 131/389 (33%), Gaps = 21/389 (5%)

Query: 88  MLTEAIEIIFQNNNIKFDLASQKKAESMLGQL---LAKTRFLSESFILLAQP-NELVFAS 143
            +T A+ +    +  K   A +++A   L +    + +    +   + +     +     
Sbjct: 294 QITSAVTVFQDISERKQLEAERQQALIQLQERQHFIQQVADATPGTLYVYDMVAQRNIYV 353

Query: 144 STKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINS 203
           + +    +G    +I     +  ++    +      +Q      +           + ++
Sbjct: 354 NRQIGELLGYTPADIQAYDDQLFAQLIHPEDLATIGNQYTRLNQAQADEVIDYEYRMRHA 413

Query: 204 RVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA-------NIC 256
                  WR   +      +     L  ++    +     K+ +  L +        N  
Sbjct: 414 N----GEWRWLWSRN-TVSTRTPEGLAHLVVGTVQDITDRKQAELALQQTQVHLQRANER 468

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
            E A     C +++++ +  +   +     ++G   E    +     + IH ++ +    
Sbjct: 469 FELAAKAVNCLIYDWDVEQDRVERTEGFTRLLGYSLEEAEPTGAWWRQQIHPEDVQRLSA 528

Query: 317 -ARSVTGKHVKQLDQIFHMRHASGADIWIQVRA-QMMRTISG-GMNIIGIAMDLTEKYHL 373
            A S    +  Q+   + +R      I++  +A  + R   G    ++G   D+T++   
Sbjct: 529 TAISNLLNNDLQI-CEYRVRTKDNRYIYVLDQALVVCRDAKGYPTRMVGSTTDITDRKRA 587

Query: 374 EKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI-IQ 432
           E +  + +Q     +E T + ++ +D+N R +  N + ++  G+P   L+      + + 
Sbjct: 588 EAQLQQQEQEFRTLVENTPDVIIRYDRNLRYLYINPSIERIIGIPPEQLIGKTGIELGLI 647

Query: 433 DAQTRPIIEYRTSDPERSQDMSKEIKLAD 461
           D  ++             Q    E +  +
Sbjct: 648 DPTSQAWYRTLEQVFNTGQHHWLEFEFPN 676



 Score =  164 bits (414), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 45/308 (14%), Positives = 104/308 (33%), Gaps = 14/308 (4%)

Query: 91   EAIEIIFQNNNIKFDLASQKKAESMLGQLLAKT-RFLSESFILLAQPNELVFASSTKNSH 149
             +I ++   +  +  L  +K+ E  L +   +         I     N     ++  +  
Sbjct: 830  RSIGVLLDISEQQAALQERKRVEDELRESEQRLQLAQQAGRIGTWDWN---LLTNEVSWS 886

Query: 150  YIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLR 209
                 +  + P+  +    + T         +Q +  + + L                  
Sbjct: 887  DGIWPLLALEPKSVKPDLETFT-HFIHPEDREQAFRTVKLALAEGDDYYDEFRVIRQDGA 945

Query: 210  L-WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
            + W       +         LL I           K+ +  L ++   +  AL   + G+
Sbjct: 946  ICWLLSKGRVIRTPEGQPQRLLGI----NVDITDRKQAEEALRQSEERLRLALLVSQSGI 1001

Query: 269  WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
            W+++  NK+   S  +Y+  G+  +    +    A LIH ++++    A           
Sbjct: 1002 WDWDIVNKQITWSERIYQFHGLTPDTFGGTVAEFAALIHPEDRERVAAAIQRALAGESSY 1061

Query: 329  DQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLE---KRYAEADQRL 384
            +  F     SGA  W+     ++    G    ++G   D+T++  +E   +R   +++R 
Sbjct: 1062 ELEFRAVQPSGAIRWLSTTGGVIFDQQGQPVRMLGATNDITDRKAIEAERERLLLSERRC 1121

Query: 385  SKAIECTS 392
             +A E  +
Sbjct: 1122 REAAESAN 1129



 Score = 88.1 bits (217), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 67/519 (12%), Positives = 156/519 (30%), Gaps = 45/519 (8%)

Query: 115 MLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELS----RSRSRSK 170
            L   L+     +   +L+   +      +   ++        +IP          +  +
Sbjct: 40  SLQTSLSILLNTACPMVLVWGRD-RYLFFNDGYANLGLNSGPTLIPGQPLHNCSQPNGGE 98

Query: 171 TVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLL 230
            +   E            +     SG  L +    PL    +           +      
Sbjct: 99  LLTAIEQVFTTAQPQQQVLASQGMSGEQLWLWCFSPLWDGGQVGGVFATGCAELNPIAGT 158

Query: 231 FILFSYYRQA-KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHL-SRSMYEI- 287
             L +  RQ   + +     LL      E  L +   G+   +       L +    ++ 
Sbjct: 159 TKLEAECRQVETERQHLSEALLSEKARFEAVLRQLPEGVMIADAATGNLILTNERADQLM 218

Query: 288 -------MGIPYENKTLSFRAIA---RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
                    +      + F+A     +    ++  +    R   G+ +   +       A
Sbjct: 219 RHSYALDFQLEAYESWVPFQAYRTNGQRYAPEDYPLVRSLRQ--GEIIAHEEMELRF--A 274

Query: 338 SGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEK-------RYAEADQRLSKAIE 389
            G+ I+I V A  +    G + + + +  D++E+  LE        +  E    + +  +
Sbjct: 275 DGSQIFIDVNAAPILDYQGQITSAVTVFQDISERKQLEAERQQALIQLQERQHFIQQVAD 334

Query: 390 CTSEALVLWD-KNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
            T   L ++D    R +  N    +  G     +   +    +      P       +  
Sbjct: 335 ATPGTLYVYDMVAQRNIYVNRQIGELLGYTPADIQAYD--DQLFAQLIHPEDLATIGNQY 392

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
              + ++    AD            +G    + +  T+       L          I D 
Sbjct: 393 TRLNQAQ----ADEVIDYEYRMRHANGEWRWLWSRNTVSTRTPEGLAHLVVGTVQDITDR 448

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEF-LAKMSHELRTPLNAILGFSEV 567
             +   L++ +  L  AN ++++    A+  N    ++ + +   E       +LG+S  
Sbjct: 449 KQAELALQQTQVHLQRANERFELA---AKAVNCLIYDWDVEQDRVERTEGFTRLLGYS-- 503

Query: 568 IKKEIFGELGSVKYYEYAQDIHY-SGQHLLNMINNILEM 605
             +E        +   + +D+   S   + N++NN L++
Sbjct: 504 -LEEAEPTGAWWRQQIHPEDVQRLSATAISNLLNNDLQI 541


>gi|115523225|ref|YP_780136.1| multi-sensor hybrid histidine kinase [Rhodopseudomonas palustris
           BisA53]
 gi|115517172|gb|ABJ05156.1| multi-sensor hybrid histidine kinase [Rhodopseudomonas palustris
           BisA53]
          Length = 1039

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 168/678 (24%), Positives = 292/678 (43%), Gaps = 42/678 (6%)

Query: 114 SMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQ 173
             L            S I L + +  + A   +    IG+++ +        R   +   
Sbjct: 205 KSLEDFYQSIDLGEGSTIALIRRDGALLARYPRTDTMIGRRLTD-PEPGKMERDLKEGAV 263

Query: 174 MSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFIL 233
           +S  +LD +  +V    +     ++    ++  +L  WR + T+E        A +L +L
Sbjct: 264 VSRLALDGEHRYVAYRPVKDFPLTVSTTLTQDVVLASWRGDATIEAFGALGAVAGVLLLL 323

Query: 234 FSYYRQAKKNKENDTILLEANICVE-------TALSRGRCGLWNFNFDNKKFHLSRSMYE 286
               RQ  K + +  +L   N            A   G+ G W  N        S  ++E
Sbjct: 324 SVLTRQIGKGRRSALLLARQNARFARSRQMLLDAQRIGKLGHWMTNAAGDSAVWSPQLFE 383

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           I G+      +S      LIH ++ ++      ++     +L          GA  WI++
Sbjct: 384 IAGLAPR-PGVSLDQFLALIHPEDLQVFLHELELSRSGDTKLIHELRWVRPDGAIRWIRM 442

Query: 347 RAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLV 405
            A   R  +G  + + GI  D+TE+   E     +   L  AIE  S+  VL+DK+DR V
Sbjct: 443 EADRRRDANGDPVGVFGIVQDITERKRAEAAAEASRHLLVDAIESMSQGFVLYDKHDRFV 502

Query: 406 MCNANYQKAYGLPDHVLVPGNARSIIQDAQTR-------------PIIEYRTSDPERSQD 452
           + N+++++ +      + PG     +  A  +                  RT+   R+ +
Sbjct: 503 LANSHFKEMFPELADRMKPGMRYEDVLCAVHQSDLVDAPKAGASFDEWLARTTAWHRAAN 562

Query: 453 MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
              E +  + RW+++ +  T DGG   + TDIT  K  +A L +        + DL  +R
Sbjct: 563 RPIERRYDNGRWIRLVDHRTSDGGIAGLRTDITDFKTIEAALEQ-------KVADLELAR 615

Query: 513 QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
             LE QK EL   +A  ++ KE AE A++ KS+FLA MSHE+RTP++ ++G  +++++  
Sbjct: 616 NNLESQKQELVAKSADLELAKETAEAASRAKSDFLAIMSHEIRTPMSGMVGMIDLLRETP 675

Query: 573 FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
                + +   YA+    S   LL + N+IL+ SK+E  ++  +  + D+   I   I L
Sbjct: 676 L----TAEQKGYAEIAKESVNSLLGVTNDILDFSKLEAGELKAEAIDFDIEHTIGGAISL 731

Query: 633 IGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS--- 687
           + + AQ+K + I   +   L      D   I++IL  +++N+IKFT   G + ++ S   
Sbjct: 732 MKAKAQAKQLDIRTVLTPGLPKWLVGDPSRIRQILLNLINNAIKFT-EQGAISVKASYHS 790

Query: 688 KIGQCV--IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
                +   I I DTGIGIP    +++  PF        +  GG GLGLAI   L  + G
Sbjct: 791 LDDDKIELRIEIVDTGIGIPMEVQQRLFNPFVQADTSISRKYGGTGLGLAICKQLALMMG 850

Query: 746 GRLKIISQEGKGTIVTIC 763
           G + + S    G+     
Sbjct: 851 GEIGVRSGPEPGSTFWFT 868


>gi|224372027|ref|YP_002606192.1| predicted sensory/regulatory protein RpfC [Desulfobacterium
            autotrophicum HRM2]
 gi|223694746|gb|ACN18028.1| predicted sensory/regulatory protein RpfC [Desulfobacterium
            autotrophicum HRM2]
          Length = 1316

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 132/673 (19%), Positives = 236/673 (35%), Gaps = 42/673 (6%)

Query: 102  IKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPE 161
            +  D+   ++ E +  +    +  L    I       L    +       G    E I +
Sbjct: 369  VTKDVTKIRETEELFSKAFHASASLMG--ISEID-GGLFIDVNRAFVETSGYTRNEAIGK 425

Query: 162  LSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVF 221
             S               +         +     +    I + +  L    R +V      
Sbjct: 426  TSVELGLFPN-PEDRNRVASMVKESGFIKNMEITIRTKIGDKKFGLFSATRIDVNGN--- 481

Query: 222  FSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLS 281
                       L +        K  +  L E    ++ AL       W+++   KK +L 
Sbjct: 482  ---------PCLLTTLTDITDRKSAEDALRENKERLDLALESASMAPWHWDTMEKKLYLD 532

Query: 282  RSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGAD 341
                 ++G+  E    + +     +H D++     AR  T       +  F +    G+ 
Sbjct: 533  SKACLLLGLDTERSNGTLQDFIDAVHPDDRARLRQARDRTTARGTFYEHEFRVVWPDGST 592

Query: 342  IWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDK 400
             +I    + +   SG M  I G+  D++++   ++ + +  QRL+  I+ T+     W+ 
Sbjct: 593  HYITAHGKPVHNSSGVMTKIHGLIGDISKRKIAQQNFEDERQRLANVIKGTNTGTWEWNV 652

Query: 401  NDRLVMCNANYQKAYGLPDHVLVPG---NARSIIQDAQTRPIIEYRTSDPERSQDMSKEI 457
                 + N  + +  G     L P        +          E                
Sbjct: 653  QTGETVYNKRWAEILGYTLEELEPADVSTWNRLTHPQDLEKSDEMLLKHFTGEIPYYDIQ 712

Query: 458  KLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILER 517
                             G  + V     ++                 IN      Q L  
Sbjct: 713  CR----------MRHKRGHWVWVHDRGQVMTWTADGKPLMMFGTHMDINQAKQVEQELMA 762

Query: 518  QKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELG 577
               +L  A A+       AE AN  K EFLA MSHE+RTP+N I+G + ++         
Sbjct: 763  TNFQLEDAMARANQMATEAELANLAKGEFLANMSHEIRTPMNGIIGMTGLLMDTQL---- 818

Query: 578  SVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSA 637
            + +   YA+ +  SG+ LL +IN IL+ SKIE  K+ ++  + +L    +     +   A
Sbjct: 819  TDEQRRYARIVQASGESLLRIINEILDFSKIEAGKLDLETIDFNLQDFCDYLTPPLAMQA 878

Query: 638  QSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC--- 692
              + I+    +  ++      D   + +IL  +  N++KFT + GK+ I+     +    
Sbjct: 879  HEQGIEFICTLDPDVPLGLRGDSGRLGQILTNLAGNAVKFT-STGKVSIKVKVEHETDKD 937

Query: 693  --VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
              +  ++ DTGIGI +  L  I   F        +  GG GLGLAIS  LT + GGR+ +
Sbjct: 938  VILYFSVKDTGIGIQREKLGMIFNKFTQADESTTREFGGTGLGLAISKQLTEMMGGRMGV 997

Query: 751  ISQEGKGTIVTIC 763
             S +G+G+     
Sbjct: 998  ESIQGEGSNFWFT 1010



 Score =  109 bits (273), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/380 (11%), Positives = 104/380 (27%), Gaps = 44/380 (11%)

Query: 105 DLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPE 161
           D++ +K AE  L +     R      ++F+ +      +  ++      +     E+   
Sbjct: 249 DISDRKSAEERLKKSETNFRSFFNSIDNFLFVLDVKGNILKANETAIRRLEYSEEELNGL 308

Query: 162 ----LSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTL 217
               +     R++  ++    ++          +  +   I +     P     R     
Sbjct: 309 NVAMVHPEDRRAEAKKIVGEMIEGSADFCPIPVISKSGRYIQVETRVHPGSWDDRPA--- 365

Query: 218 EVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGR--CGLWNFNFDN 275
                          LF   +   K       + E       A        G+   +   
Sbjct: 366 ---------------LFCVTKDVTK-------IRETEELFSKAFHASASLMGISEID-GG 402

Query: 276 KKFHLSRSMYEIMGIPYENKTL-SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM 334
               ++R+  E  G         +   +    + +++           +     +    +
Sbjct: 403 LFIDVNRAFVETSGYTRNEAIGKTSVELGLFPNPEDRNRVASMVK---ESGFIKNMEITI 459

Query: 335 RHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA 394
           R   G   +    A  +  ++G   ++    D+T++   E    E  +RL  A+E  S A
Sbjct: 460 RTKIGDKKFGLFSATRI-DVNGNPCLLTTLTDITDRKSAEDALRENKERLDLALESASMA 518

Query: 395 LVLWDKNDRLVMCNANYQKAYGLPDHVLVP--GNARSIIQDAQTRPIIEYRTSDPERS-- 450
              WD  ++ +  ++      GL          +    +       + + R     R   
Sbjct: 519 PWHWDTMEKKLYLDSKACLLLGLDTERSNGTLQDFIDAVHPDDRARLRQARDRTTARGTF 578

Query: 451 QDMSKEIKLADSRWLQINEW 470
            +    +   D     I   
Sbjct: 579 YEHEFRVVWPDGSTHYITAH 598



 Score =  101 bits (252), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 76/553 (13%), Positives = 176/553 (31%), Gaps = 71/553 (12%)

Query: 99  NNNIKFDLASQKKAESMLGQLLAKTRFLSESFI---LLAQPN-ELVFASSTKNSHYIGKK 154
           N   K  +A Q+K    L +   + R + E+ +   +L  PN   +  ++     + G  
Sbjct: 2   NKKNKHTIALQRK---KLQESQDRYRAMFENTMCIKMLIDPNDGAIAEANEAACTFYGYS 58

Query: 155 IGEI----IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRL 210
           + +I    I +++   S  +  +  +A+L  Q  +  S +   +     +  S  P+   
Sbjct: 59  VEQIRQMKISDINTL-SPDEVAKNIQAALSGQHQYFESRHRLADGQIRDVQISSSPIPFK 117

Query: 211 WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
            ++ +   +                        K  +  L E        L     G+  
Sbjct: 118 GQKWLYYII------------------HDITARKNAEKKLHENKSFQRVLLEDINAGVVI 159

Query: 271 FNFDNKKFH-LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD 329
            +        ++    ++ G   +            +   ++  C             LD
Sbjct: 160 VDKKTHTIEQINSQGAKLFGASQDEIIGHV--CHNFLCPYDRGNCP-----ITDKGMDLD 212

Query: 330 QIFHMR-HASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
           +   +   A G  + I    + ++ + G   ++   +D++++   E+R  +++       
Sbjct: 213 RADRILLKADGTLLPILKSVKSIK-LDGKEKLLETFIDISDRKSAEERLKKSETNFRSFF 271

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
                 L + D    ++  N    +     +  L  G   +++     R   +    +  
Sbjct: 272 NSIDNFLFVLDVKGNILKANETAIRRLEYSEEEL-NGLNVAMVHPEDRRAEAKKIVGEMI 330

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
                                  +  G  I V T +     +         +    I + 
Sbjct: 331 EGSAD-----------FCPIPVISKSGRYIQVETRVHPGSWDDRPALFCVTKDVTKIRET 379

Query: 509 STSRQILERQKTEL---SIANAKYQVEKERA--ETANKTKSEFLAKMSHEL--------R 555
                        L   S  +    ++  RA  ET+  T++E + K S EL        R
Sbjct: 380 EELFSKAFHASASLMGISEIDGGLFIDVNRAFVETSGYTRNEAIGKTSVELGLFPNPEDR 439

Query: 556 TPLNAIL---GFSEVIKKEIFGELGSVKYYEY-AQDIHYSGQ-HLLNMINNILEMSKIET 610
             + +++   GF + ++  I  ++G  K+  + A  I  +G   LL  + +I +  K   
Sbjct: 440 NRVASMVKESGFIKNMEITIRTKIGDKKFGLFSATRIDVNGNPCLLTTLTDITD-RKSAE 498

Query: 611 EKISIDKQNADLI 623
           + +  +K+  DL 
Sbjct: 499 DALRENKERLDLA 511


>gi|254413568|ref|ZP_05027338.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
 gi|196179675|gb|EDX74669.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
          Length = 1315

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 139/736 (18%), Positives = 280/736 (38%), Gaps = 69/736 (9%)

Query: 60   LVFIATSSIIKVTTRYAQQEKMTNQT--SLMLTEAIEIIFQNNNIKFDLASQKKAESMLG 117
            L+ +  S+       + Q   +        +    +++  Q      +L +   A +   
Sbjct: 385  LLKLNQSAKKLAQGEWEQSVVIQRHDEVGELANSFVQMASQLQASFTELQTLNTALTESE 444

Query: 118  QLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEA 177
              L +        I +   +  +  ++  +   +G    + +PE + +        + +A
Sbjct: 445  SRLNQILEAIPVGISVHDVSGQIIYANQTSKQLLG---IDTLPEATTTDLSGTF-HVYQA 500

Query: 178  SLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYY 237
              ++         +    G  + ++     L   R  + +        +   +    + +
Sbjct: 501  ESEELYPVEQMPLVRAFQGEKVKVDDMEIRLPDRRIPLEVYGTPIRNETG-TIVAAIATF 559

Query: 238  RQAKKNKENDTILL--------EANIC---VETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
                + K+ + IL         +       +  A      G W+F+ ++KK   S  ++ 
Sbjct: 560  SDITERKQTEQILADYNQTLATQVRERTVELNEAQRLAHLGNWSFDVNSKKISWSDEVFR 619

Query: 287  IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
            I G        S+  + + IH D+    +          K  +    +  + G+  ++  
Sbjct: 620  ICGRDPSQSEPSYEQLLQQIHRDDVAQFQHDIEQAMTEGKSYEHEQRIVRSDGSIRYVLA 679

Query: 347  RAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLV 405
            + + +   SG  + + G   D++E+  +E++  E++++  +  E   +   +      ++
Sbjct: 680  KGEAILNSSGQVVQLFGTVQDISERKLIEEQLRESEEKFRQLAENIQDVFFILSYTGEIL 739

Query: 406  MCNANYQKAYGLPDHVLV--PGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSR 463
              N  Y++ +      L   P +    +        +               E +L DS 
Sbjct: 740  YINPVYEQIWQRTCQSLYDNPRSWLDSVFPEDYPSTVAA------------MERQLQDST 787

Query: 464  WLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELS 523
                    T   G I              + R      + T   +  +  I +R++ EL+
Sbjct: 788  DFDQVYRITRPNGEI-----------RWIRARSFPVPHQKTYRFVGIAEDITDRKQIELA 836

Query: 524  IANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYE 583
                     K+ AETAN+ KS FLA MSHELRTPLNAI+GF++++++          Y E
Sbjct: 837  -----LTEAKDAAETANRAKSTFLANMSHELRTPLNAIMGFTQLMQRSSTFPAD---YQE 888

Query: 584  YAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK 643
              Q I+ S +HLL +IN +L++SKIE  +I++++   DL  ++ +   L    A+ K ++
Sbjct: 889  NLQIIYRSSEHLLTLINQVLDLSKIEAGRITLNQTVFDLYALLRDVENLFQIKARDKGLQ 948

Query: 644  IEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK------------- 688
            +      ++      D   ++++L  +LSN+ KFT   G + ++ S+             
Sbjct: 949  LLFDYSDQVPQYVQTDAVKLRQVLINLLSNAFKFTQEGG-ISVKVSRGIDVGETPTANKP 1007

Query: 689  IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
                +   I DTG G+    LE I   F        Q   G GLGL+IS     L GG L
Sbjct: 1008 EEITLQFEIEDTGAGMAAEELESIFDAFIQ-SKTGKQHQEGTGLGLSISRKFVQLMGGDL 1066

Query: 749  KIISQEGKGTIVTICM 764
             + SQ  +GT+    +
Sbjct: 1067 TVASQVDQGTVFRFEI 1082


>gi|20090861|ref|NP_616936.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
 gi|19915933|gb|AAM05416.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
          Length = 1000

 Score =  432 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 142/712 (19%), Positives = 265/712 (37%), Gaps = 88/712 (12%)

Query: 91  EAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFI---LLAQPNELVFASSTKN 147
           E+IE I        +    ++  S L + L +  + ++S +   +    +  +   +   
Sbjct: 16  ESIEEIRGKKRADREETEVQEK-SHLEEKLVRLEWQADSAVTGLITMDFDGTLSYVNPFF 74

Query: 148 SHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPL 207
               G    E  P    S   +   +  +A                  G +         
Sbjct: 75  VRMWGYGSAEEPPGRQVSELWASPAEFLQAER-------ECREKGEWIGELQARRRDGTF 127

Query: 208 LRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILL-------EANICVETA 260
             +         +        L   +   +    + K+ +  L        EA   ++ A
Sbjct: 128 FYVHTS------LSLIRNREGLPLGISGSFVDITRLKQVEEELRNRTLELSEAKARLDLA 181

Query: 261 LSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL----IHYDN-KKICE 315
           L     G W+++          +++ ++GI  E    +  ++  L    +  ++ +++ E
Sbjct: 182 LEATEMGTWDWDVLTNGMTWDDNLFRLVGISREEFLQTHDSLLELSNRILSPEDNRRMLE 241

Query: 316 IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLE 374
           + ++V        +    +    G      V+ +  R   G +  + G   D+T++   E
Sbjct: 242 VMQAVADGKTDSYEFEHDVLRPDGTVRHFLVKGRAHRDSEGKLLRVTGTTTDITDQKIAE 301

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL-PDHVLVPGNARSIIQD 433
                ++  L+++          +D +   +  +   +  +   P          S I  
Sbjct: 302 DALRRSEANLARSQAMAHLGSYSFDAHTGEIYWSEELKTIWDYDPGPNYSFETVISRIHP 361

Query: 434 AQTRPIIEYRTSDPERSQDMSKE--IKLADS--RWLQINEWCTHDGGTISVGTDITLLKH 489
              + I+E   +  +     + E  I   D   R++      + DG  + V    TL   
Sbjct: 362 EDRKRILEALKNAGQGKHPFNSEYGILKPDGSIRYVHDQGEISLDGNGVPVRMFGTL--- 418

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
                                      +  T   +   +    KE AE+ANK K +FLA 
Sbjct: 419 ---------------------------QDITHRKLMEEQLLKAKEAAESANKAKGDFLAN 451

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           MSHE+RTP+NA+LG  E++ +       + +  EY Q  H S + LL++I+++L+ SKIE
Sbjct: 452 MSHEIRTPMNAVLGMLEMLLETSL----TDEQREYLQLAHASAESLLSIIDDVLDFSKIE 507

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFP 667
             K+ +++ + +L  +I+  I L+   A SK +K+   I  +L   F  D   +K++LF 
Sbjct: 508 QNKLELEQISFELESLISHIINLLSGKAGSKGLKLAFHIEKDLPSTFIGDPVRLKQVLFN 567

Query: 668 ILSNSIKFTNNNGKMMIRTSK----------------IGQCVIITIADTGIGIPKSALEK 711
           IL N+IKFT   G++ +                        ++  + DTGIGIP   L +
Sbjct: 568 ILGNAIKFTKK-GEIALSVEVYMPSERNSGLSNSDFPEEVALLFKVKDTGIGIPPEKLSQ 626

Query: 712 IGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           I  PF        +  GG GLGLAIS  L  L  GR+ + S+ GKG      
Sbjct: 627 IFDPFIQADASVTREYGGTGLGLAISSQLVELMEGRIWVESEVGKGCTFYFT 678


>gi|117618541|ref|YP_856712.1| PAS [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117559948|gb|ABK36896.1| PAS [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 1323

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 142/709 (20%), Positives = 262/709 (36%), Gaps = 72/709 (10%)

Query: 102 IKFDLASQKKAESMLGQLLAKTRFLSESFIL------LAQPNELVFASSTKNSHYIGKKI 155
           +  D   +K+ E  L +     R       +      +   +      S +     G+  
Sbjct: 250 VIEDHQQRKETEEALRRNEGILRESQHLAKIGNWRWNITDDSH---FWSPEIYRIYGRDP 306

Query: 156 G-------EIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
                   E+    ++   R+    +     D  PY   +  +      I II     L 
Sbjct: 307 SLPPAIYPEVRKYFTQDGWRAIAQSVERCLQDGLPYECDAEVIHEQGEPIWIIARGAALR 366

Query: 209 RLWREEVTLEVVFFSII----SALLLFILFSYYRQAKKNKENDT---------------- 248
                 V L      I     +   L          ++                      
Sbjct: 367 ANDGTIVELYGTVQDITERKLAEQQLLHNQQLALDTQRRARLAALNLMDDAISARIRAET 426

Query: 249 ---ILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL 305
               L E+   +  A      G+W +N    +   S     + G     +   F+     
Sbjct: 427 TSSALRESEQRLLMAQEGAHVGIWEWNMQGGRLFFSPECARLYGRS-AEQLSEFKQWHSC 485

Query: 306 IHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIA 364
           +H D+K   +   +      K ++  F +   +G   W+  +  + R        ++GI 
Sbjct: 486 LHPDDKPRLDKLLAELPASGKPIEIEFRILLPNGDVRWLSSKGSIYRDAQQRPLRLLGIH 545

Query: 365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP 424
           +D+TE+   E++  +    LS A+E + + + + D   R+   N  +  A G     ++ 
Sbjct: 546 LDITERKQAEQQLRQ----LSLALEQSPDGVFITDTQARIEYVNVAFLAASGYQQSEVIG 601

Query: 425 GNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDI 484
                        P +      P+ +     +      RW         DG    V   +
Sbjct: 602 QT-----------PSLLRSGLTPKATYIALWDAIKRGQRWHGEFINRRKDGSHYQVLATV 650

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK----YQVEKERAETAN 540
           + ++            ++A I +     + L++ +  L     +         +RAE+AN
Sbjct: 651 SPIRQENGA-VTHYVTVQADITEKKQLGEELDQYRYHLEEMVNERTLQLAQAHQRAESAN 709

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
           + KS FLA MSHE+RTP+NAILG + ++K++           +  + I  + QHLL +IN
Sbjct: 710 RAKSAFLANMSHEIRTPMNAILGLTYLLKRDT----PDHTQQDRLEKIDNAAQHLLTIIN 765

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKR 659
           +IL++SKI+  K+++++ +  L  +++    L+   A++K + I   I  +  + + D  
Sbjct: 766 DILDLSKIDAGKMALEQSDFSLTAMLDNVSALMSEQARAKGLTIIVDIGDTPAWVHGDIT 825

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKI----GQCV-IITIADTGIGIPKSALEKIGQ 714
            +++ L    +N+IKFT   G + +R        G  +    + DTGIGI     EK+ Q
Sbjct: 826 RLRQALLNYAANAIKFT-EQGSVTLRVRVDHPLAGGYLLRFEVEDTGIGISPEQSEKLFQ 884

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
            FE       +  GG GLGLAI+  L  L GG + + S  GKG+     
Sbjct: 885 AFEQADVSTTRKYGGTGLGLAITSRLATLMGGEVGVTSTLGKGSCFWFT 933



 Score =  152 bits (384), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 63/467 (13%), Positives = 128/467 (27%), Gaps = 73/467 (15%)

Query: 86  SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASST 145
            L          +    +   + Q + +    +  A     +   I L  P+      + 
Sbjct: 111 LLSAAMHRSRARETQRWQELSSIQSRLQQSETRFQATF-EQAAVGIALVSPDGKWLRVNR 169

Query: 146 KNSHYIGKKIGEIIPELSRSRSRSKTV----QMSEASLDQQPYH--VLSVNLPHNSGSIL 199
           +    +G +  E++    +  +    +          L  +  H  +    L      + 
Sbjct: 170 RLCDMLGYQADELMGMTFQQITHPDDLFIDQTYVAQMLADERQHYTLEKRYLRKGGEVLW 229

Query: 200 IINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVET 259
           I  +   +  L  +                     S     ++ KE +  L      +  
Sbjct: 230 ITLTVALVKDLKGKPDY----------------FISVIEDHQQRKETEEALRRNEGILRE 273

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
           +    + G W +N  +     S  +Y I G         +  + +    D  +    +  
Sbjct: 274 SQHLAKIGNWRWNITDDSHFWSPEIYRIYGRDPSLPPAIYPEVRKYFTQDGWRAIAQSVE 333

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEK--- 375
              +     +    + H  G  IWI  R   +R   G +  + G   D+TE+   E+   
Sbjct: 334 RCLQDGLPYECDAEVIHEQGEPIWIIARGAALRANDGTIVELYGTVQDITERKLAEQQLL 393

Query: 376 ------------------------------------RYAEADQRLSKAIECTSEALVLWD 399
                                                  E++QRL  A E     +  W+
Sbjct: 394 HNQQLALDTQRRARLAALNLMDDAISARIRAETTSSALRESEQRLLMAQEGAHVGIWEWN 453

Query: 400 KNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ---DMSKE 456
                +  +    + YG     L              +P ++   ++   S    ++   
Sbjct: 454 MQGGRLFFSPECARLYGRSAEQLSEFKQWHSCLHPDDKPRLDKLLAELPASGKPIEIEFR 513

Query: 457 IKLADS--RWLQINEWCTHDG-----GTISVGTDITLLKHNQAQLRE 496
           I L +   RWL        D        + +  DIT  K  + QLR+
Sbjct: 514 ILLPNGDVRWLSSKGSIYRDAQQRPLRLLGIHLDITERKQAEQQLRQ 560


>gi|307150289|ref|YP_003885673.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
 gi|306980517|gb|ADN12398.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
          Length = 1093

 Score =  430 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 140/676 (20%), Positives = 266/676 (39%), Gaps = 50/676 (7%)

Query: 100 NNIKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSHYIGKKIG 156
             I  D++S K+ E+ L +  A+ R L++S    I +          +     + G+ + 
Sbjct: 303 AGINLDISSLKQTEAKLRESEAQLRNLADSAPVLIWMNNAEGGCEFVNKAYLKFFGESLE 362

Query: 157 EIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
           EI                       QPY        +                 +R   +
Sbjct: 363 EIQGFGWSIHLHPDDA---------QPYLSAYEQAFNEQKPFRAQARIKRADGQYRWLDS 413

Query: 217 LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
                FS     L +I  S      + KE    L E+    +         +W  +    
Sbjct: 414 RATPQFSSTGQFLGYIGSS--SDISEIKEASEALRESEQRFKLLADNVPVLIWMDDEFQH 471

Query: 277 KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRH 336
           +  ++    +  GI  E      +    L+H ++ +   +       H  +   +  +R 
Sbjct: 472 RRFVNARYLQFAGISPEMLV---QGWTDLLHPEDAQQYLLKYKQAIAHKSEYRAVVRLRR 528

Query: 337 ASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV 396
             G   W +V           +  +G  +D+TE+   E+   + +QR S       + ++
Sbjct: 529 HDGVYRWFEVIGLPRFEGDSFVGYLGCKLDITERKQAEEALQQREQRFSNLFNGMEDWVL 588

Query: 397 LW-----DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ 451
           ++     D+  +L+  N    K  G     L+  + + II  A   P  E      + ++
Sbjct: 589 VYHLTEEDQPGKLIEVNEQASKKLGYSREELLSMSVKDIINPASVNP--EASLKKLQSAK 646

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
            +  E           +   T +G  I V    TL                 T+  +   
Sbjct: 647 HIVVE-----------SVHITKEGQEIPVEVSATLFT----------LNGLPTVQAICRD 685

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
               ++ + E      + Q  +E AE+AN+ K EFLA +SHELR+PLN ILG+++++K  
Sbjct: 686 ITERKQIEQEREQLLIREQAAREAAESANRIKDEFLAVLSHELRSPLNPILGWAQMLKN- 744

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
              EL      +    I  + +    +I ++L++S+I   K++++  +  L+ +I   + 
Sbjct: 745 --YELDQPTTQKALCIIERNARLQAELIEDLLDVSRILRGKLNLNTTSVSLVVVIEAALE 802

Query: 632 LIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
            +  +AQ+K+I++  ++ + +     D   ++++++ +LSN++KFT + G++ I   +I 
Sbjct: 803 TVRLAAQAKSIELRTQLETPVGRVLGDAARLQQVVWNLLSNAVKFTPSGGQVEIELEQIH 862

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
             V I + DTG GI    L  I   F    +   +  GG GLGLAI+  L  LHGG++  
Sbjct: 863 GGVEIRVKDTGKGITPEFLPYIFDYFRQADSSTTRKFGGLGLGLAIARHLVELHGGKIWA 922

Query: 751 IS-QEGKGTIVTICMP 765
            S  E +G    + +P
Sbjct: 923 ESLGENQGATFIVNLP 938



 Score =  149 bits (377), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/496 (13%), Positives = 140/496 (28%), Gaps = 39/496 (7%)

Query: 95  IIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKK 154
             F    I   +  +++   +  +  A         IL       +   S  N       
Sbjct: 46  QEFIREAIAEKIKQKQETRKVKTEEKAAMLEAFPDLILTIDQQGKILDYSGTN-SIEDYG 104

Query: 155 IGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREE 214
           +G        ++ + KT+         + +      L      + I      LL    EE
Sbjct: 105 LGCGTRSALPTQLQQKTLAEILPPQISEQWKQALAALNRRKNLVTI---EYSLLINQIEE 161

Query: 215 VTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFD 274
                +     S  LL I+    R   + K ++  L                G+W    D
Sbjct: 162 FYEARLVPLKESDNLLAII----RNISQWKRSEAALRLNERLYRAIGETIDYGIWICEPD 217

Query: 275 NKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM 334
            +  + S S   ++G+  E    S      ++H D+ +   +A     +     D+    
Sbjct: 218 GRNIYASDSFLNLVGMTQEQ--CSNFGWGEVLHPDDAEATIVAWQECSQSGNFWDREHRF 275

Query: 335 RHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
           R   G    I  R   +R   G +    GI +D++     E +  E++ +L    +    
Sbjct: 276 RGIDGNWHPILARGVPVRDEKGELLWWAGINLDISSLKQTEAKLRESEAQLRNLADSAPV 335

Query: 394 ALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDM 453
            + + +        N  Y K +G     +        +     +P +          +  
Sbjct: 336 LIWMNNAEGGCEFVNKAYLKFFGESLEEIQGFGWSIHLHPDDAQPYLSAYEQAFNEQKPF 395

Query: 454 SKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR- 512
             + ++              DG    + +  T    +  Q                 S  
Sbjct: 396 RAQARIK-----------RADGQYRWLDSRATPQFSSTGQFLGYIGSSSDISEIKEASEA 444

Query: 513 -QILERQKTELSIANAKYQVEKERAETANKTKSEFL--AKMSHELRTPLNAILGFSEVIK 569
            +  E++   L+          +  +      + +L  A +S E+      + G+++++ 
Sbjct: 445 LRESEQRFKLLADNVPVLIWMDDEFQHRRFVNARYLQFAGISPEML-----VQGWTDLLH 499

Query: 570 KEIFGELGSVKYYEYA 585
                        +Y 
Sbjct: 500 --------PEDAQQYL 507


>gi|145299082|ref|YP_001141923.1| two-component system hybrid sensor histidine kinase/response
           regulator [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142851854|gb|ABO90175.1| two-component system hybrid sensor histidine kinase/response
           regulator [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 1319

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 143/706 (20%), Positives = 269/706 (38%), Gaps = 66/706 (9%)

Query: 102 IKFDLASQKKAESMLG---QLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIG-- 156
           I  D   +K+ E+ L     +L +++ L++               S +     G+  G  
Sbjct: 250 IIEDNQQRKETEAALRRNEVILHESQHLAKIGNWRWHIANNSHFWSPEIYRIYGRDPGLP 309

Query: 157 -----EIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLW 211
                E+    ++   R+    +     + QPY   +  +      + +I     L    
Sbjct: 310 PAVYPEVKKYFTQEGWRAIAQSVERCLQNGQPYECDAEVIHEQGDPVWVIARGAALRDSS 369

Query: 212 REEVTLEVVFFSII----SALLLFILFSYYRQAKKNKENDT------------------- 248
              V L      I     +   L          ++                         
Sbjct: 370 GAIVELYGTVQDITERKLAEQQLLHNQQVALDTQRRARLAALNLMDDAISARIRAETTST 429

Query: 249 ILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHY 308
            L ++   +  A      G+W ++  + +   S     + G   E     F      +H 
Sbjct: 430 ALRDSEQRLLMAQEGAHVGIWEWDILSGRLFFSPECARLYGRSVEQLC-EFHIWQGCLHP 488

Query: 309 DNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDL 367
           D++   +   S        LD  F +   +G   W+  +  + R        ++GI +D+
Sbjct: 489 DDRARIDQLLSELPHTGTPLDIEFRILRPTGEVRWLVSKGSVYRDAQQRPVRLLGINLDI 548

Query: 368 TEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA 427
           TE+   E++  +    LS A++ + + + + D   R+   N  +  A G   H ++    
Sbjct: 549 TERKQAEQQLRQ----LSLALKQSPDGVFITDIQGRIEYVNVAFLAASGYQQHEVIGQT- 603

Query: 428 RSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLL 487
                     P +      P+ +     +      RW         DG    V   ++ +
Sbjct: 604 ----------PTLLRSGLTPKATYITLWDAIHQGQRWHGEFINRRKDGSHYQVLATVSPI 653

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK----YQVEKERAETANKTK 543
           +    +       ++A I +     + L++ +  L     +         +RAE+AN+ K
Sbjct: 654 RQENGE-VTHYVTVQADITEKKQLGEELDQYRYHLEEMVNERTLQLAQAHQRAESANRAK 712

Query: 544 SEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL 603
           S FLA MSHE+RTP+NAILG + ++K++          ++  + I  + QHLL +I +IL
Sbjct: 713 SAFLANMSHEIRTPMNAILGLTYLLKRDT----PDHTQHDRLEKIDNAAQHLLTIITDIL 768

Query: 604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIK 662
           ++SKI+  K+ +++ +  L  +++    L+   A++K + I   I  S  + + D   ++
Sbjct: 769 DLSKIDAGKMVLEQGDFSLTAMLDNVSALMSEQARAKGLTIIVDIGDSPAWVHGDITRLR 828

Query: 663 KILFPILSNSIKFTNNNGKMMIRTSKI-----GQCVIITIADTGIGIPKSALEKIGQPFE 717
           + L    +N+IKFT   G + +R         G  +   + DTGIGI     EK+ Q FE
Sbjct: 829 QALLNYAANAIKFT-EQGSVTLRVRVERPLSNGYLLRFEVEDTGIGISPEQREKLFQAFE 887

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
                  +  GG GLGLAI+  L  L GG + + S +GKG+     
Sbjct: 888 QADASTTRKYGGTGLGLAITSRLATLMGGEVGVESTQGKGSCFWFT 933



 Score =  150 bits (380), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 63/497 (12%), Positives = 136/497 (27%), Gaps = 73/497 (14%)

Query: 56  SMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESM 115
            +  L  +  ++   +             T L          +    +  +++Q + +  
Sbjct: 81  ILPPLHSLTIAAGQDLVQWGILITNGILITLLSAAMHRSRAREVQRWQELMSTQSRLQRS 140

Query: 116 LGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTV--- 172
             +  A     +   I L  P+      + +    +G +  E++    +  +    +   
Sbjct: 141 ETRFQATF-EQAAVGIALVAPDGNWLRVNQRLCDMVGYQADELMGMSFQQITHPDDLFID 199

Query: 173 -QMSEASLDQQPYH--VLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALL 229
                  L  +  H  +    L  N   + I  +   +     +                
Sbjct: 200 QTFVAQMLAGERPHYTLEKRYLRKNGEVLWITLTVALVRDDRGKPDY------------- 246

Query: 230 LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMG 289
                S     ++ KE +  L    + +  +    + G W ++  N     S  +Y I G
Sbjct: 247 ---FISIIEDNQQRKETEAALRRNEVILHESQHLAKIGNWRWHIANNSHFWSPEIYRIYG 303

Query: 290 IPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
                    +  + +    +  +    +     ++ +  +    + H  G  +W+  R  
Sbjct: 304 RDPGLPPAVYPEVKKYFTQEGWRAIAQSVERCLQNGQPYECDAEVIHEQGDPVWVIARGA 363

Query: 350 MMRTISGGM-NIIGIAMDLTEKYHLEK--------------------------------- 375
            +R  SG +  + G   D+TE+   E+                                 
Sbjct: 364 ALRDSSGAIVELYGTVQDITERKLAEQQLLHNQQVALDTQRRARLAALNLMDDAISARIR 423

Query: 376 ------RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
                    +++QRL  A E     +  WD     +  +    + YG     L   +   
Sbjct: 424 AETTSTALRDSEQRLLMAQEGAHVGIWEWDILSGRLFFSPECARLYGRSVEQLCEFHIWQ 483

Query: 430 IIQDAQTRPIIEY---RTSDPERSQDMSKEIKLADS--RWLQINEWCTHDG-----GTIS 479
                  R  I+             D+   I       RWL        D        + 
Sbjct: 484 GCLHPDDRARIDQLLSELPHTGTPLDIEFRILRPTGEVRWLVSKGSVYRDAQQRPVRLLG 543

Query: 480 VGTDITLLKHNQAQLRE 496
           +  DIT  K  + QLR+
Sbjct: 544 INLDITERKQAEQQLRQ 560


>gi|300867388|ref|ZP_07112044.1| putative Histidine kinase [Oscillatoria sp. PCC 6506]
 gi|300334639|emb|CBN57212.1| putative Histidine kinase [Oscillatoria sp. PCC 6506]
          Length = 1120

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 131/639 (20%), Positives = 260/639 (40%), Gaps = 60/639 (9%)

Query: 133 LAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLP 192
           L    E + ++   +  ++  ++ +          R   +++    L  Q    ++V L 
Sbjct: 53  LTNSAEEMASAKPFDCAFLDYRLPDGDGLKLVKTIREAGIKIPLIVLTGQGDEQIAVELM 112

Query: 193 HNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLE 252
               S  I  +++    L R                 L      YR   K  +    L E
Sbjct: 113 KAGASDYIAKAKLSPENLSRS----------------LQNAIRIYRAETKATQASQKLKE 156

Query: 253 ANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKK 312
           +       L     G+W+++    + + +  + EI+G+       +  A    +H ++ +
Sbjct: 157 SEERYRLVLEGANDGIWDWDLSKNEVYWNDRLLEIVGLSRSEFGSAIEAFFDRLHPEDYE 216

Query: 313 ICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKY 371
               A     +   + +  F + H+S    +   R +  R   G  + + GI  D++++ 
Sbjct: 217 STRKALEAHLETGTEYNVEFRLLHSSDVYRYCTGRGKAQRNQQGKALRMAGIISDISDRK 276

Query: 372 HLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSII 431
             E       Q+L + I C    + ++DK  R    +  +   Y L    ++  +   ++
Sbjct: 277 LAEAALERERQQLRQIIACVPVPMAMFDKEMRYQAHSQRWLTQYNLEGQSILNRSYYEVL 336

Query: 432 QDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQ 491
            D                             RW +++E     G  +SV  D    +   
Sbjct: 337 PDIPD--------------------------RWRKMHERSLT-GEVVSVSEDAWKREDGS 369

Query: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMS 551
                         +       ++  +  EL          +E A  A++ KS+FLA MS
Sbjct: 370 TVFLRWAIHPWYAPDGEVGGIVLVSDRINELVE-------AREAAIEASRVKSQFLANMS 422

Query: 552 HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETE 611
           HE+RTP+N +LG ++++ +         K  EYAQ I+ S +HLL++IN+IL+ SKIE  
Sbjct: 423 HEIRTPMNGVLGMAQLLLRLSL----EAKPREYAQTIYRSAEHLLSVINDILDFSKIEAG 478

Query: 612 KISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPIL 669
           ++ ++  + DL   I   + ++ ++A+ K +++   I S +      D   +K+IL  ++
Sbjct: 479 EMRLETLDFDLDVCIESMVEMVVATAEEKGLELNVLIESSVPRQLQGDPGRLKQILLNLV 538

Query: 670 SNSIKFTNNNG---KMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
           +N+IKFT+      ++ +++S + + +I ++ D+GIGI     +K+ Q F  +     + 
Sbjct: 539 NNAIKFTDRGQVLVRVSLKSSTVDRKLIFSVRDSGIGISPEGQKKLFQSFSQVDGSPTRQ 598

Query: 727 IGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GG GLGL I   L  + GG + + +  GKG+     +P
Sbjct: 599 YGGTGLGLVICKQLVEMMGGEIGVRTSVGKGSNFWFTIP 637


>gi|149174355|ref|ZP_01852982.1| multi-sensor hybrid histidine kinase [Planctomyces maris DSM 8797]
 gi|148846900|gb|EDL61236.1| multi-sensor hybrid histidine kinase [Planctomyces maris DSM 8797]
          Length = 1102

 Score =  429 bits (1103), Expect = e-117,   Method: Composition-based stats.
 Identities = 130/569 (22%), Positives = 239/569 (42%), Gaps = 44/569 (7%)

Query: 211 WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKEN------DTILLEANICVETALSRG 264
           W        +  +  + +    +F+  R   +  +          L  +   ++ AL  G
Sbjct: 138 WWPIYRFSGLIKACTAIVSWITVFALIRFVPEALKLPSTALLAQELQRSKERLDFALDAG 197

Query: 265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKH 324
           + G+W +N         R   +I  I  E + L      + +H +++           + 
Sbjct: 198 QIGVWEWNLKTDTLLWDRRTRQIFNIDPEVRDLYLTDFTQCLHPEDRNEVTNQLEQCIQT 257

Query: 325 VKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQR 383
               +  F + H+ G+  ++  + +      G     IG+  D T+K   E   AE++  
Sbjct: 258 RTPYNSKFRVVHSDGSIRYVHAQGRAFLGNDGEPEQYIGVCHDFTDKQLQEDALAESELN 317

Query: 384 LSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYR 443
                E  +  +     + R +  N    + +      L+      +         +E  
Sbjct: 318 FRSTFEQVAMGIAHVALDGRWLRVNQRLCEIFDYQAEELLELRIHDLSHPD----ELEIV 373

Query: 444 TSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKA 503
             + +R Q    +    + R+L        DG +I     ++L++H   + +     +K 
Sbjct: 374 LKNMQRMQAGEIKSYSIEKRYL------RKDGSSIWTNLMVSLVRHQSGEPKHFIFGIKN 427

Query: 504 TINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILG 563
                                   K +  K  AE A++TKSEFLA MSHELRTPLN ++G
Sbjct: 428 ---------------IQRRKETEQKLKAAKLTAEEASQTKSEFLANMSHELRTPLNGVIG 472

Query: 564 FSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLI 623
            +E+++    G   +    E+      SG+ LLN+IN+IL+ SKIE  K+ +D    DL 
Sbjct: 473 MTELLQ----GTHLNQHQQEFVDACRSSGESLLNLINDILDFSKIEAGKLDLDLHEFDLE 528

Query: 624 PIINEGIRLIGSSAQSKNIKIEKKIPSE--LFFNADKRIIKKILFPILSNSIKFTNNNGK 681
            ++ + +  +      KN+++   +  E  L    D   +++IL  ++ N+IKFT++ G+
Sbjct: 529 NVLMDTVSTLVWRTNEKNLELPCFVDPESRLTLKGDSYRLRQILVNLIGNAIKFTDS-GE 587

Query: 682 MMIRTS---KIGQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAI 736
           +++RT    +    + I  ++ DTGIGI +S + ++ Q F  +     ++ GG GLGL I
Sbjct: 588 VVVRTRTVSRENGNIRIHFSVTDTGIGISESKINRLFQSFSQVDASTTRNYGGTGLGLVI 647

Query: 737 SDALTNLHGGRLKIISQEGKGTIVTICMP 765
           S  L  L GGR+ I SQ+G G+     +P
Sbjct: 648 SQNLVELMGGRIGIESQDGVGSTFWFEIP 676



 Score = 38.0 bits (87), Expect = 5.5,   Method: Composition-based stats.
 Identities = 29/251 (11%), Positives = 62/251 (24%), Gaps = 35/251 (13%)

Query: 13  LYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVT 72
           LY     Q +    +          I     + S F            V  +  SI  V 
Sbjct: 230 LYLTDFTQCLHPEDRNEVTNQLEQCIQTRTPYNSKFR-----------VVHSDGSIRYVH 278

Query: 73  TRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSES 129
            +         +             Q   +  D   ++  E  L +     R        
Sbjct: 279 AQGRAFLGNDGEP-----------EQYIGVCHDFTDKQLQEDALAESELNFRSTFEQVAM 327

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
            I     +      + +       +  E++       S    +++      +    + + 
Sbjct: 328 GIAHVALDGRWLRVNQRLCEIFDYQAEELLELRIHDLSHPDELEIV----LKNMQRMQAG 383

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
            +   S     +        +W   +   V   S      +F +    +  ++ KE +  
Sbjct: 384 EIKSYSIEKRYLRKDGS--SIWTNLMVSLVRHQSGEPKHFIFGI----KNIQRRKETEQK 437

Query: 250 LLEANICVETA 260
           L  A +  E A
Sbjct: 438 LKAAKLTAEEA 448


>gi|121997175|ref|YP_001001962.1| multi-sensor hybrid histidine kinase [Halorhodospira halophila SL1]
 gi|121588580|gb|ABM61160.1| multi-sensor hybrid histidine kinase [Halorhodospira halophila SL1]
          Length = 1266

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 135/710 (19%), Positives = 251/710 (35%), Gaps = 57/710 (8%)

Query: 69  IKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRF--- 125
            +   R      +  Q ++   E          +  D+  +K+    L     +      
Sbjct: 86  FESQHRRRDGTLVDVQITVSQVEFAGHPRLLA-VFRDITERKETIRALRTSEQRFLDVVD 144

Query: 126 LSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYH 185
            +  +I     +      + +    +G+   EII         S   +  +  L      
Sbjct: 145 AAGEYIWEIDRDGTYQLVTAQIEPLLGRSTAEIIGRSPVDFMPSAEAERIQTML------ 198

Query: 186 VLSVNLPHNSGSILIINSRVPL-LRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNK 244
                    +   L   S  P   R+W+    L +  F+    L+ F      R     +
Sbjct: 199 -SERAQTGAAWQGLEHESVRPDGTRVWQRVSGLPI--FNEAGELIGFRGTG--RDITAER 253

Query: 245 ENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIAR 304
           +        N  +  A +  R G+W  +    +         I G            +  
Sbjct: 254 QAQQNEKRLNERLRLATTAARIGVWELDRATDRLEWDAGSARIFGTDPAAFNHRLANLQA 313

Query: 305 LIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA-SGADIWIQVRAQMMRTISGG-MNIIG 362
            +  +N+ I E     +    +  +  F +R    GA   I+  +  +    G    ++G
Sbjct: 314 TLWDENRTIAEGLIERSLHSAEPCEAEFRIRRKSDGAIRHIRSVSLSIPDEHGQVQRLVG 373

Query: 363 IAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKN-DRLVMCNANYQKAYGLPDHV 421
           I  D+T++    ++ A  + R     E     L + D      +  N    +A G     
Sbjct: 374 INEDITDRVQAREQLAAQEARFRGLFELAPVGLAMTDFETGAFLDFNDQVSEAAGYTREA 433

Query: 422 LVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVG 481
                   +          E+  +          E            E+   DG    V 
Sbjct: 434 FAQLTYWDVTPREYEPKEREHLEAMARTGYYGPYE-----------KEFIHRDGHRFPVL 482

Query: 482 TDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANK 541
            +   +   Q                       + +  +E           KE AE  N+
Sbjct: 483 LNGFRMTDPQTGRVVVWS---------------VIQDISERKAVEQALHQAKEAAEANNR 527

Query: 542 TKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINN 601
            KS+FLA MSHE+RTP+NA++G  +++ +     +       YA+ +H + + LL +IN+
Sbjct: 528 AKSDFLANMSHEIRTPMNAVIGLGQLLIETDLDPV----QRNYAEKMHNASRMLLGIIND 583

Query: 602 ILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKR 659
           IL+ SKIE +++++D    DL  ++++   L G  A  K +++  ++   +      D  
Sbjct: 584 ILDYSKIEADRLTLDPHPFDLHELMDQMATLFGDQAGEKGLELFLRVEPTIPSSLEGDAL 643

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ-----CVIITIADTGIGIPKSALEKIGQ 714
            + ++L  +LSN+IKFT  +G++ +  +++GQ      +   + DTGIGI       + Q
Sbjct: 644 RLSQVLSNLLSNAIKFT-KHGQVGLSITQLGQDPEGVRLHFQVEDTGIGITPEQQRNLFQ 702

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
            F        ++ GG GLGL IS  L    GG L++ S  G+GT     +
Sbjct: 703 AFSQADTSTTRNYGGTGLGLVISQRLVAHMGGELRLESTPGEGTRFAFEL 752



 Score =  115 bits (287), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/395 (10%), Positives = 105/395 (26%), Gaps = 38/395 (9%)

Query: 114 SMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS----RS 169
               +       L ++ +L+A     V   +   + ++G     +              +
Sbjct: 10  RRADEWRILFDHLPDATLLIAPDTGRVLEGNPAAAAHLGYTPEALRGLTIADFEAAETPA 69

Query: 170 KTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALL 229
           +     E           S +   +   + +  +   +                      
Sbjct: 70  EIAAHIEKIQRAGRDDFESQHRRRDGTLVDVQITVSQVEFAGHPR--------------- 114

Query: 230 LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMG 289
              L + +R   + KE    L  +       +      +W  + D     ++  +  ++G
Sbjct: 115 ---LLAVFRDITERKETIRALRTSEQRFLDVVDAAGEYIWEIDRDGTYQLVTAQIEPLLG 171

Query: 290 IPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD-QIFHMRHASGADIWIQVRA 348
                     R+    +     +  +   S   +                G  +W +V  
Sbjct: 172 RSTAEIIG--RSPVDFMPSAEAERIQTMLSERAQTGAAWQGLEHESVRPDGTRVWQRVSG 229

Query: 349 QMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMC 407
             +   +G  +   G   D+T +   ++     ++RL  A       +   D+    +  
Sbjct: 230 LPIFNEAGELIGFRGTGRDITAERQAQQNEKRLNERLRLATTAARIGVWELDRATDRLEW 289

Query: 408 NANYQKAYGLPDHVLVPG--NARSIIQDAQT---RPIIEYRTSDPERSQDMSKEIKLADS 462
           +A   + +G           N ++ + D        +IE      E  +   +  + +D 
Sbjct: 290 DAGSARIFGTDPAAFNHRLANLQATLWDENRTIAEGLIERSLHSAEPCEAEFRIRRKSDG 349

Query: 463 --RWLQINEWCTHDG-----GTISVGTDITLLKHN 490
             R ++       D        + +  DIT     
Sbjct: 350 AIRHIRSVSLSIPDEHGQVQRLVGINEDITDRVQA 384


>gi|75908636|ref|YP_322932.1| PAS/PAC sensor hybrid histidine kinase [Anabaena variabilis ATCC
           29413]
 gi|75702361|gb|ABA22037.1| PAS/PAC sensor hybrid histidine kinase [Anabaena variabilis ATCC
           29413]
          Length = 933

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 118/674 (17%), Positives = 229/674 (33%), Gaps = 72/674 (10%)

Query: 111 KAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSK 170
           + E+   +L       +   I+   P+ ++   +     ++G    E+I + +      K
Sbjct: 39  QLEATNQKLQQAILNSANYTIISTTPDGIILTFNAAAQRWLGYTAEEVIGKTTPEIVHDK 98

Query: 171 TVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLW--------REEVTLEVV-F 221
              +  A   +    +     P     +          R W        R  V L V   
Sbjct: 99  NEVVKVA--QELSQELGVTIEPGFEVFVAKARLGQVEEREWTYIRKDGSRFPVLLSVTPL 156

Query: 222 FSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLS 281
           +     +  F+           K  +  L E+     T       G++  +   +    +
Sbjct: 157 YDAEENITGFLGIG--SDITARKLAEAALRESEYRYATLAQTAPVGIFRNDASGRCIFAN 214

Query: 282 RSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGAD 341
                ++G P E+         + +H D++       +   K        +  RH +   
Sbjct: 215 ERACNLIGSPLEDILG--EGWVQSLHPDDRLRIVREWNQAIKQNLPFKAEYRFRHPNNVI 272

Query: 342 IWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDK 400
            W+  +A   R   G     IG   D+ ++   E+        LS+A+E   E +   D 
Sbjct: 273 NWVISQAIPERGSDGEVTGYIGTMTDINDRKRAEEELL----HLSQALESAVEGISQLDT 328

Query: 401 NDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLA 460
               +  N  Y +  G     ++     S +       ++                  L 
Sbjct: 329 QGHYIKVNPAYAQITGYTPEEMIGMEWTSTVHPDDQEKMMAA------------YRQMLK 376

Query: 461 DSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKT 520
           + +          DG        +    + Q +       +K   +     R+ +ER   
Sbjct: 377 NGKVEMEARAMRKDGSAFYKQVVMVKAYNQQQECIGHYCFMKDISD-----RREVER--- 428

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
                                 K EF++ +SHELRTPL +I G  +++  ++    GS  
Sbjct: 429 ---------------------LKDEFVSVVSHELRTPLTSISGALDLLASKVV-PAGSED 466

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
                     +   L+ +IN+IL++ +IE+ KI I  Q  +   ++ + + ++   A+  
Sbjct: 467 AQRMLNIAANNTDRLVRLINDILDIERIESGKIQITPQACNAADLMTQSVEVMEELAEQG 526

Query: 641 NIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-------- 692
            I++    P      AD   I ++   ++SN+IKF+     + +      +         
Sbjct: 527 GIQLAMS-PLSAHLWADPDRIIQVFTNLISNAIKFSPAGATVWVTAKIPEKSELEKFPNP 585

Query: 693 -VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            ++  + D G GIP   LE I + F  +     +  GG GLGLAI  ++   HGGR+   
Sbjct: 586 VILFEVKDQGRGIPADKLESIFERFGQVDASDSRQKGGTGLGLAICRSILQHHGGRIWAE 645

Query: 752 SQEGKGTIVTICMP 765
           S  G+G+     +P
Sbjct: 646 STLGEGSTFFFTLP 659



 Score =  113 bits (284), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 45/332 (13%), Positives = 100/332 (30%), Gaps = 38/332 (11%)

Query: 59  FLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKF------DLASQKKA 112
           F VF+A + + +V  R     +       +L     +     NI        D+ ++K A
Sbjct: 120 FEVFVAKARLGQVEEREWTYIRKDGSRFPVLLSVTPLYDAEENITGFLGIGSDITARKLA 179

Query: 113 ESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRS 169
           E+ L +   +   L+++    I     +     ++ +  + IG  + +I+ E        
Sbjct: 180 EAALRESEYRYATLAQTAPVGIFRNDASGRCIFANERACNLIGSPLEDILGEGWVQSLHP 239

Query: 170 KTVQMS-----EASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSI 224
                      +A     P+         N+    +I+  +P      E           
Sbjct: 240 DDRLRIVREWNQAIKQNLPFKAEYRFRHPNNVINWVISQAIPERGSDGEVTGYIGTM--- 296

Query: 225 ISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSM 284
                              K  +  LL     +  AL     G+   +       ++ + 
Sbjct: 297 -------------TDINDRKRAEEELL----HLSQALESAVEGISQLDTQGHYIKVNPAY 339

Query: 285 YEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWI 344
            +I G   E            +H D+++    A     K+ K ++         G+  + 
Sbjct: 340 AQITGYTPEEMIG--MEWTSTVHPDDQEKMMAAYRQMLKNGK-VEMEARAMRKDGSAFYK 396

Query: 345 Q-VRAQMMRTISGGMNIIGIAMDLTEKYHLEK 375
           Q V  +        +       D++++  +E+
Sbjct: 397 QVVMVKAYNQQQECIGHYCFMKDISDRREVER 428


>gi|220908073|ref|YP_002483384.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219864684|gb|ACL45023.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 1305

 Score =  426 bits (1096), Expect = e-117,   Method: Composition-based stats.
 Identities = 140/735 (19%), Positives = 268/735 (36%), Gaps = 67/735 (9%)

Query: 81  MTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPN 137
            +    L+L +        +       ++++AE  L    ++ R L E+    +L+   N
Sbjct: 127 DSVSDFLVLLQTKNTALAESQKLTRQLTRQRAE--LRSTSSRLRTLIENIQAGVLVEDEN 184

Query: 138 ELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGS 197
             +   +          +            +            +  +      L      
Sbjct: 185 RSIVLVNQAFCQLFAIPV-------PLENLQGMNCHECGE-CSKDLFLDPQGFLDGIDLI 236

Query: 198 ILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICV 257
           +      V      R+   LE  +  I+     +     YR     K+ +  +  +   +
Sbjct: 237 LQEGRLVVNEELQLRDGRVLERDYVPIVGDGNFYGHLWQYRDVTARKQAENAVKASEQRL 296

Query: 258 ETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIA 317
           + AL     GLW++N    + + S   YE++G    +     +   +L+H D+    +  
Sbjct: 297 KLALDAVEEGLWDWNLVTGEIYRSDRWYEMLGYCARDLADRNQLREQLVHPDDLAAMKNL 356

Query: 318 RSVTGKHVKQ-LDQIFHMRHASGADIWIQVRAQMM--RTISGGMNIIGIAMDLTEKYHLE 374
            S    +     +    MR  SG  +WI  R +++        + ++G  +D+TE+   E
Sbjct: 357 LSAHLNNQTPLYECEARMRTRSGGWLWILDRGRVVSRDREGNPLRMVGTHLDITERKQAE 416

Query: 375 KRYAEAD---------------------------QRLSKAIECTSEALVLWDKNDRLVMC 407
           +   +                             Q + + ++C    +   D +    + 
Sbjct: 417 EALQQQYKRVVLLKQLTEKVRQSLQPEEILKTTVQEVQQLLQCDRVLIFQLDADGSGTVV 476

Query: 408 NAN----YQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSR 463
                  +    G   +             +     I        +        +     
Sbjct: 477 QEAVVPGWTITLGQDINDPCLRMGYLDYYRSGRITAIADLEQANFQPCHREFLQQFQVRA 536

Query: 464 WLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE-- 521
            L +      +   + +    +  +       +  + L   +    T   +LE++     
Sbjct: 537 NLVVPILVRQELWGLLIVHQCSQPRQWTELELDLLKHLADQMGVALTQAHLLEQETRNAY 596

Query: 522 -LSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
            L+  N +    K  AE AN  KS FLA +SHE+RTP+NA++G S ++           +
Sbjct: 597 LLTRQNEELTAAKHAAEVANAAKSNFLAIVSHEIRTPMNAVIGMSGLLLDTCLTP----E 652

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
            ++Y + I  S   LL +IN+IL+ SKIE+ K+ +++Q  DL   I E + L+   A SK
Sbjct: 653 QFDYVETIRNSSDTLLTIINDILDFSKIESGKLELEEQPFDLRICIEEALDLLAPQAASK 712

Query: 641 NIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG-------- 690
            + +   I   L      D   +++IL+ +LSN++KFT   G+++I              
Sbjct: 713 GLDLVYFIDPHLPTQIIGDITRLRQILWNLLSNAVKFT-AMGEVVISVQGRELEFYPPFI 771

Query: 691 --QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
               +   + DTG+GI +  +E++ +PF        +  GG GLGLAIS  L+ L  GR+
Sbjct: 772 STYEIQFAVQDTGVGIAREQMERLFKPFSQGDASMTRRYGGTGLGLAISKRLSELMRGRM 831

Query: 749 KIISQEGKGTIVTIC 763
            + SQEGKG+     
Sbjct: 832 WVASQEGKGSTFYFT 846


>gi|295134137|ref|YP_003584813.1| two-component system sensor histidine kinase/response regulator
            hybrid [Zunongwangia profunda SM-A87]
 gi|294982152|gb|ADF52617.1| two-component system sensor histidine kinase/response regulator
            hybrid [Zunongwangia profunda SM-A87]
          Length = 1567

 Score =  424 bits (1090), Expect = e-116,   Method: Composition-based stats.
 Identities = 134/688 (19%), Positives = 258/688 (37%), Gaps = 58/688 (8%)

Query: 96   IFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKI 155
            I Q N+I     +Q+       +L       ++  I+ +  + ++   +    ++ G K 
Sbjct: 512  ISQINDITAAKEAQENINKSYRELQNMMDATTQVSIIESDLDGVIKKFNKGAENFFGYKA 571

Query: 156  GEIIPELSRSRSRSKTVQMSEAS---------LDQQPYHVLSVNLPHNSGSILIINSRVP 206
             E+I +        K                 +           +            +  
Sbjct: 572  EEMIEKEKFFIFHDKQEIKEREIELSKKYGEEIKGFDVFTAGPKIKDYESLEWTYIRKNG 631

Query: 207  LLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRC 266
                 R  V L +        ++   +        + K     L ++    + AL     
Sbjct: 632  E----RFPVQLVITAIKNSEGVITGYV-GVATDISQLKAIQEELKKSEQRWQFALEGSGD 686

Query: 267  GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSV-TGKHV 325
            G+W++  D+    LS    E++G    +   S     + IH  + +  E A        +
Sbjct: 687  GIWDWFVDSNTQFLSLRAKEMLGFEETDDLTSVEEWDKRIHPKDLEKSEKALQDYFTGKL 746

Query: 326  KQLDQIFHMRHASGADIWIQVRAQMMR--TISGGMNIIGIAMDLTEKYHLEKRYAEADQR 383
                    ++   G   WI  R +++        + +IG   D+T++   E++  E + R
Sbjct: 747  PIYHVEKRIKCKDGEYKWILDRGKVVEWTEDKKPLRMIGTQSDITDRKIAERKIKENEVR 806

Query: 384  LSKAIECTSEALVLWD-KNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
                 E +   + L D +N   +  N +   + G        G +   I   +  P++  
Sbjct: 807  FRSLYELSPIGIGLIDVENGTFIEANQSLITSSGYTKEEF-TGISYRKIVPKEFIPLVSD 865

Query: 443  RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
            +             + L +        +   DG T     +   +K    +         
Sbjct: 866  KFKK----------VVLNEKVEAFEKSFIKKDGTTFPALVNGAKIKDTNGKDIIL----- 910

Query: 503  ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
                          +  T            K +AE A+K+KSEFLA MSHE+RTPLN ++
Sbjct: 911  -----------ATIQDITRRKEMENSLVEAKLKAEAASKSKSEFLANMSHEIRTPLNGVI 959

Query: 563  GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
            GF++++ K            +Y + ++ S   LL++IN+IL+ SKIE  K+ +  +  ++
Sbjct: 960  GFTDLLMKTELNTS----QKQYMETVYNSANTLLDLINDILDFSKIEAGKLELSVEKINI 1015

Query: 623  IPIINEGIRLIGSSAQSKNIKIEKKIPSEL--FFNADKRIIKKILFPILSNSIKFTNNNG 680
            I +  + I ++   A  K +++   I  ++  +   D   I++IL  +L N++KFTN  G
Sbjct: 1016 IELCGQTIDVVKHKAHEKGLEVLLNISQKVDRYIYGDSVRIRQILTNLLGNAVKFTNK-G 1074

Query: 681  KMMIRTS------KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
            ++ +R        +  +     + DTGIGI    LE+I + F+   +   +  GG GLGL
Sbjct: 1075 EIELRIEAGNKNTEHQREYTFIVRDTGIGIAPQNLERIFKAFDQEDSSTTRKYGGTGLGL 1134

Query: 735  AISDALTNLHGGRLKIISQEGKGTIVTI 762
             IS+ L  L   +L + S+ G G+  + 
Sbjct: 1135 TISNKLLYLMNSKLDVQSEPGIGSSFSF 1162



 Score =  120 bits (300), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/244 (12%), Positives = 75/244 (30%), Gaps = 7/244 (2%)

Query: 230 LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH-LSRSMYEIM 288
              ++  ++   + K  +  L                G+   +    + +  + S  +I 
Sbjct: 250 TIRVYGAFQDITEQKLKENELKLTQSRFRDIFDNSPLGIILIDPKTNEVYHANESAKKIF 309

Query: 289 GIPY-ENKTLSFRAIARLIHYDNKKIC-EIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           G+    ++ +   +    I  ++ ++  E  + +           +      G  IW+Q 
Sbjct: 310 GLESLSSQEIQKFSFQNQIFEEDFELISEKRKKLLQGKFDNYRIEYRFYKDHGRIIWLQS 369

Query: 347 RAQMMRTISGGMNI-IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLV 405
              ++R   G   + I    D+T +  LE    +   +   A + +   + L   + + V
Sbjct: 370 FTSLLRAEDGSPRLIIAQVEDITLRKLLEAESFKNASQFKSAFDYSPNGMALVSLDGKWV 429

Query: 406 MCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPI---IEYRTSDPERSQDMSKEIKLADS 462
             N N  K  G     L+  +   +            +    +    + +M K     + 
Sbjct: 430 NVNRNLSKMIGYTQEELLEMSFMDVTYHEDLDKDLKLLSKLMAGEIDTYNMEKRYIHKEG 489

Query: 463 RWLQ 466
             L 
Sbjct: 490 HLLW 493



 Score =  114 bits (286), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 51/443 (11%), Positives = 131/443 (29%), Gaps = 30/443 (6%)

Query: 104 FDLASQKKAESMLGQLLAKTRF---LSESFILLAQPNELVFA-SSTKNSHYIGKKIGEII 159
            D+  QK  E+ L    ++ R     S   I+L  P       ++       G  +  + 
Sbjct: 258 QDITEQKLKENELKLTQSRFRDIFDNSPLGIILIDPKTNEVYHANESAKKIFG--LESLS 315

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
            +  +  S        +   +                               R       
Sbjct: 316 SQEIQKFSFQN-----QIFEEDFELISEKRKKLLQGKFDNYRIEYRFYKDHGRIIWLQSF 370

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
                       ++ +        K  +    +     ++A      G+   + D K  +
Sbjct: 371 TSLLRAEDGSPRLIIAQVEDITLRKLLEAESFKNASQFKSAFDYSPNGMALVSLDGKWVN 430

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKI-CEIARSVTGKHVKQLDQIFHMRHAS 338
           ++R++ +++G   E       +   + ++++     ++   +    +   +      H  
Sbjct: 431 VNRNLSKMIGYTQEELL--EMSFMDVTYHEDLDKDLKLLSKLMAGEIDTYNMEKRYIHKE 488

Query: 339 GADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA-LV 396
           G  +W  +   + +  +G     I    D+T     ++   ++ + L   ++ T++  ++
Sbjct: 489 GHLLWGLLTVSLQKDENGKPLYFISQINDITAAKEAQENINKSYRELQNMMDATTQVSII 548

Query: 397 LWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKE 456
             D +  +   N   +  +G     ++      I  D Q     E   S     +    +
Sbjct: 549 ESDLDGVIKKFNKGAENFFGYKAEEMIEKEKFFIFHDKQEIKEREIELSKKYGEEIKGFD 608

Query: 457 I-----KLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
           +     K+ D   L+       +G    V   IT +K+++  +                 
Sbjct: 609 VFTAGPKIKDYESLEWTYIR-KNGERFPVQLVITAIKNSEGVITGYVGVATDISQ----- 662

Query: 512 RQILERQKTELSIANAKYQVEKE 534
              L+  + EL  +  ++Q   E
Sbjct: 663 ---LKAIQEELKKSEQRWQFALE 682



 Score =  113 bits (283), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/249 (13%), Positives = 78/249 (31%), Gaps = 11/249 (4%)

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
           L + N   E      R G W  +  N + H ++   +I  +  +        +   +  +
Sbjct: 143 LKKLNEIFEKTNEVARVGGWMVDLVNNQIHWTKVTKDIHEVDEDFVPSMQTGLDFYLEGE 202

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
           N+       +   ++       F +  A G   W++V     +     + + G   D+TE
Sbjct: 203 NRDRITRIFTEVAENGGSYIDNFQILTAKGHIKWVKVFGNAEQEAGRTIRVYGAFQDITE 262

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDR-LVMCNANYQKAYG---LPDHVLVPG 425
           +   E        R     + +   ++L D     +   N + +K +G   L    +   
Sbjct: 263 QKLKENELKLTQSRFRDIFDNSPLGIILIDPKTNEVYHANESAKKIFGLESLSSQEIQKF 322

Query: 426 NARSIIQDAQTRPIIEYRTSDPER---SQDMSKEIKLADSRWLQ----INEWCTHDGGTI 478
           + ++ I +     I E R    +    +  +         R +      +     DG   
Sbjct: 323 SFQNQIFEEDFELISEKRKKLLQGKFDNYRIEYRFYKDHGRIIWLQSFTSLLRAEDGSPR 382

Query: 479 SVGTDITLL 487
            +   +  +
Sbjct: 383 LIIAQVEDI 391


>gi|307592365|ref|YP_003899956.1| multi-sensor signal transduction histidine kinase [Cyanothece sp. PCC
            7822]
 gi|306986010|gb|ADN17890.1| multi-sensor signal transduction histidine kinase [Cyanothece sp. PCC
            7822]
          Length = 1490

 Score =  424 bits (1089), Expect = e-116,   Method: Composition-based stats.
 Identities = 125/691 (18%), Positives = 257/691 (37%), Gaps = 62/691 (8%)

Query: 87   LMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAK---TRFLSESFILLAQPNELVFAS 143
             ML +    + +  ++  D+   K+ E  L +   +       S   I            
Sbjct: 847  RMLFDNQGNLIELQSVGRDITELKQVEGALRESQERLQLALEASGDGIWDWNILTDEVYL 906

Query: 144  STKNSHYIGKKIGEIIPELSR--SRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILII 201
              +    +G K  E+    S        + +   +  L++        +L + +      
Sbjct: 907  DPQFFQMLGYKADELTSSFSTWEQLVHPEDLIWVKERLEK--------HLENTAVDYRFD 958

Query: 202  NSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETAL 261
                     W+       V         L ++ + +R     K  +  LLE+      AL
Sbjct: 959  YRLQTKSNEWKWIANYGKVVAIDEKGKPLRMI-AIHRDINDRKLFEAALLESEEQRRLAL 1017

Query: 262  SRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVT 321
                 G W++     +   + + + ++G+P  N    +      IH ++K+  E   + +
Sbjct: 1018 DLTHIGFWDWQIPTGQLIWNENHFTLLGLPSNNPKPRYEDWRDCIHPEDKERVEQLYTKS 1077

Query: 322  GKHVKQLDQIFHMRHASGADIWIQVRAQMMRT-ISGGMNIIGIAMDLTEKYHLEKRYAEA 380
             +     +  + + H  G+  W+  RA+ +       +  +G+ +D+T++ H+E    E+
Sbjct: 1078 IETHTDYESEYRIIHPDGSVHWLMARAKAIYDLEGQPVRSLGVLLDITDRKHIEASLRES 1137

Query: 381  DQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII 440
            D+R    ++     ++  D +  +   N  + K  G     ++       +   +  P+ 
Sbjct: 1138 DRRWQSLLDNVQLVVIGLDLDGYIEYANPFFLKLTGYQLEEVLGQYWFDFLNPQEKHPLK 1197

Query: 441  EYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRR 500
                   E++     +           N   T  G    +  + T+LK    +   +   
Sbjct: 1198 IIFKEVLEQNFHPYYQ-----------NSVMTKSGEERMIAWNNTILKDVAGEPIGTMS- 1245

Query: 501  LKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNA 560
                         I ER K E                     K+EF++ +SHELRTPL +
Sbjct: 1246 ---------IGEDITERDKVER-------------------MKAEFISVVSHELRTPLTS 1277

Query: 561  ILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNA 620
            +     ++ ++I     S +     Q        L+ ++N+IL++ ++E+ KI + K   
Sbjct: 1278 MQAALSLLSEKIIDP-NSPEGEATIQIATEGTDRLVRLVNDILDLERLESGKIRLKKSLC 1336

Query: 621  DLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNG 680
            ++I +I   I  +   A   NI ++  I       AD   I ++L  +LSN+IKF+ ++ 
Sbjct: 1337 NVIDLIETAIAQMQEMANQANITLKF-ILCSFQIEADADRILQVLTNLLSNAIKFSPHHS 1395

Query: 681  KMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLA 735
             + +   +         +   + D G GIP + L+ I   F  +     ++ GG GLGLA
Sbjct: 1396 TIELSVEEQQDEGVKGVLRFGVRDQGRGIPSAHLDSIFARFGQVDASDSRTKGGTGLGLA 1455

Query: 736  ISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            I  ++   HGG++   S  G+G+     +P+
Sbjct: 1456 ICRSIVEQHGGKIWAESIAGQGSTFYFTLPK 1486



 Score =  142 bits (357), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 52/260 (20%), Positives = 92/260 (35%), Gaps = 10/260 (3%)

Query: 266 CGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHV 325
            G+W ++        +   Y ++G    N   S+R     I+ D+    E          
Sbjct: 43  IGVWEWDITTGVMKGNDYYYRLLGYEPGNLEPSYRLWRNQIYPDDVGSVENKLIQALTKK 102

Query: 326 KQLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRL 384
              D  F +    G   W Q + Q +   +G  + ++G+  D++E+   E+  A+ +Q+L
Sbjct: 103 TGYDVEFRVLLKDGTIRWQQSKGQGIYNEAGQAVRMVGVTFDISERKEREETLAKDEQKL 162

Query: 385 SKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD--AQTRPIIEY 442
           S  + C   ++ + D N   +  +  +   Y L +   + G+    I     Q    I  
Sbjct: 163 SLFVRCAPVSVAMLDTNMNYIAVSQRWVDVYHLGEIEAILGHCHYEIFPNIPQRWREIHQ 222

Query: 443 RTSDPERSQDMSKEIKLADSR--WLQINEWCTH-----DGGTISVGTDITLLKHNQAQLR 495
           R    E  +       L D    WL+             GG      DIT LK  Q  L 
Sbjct: 223 RGLVGELIKCEEDRFTLPDGTVQWLKWEVQPWRHKTGQIGGIFIFVEDITELKQAQTTLE 282

Query: 496 ESKRRLKATINDLSTSRQIL 515
           +  ++        S  R+ L
Sbjct: 283 QQIQQEYLLGEIASDIRRSL 302



 Score =  135 bits (341), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/523 (10%), Positives = 158/523 (30%), Gaps = 58/523 (11%)

Query: 55  ISMVFLVFIATSSIIKVTT------RYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLAS 108
           + +  L+      ++ V          + +  +  + +  ++ A++          +L+ 
Sbjct: 400 LVVPLLLEEQLWGLLIVHHCSAPRVWQSSEITLLQRLATQVSIAVQQSELYEQRGRELSE 459

Query: 109 QKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRS 165
           +K+ +++L +     R L   +   I     + +   S+ +     G+ +   +      
Sbjct: 460 RKRIQNILQKSEELFRSLSAAAPIGICQIDADGMCIYSNRRWQKMSGQDLTNSLGYGWLE 519

Query: 166 RSRSKTVQM----SEASLDQQPYHV-LSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
               +   +     +  L  +   +     L        +     P+     E +     
Sbjct: 520 AIHPEDRGLCLRGWKTYLQGKGRFLSEFRLLTPQKKVHWVWVQVAPMQSATGEIIGHVCT 579

Query: 221 FFSIISALLLFILFS----------------YYRQAKKNKENDTILLEANICVETALSRG 264
           +  I +     +                     ++  + +  +  +  +    +  ++  
Sbjct: 580 YEEITARKQAELALQKLNEELEIRVSQRTVELEQELLRRERIEQEIRHSEARFQAFMAHN 639

Query: 265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKH 324
               W  + + +  + +++ Y+   +  +        +  L   +  +          K 
Sbjct: 640 PACAWITDSNGQMLYANQTYYQTFQLLNQEVIGHN--LFELYPDEIAQHYLNNIQAVVKS 697

Query: 325 VKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRL 384
              L+   H     G      V   ++   S    + GIA+D+TE+  +EK    ++ R 
Sbjct: 698 QTTLETSRHSLKPDGTMGEFLVYNFLVPNSSDEQLVGGIAVDITERKRIEKALQASEIRY 757

Query: 385 SKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRT 444
              IE  +E +  +  +  ++  N  Y + + +    ++  +   +I +A    + +   
Sbjct: 758 RAIIEDQTEMIARFLPDSTVLFVNEAYCRYFNIKREEILNKSYSPVIYEADLEKVNQLVE 817

Query: 445 SDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKAT 504
           S    +  +  E ++ D R           G                    +   R+   
Sbjct: 818 SMSIETPMLVIENRVIDGR-----------GEVRWT---------------QWVNRMLFD 851

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFL 547
                   Q + R  TEL       +  +ER + A +   + +
Sbjct: 852 NQGNLIELQSVGRDITELKQVEGALRESQERLQLALEASGDGI 894



 Score = 67.3 bits (163), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 49/371 (13%), Positives = 112/371 (30%), Gaps = 32/371 (8%)

Query: 212 REEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF 271
           R + +     ++     +  +  ++     + KE +  L +    +   +      +   
Sbjct: 119 RWQQSKGQGIYNEAGQAVRMVGVTF--DISERKEREETLAKDEQKLSLFVRCAPVSVAML 176

Query: 272 NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ- 330
           + +     +S+   ++             AI    HY+             +     +  
Sbjct: 177 DTNMNYIAVSQRWVDVY------HLGEIEAILGHCHYEIFPNIPQRWREIHQRGLVGELI 230

Query: 331 ---IFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAM-DLTEKYHLEKRYAEADQRLSK 386
                      G   W++   Q  R  +G +  I I + D+TE    +    +  Q+   
Sbjct: 231 KCEEDRFTLPDGTVQWLKWEVQPWRHKTGQIGGIFIFVEDITELKQAQTTLEQQIQQEYL 290

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVL------VPGNARSIIQDAQTRPII 440
             E  S+     + ++ L       +        ++        G+  S     Q  PI+
Sbjct: 291 LGEIASDIRRSLNLDEVLSRTVHRVRDFLQTDRVIIFRFRPDWQGDVISESVAEQWTPIL 350

Query: 441 EYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDIT---------LLKHNQ 491
                DP               R   +++  + +  T  V    T          L   +
Sbjct: 351 STTIYDP--CFSECYIDPYRQGRVAMMSDIDSLELETCYVELLKTFQVKANLVVPLLLEE 408

Query: 492 AQLRESKRRLKATINDLSTSRQI-LERQKTELSIANAKYQVEKERAETANKTKS-EFLAK 549
                      +      +S    L+R  T++SIA  + ++ ++R    ++ K  + + +
Sbjct: 409 QLWGLLIVHHCSAPRVWQSSEITLLQRLATQVSIAVQQSELYEQRGRELSERKRIQNILQ 468

Query: 550 MSHELRTPLNA 560
            S EL   L+A
Sbjct: 469 KSEELFRSLSA 479



 Score = 66.2 bits (160), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 54/535 (10%), Positives = 133/535 (24%), Gaps = 81/535 (15%)

Query: 83  NQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAK---TRFLSESFILLAQPNEL 139
                 +        +   + FD++ +K+ E  L +   K       +   + +   N  
Sbjct: 122 QSKGQGIYNEAGQAVRMVGVTFDISERKEREETLAKDEQKLSLFVRCAPVSVAMLDTNMN 181

Query: 140 VFASSTKNSHYIGK-KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSI 198
             A S +        +I  I+         +   +  E         ++       +   
Sbjct: 182 YIAVSQRWVDVYHLGEIEAILGHCHYEIFPNIPQRWREIHQRGLVGELIKCEEDRFTLPD 241

Query: 199 LIINSRVPLLRLWREEVTLEVVFFSIISALLLF---------------ILFSYYRQAKKN 243
             +      ++ WR +       F  +  +                  +L       +++
Sbjct: 242 GTVQWLKWEVQPWRHKTGQIGGIFIFVEDITELKQAQTTLEQQIQQEYLLGEIASDIRRS 301

Query: 244 KENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIA 303
              D +L      V   L   R  ++ F  D +   +S S+ E          LS     
Sbjct: 302 LNLDEVLSRTVHRVRDFLQTDRVIIFRFRPDWQGDVISESVAEQW-----TPILSTTIYD 356

Query: 304 RLIHYDNKKICEIARSVTGKHVKQLDQI-----------------------------FHM 334
                         R      +  L+                                 +
Sbjct: 357 PCFSECYIDPYRQGRVAMMSDIDSLELETCYVELLKTFQVKANLVVPLLLEEQLWGLLIV 416

Query: 335 RHASGADIWIQVRAQMMRTISGGMNIIGIA--------MDLTEKYHLEKRYAEADQRLSK 386
            H S   +W      +++ ++  ++I             +L+E+  ++    ++++    
Sbjct: 417 HHCSAPRVWQSSEITLLQRLATQVSIAVQQSELYEQRGRELSERKRIQNILQKSEELFRS 476

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
                   +   D +   +  N  +QK  G      +       I        +    + 
Sbjct: 477 LSAAAPIGICQIDADGMCIYSNRRWQKMSGQDLTNSLGYGWLEAIHPEDRGLCLRGWKTY 536

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
            +       E +L            T       V   +  ++    ++          I 
Sbjct: 537 LQGKGRFLSEFRL-----------LTPQKKVHWVWVQVAPMQSATGEIIG-HVCTYEEIT 584

Query: 507 DLSTSRQILERQKTELS--------IANAKYQVEKERAETANKTKSEFLAKMSHE 553
               +   L++   EL             +    +   +    +++ F A M+H 
Sbjct: 585 ARKQAELALQKLNEELEIRVSQRTVELEQELLRRERIEQEIRHSEARFQAFMAHN 639


>gi|124009081|ref|ZP_01693764.1| PAS [Microscilla marina ATCC 23134]
 gi|123985295|gb|EAY25215.1| PAS [Microscilla marina ATCC 23134]
          Length = 1290

 Score =  423 bits (1088), Expect = e-116,   Method: Composition-based stats.
 Identities = 128/698 (18%), Positives = 268/698 (38%), Gaps = 68/698 (9%)

Query: 102  IKFDLASQKKAESMLGQLL-----AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIG 156
            +  ++  +K  E  L          K      + +        +  ++   +   G    
Sbjct: 472  VMQNITQRKVDEHKLKSSHKTLSDFKMALDEATIVATIDLQGNITYANDNFATISGYATH 531

Query: 157  EIIPELSRSRSRSKTV---QMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
            E+           K     +        + +   + N+  +     +  + +P L   + 
Sbjct: 532  ELTGRHYDVLIPKKQALSSEALNTVQSGKVWQGETNNVHKSGKQYWLKTTIIPFLNDRKL 591

Query: 214  EVTLEVVFFSII----------SALLLFILFSYYRQAK--KNKENDT-------ILLEAN 254
                 ++   I              L   + +   QA   + ++ +         L E+ 
Sbjct: 592  PFQYMIICMDITDHKKAEETVKLQYLQIEMQNQELQATNEELRQTNEVLFSTMEQLRESE 651

Query: 255  ICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC 314
              +  A    + G+W+++  N      + M+E+ G    +   ++ A  + +H D+KK  
Sbjct: 652  QRLSLATLSAKMGIWDWDLLNNHLVWDKQMFELYGCKPGDFPNAYDAWEKHLHPDDKKQV 711

Query: 315  EIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHL 373
             +   +  +   + +  F + H +G    I+   +++       + +IGI  D+T +   
Sbjct: 712  YLDSLLAREGKAEYNTEFRVCHPNGNIRHIKGFGKVVFDDHAQPVRMIGINWDITTQKRA 771

Query: 374  EKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD 433
            E+      + L + ++     + + D   RL+  N    + Y +    ++      I  +
Sbjct: 772  EEDLTNQKRILEQILDTLPINIYIKDDEGRLMFLNKATCQTYRITKE-ILGKTDAEIFPE 830

Query: 434  AQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
                  ++        ++  + E ++    W  +N         IS              
Sbjct: 831  YLAEAFVKDDMLVRAGTKPGTWEEQI---SWQHLNIDLLVGKKLISFE------------ 875

Query: 494  LRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
              ++K       +   T+R+  ER          +    K++AE A   K +FL+ MSHE
Sbjct: 876  --KNKAPYILGYSLDITARKRFER----------ELITAKQKAEEAALAKEQFLSTMSHE 923

Query: 554  LRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKI 613
            +RTP+NA++G + V+ +        V   E  + + +S Q LL++IN+IL+ +KI+  K+
Sbjct: 924  IRTPMNAVIGMTHVLLENK----PRVDQLENLKILKFSAQTLLSLINDILDFTKIDAGKV 979

Query: 614  SIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSN 671
              ++   DL  +I    +    +AQ KNI+++    + +      D   + ++L  +++N
Sbjct: 980  EFEEVLFDLPELIESIQKSFAFTAQEKNIQLKFSTDTNIPHKVIGDPVRLTQVLTNLMNN 1039

Query: 672  SIKFTNNNGKMMIRTSKIGQ-----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
            +IKFT   G++ +    I Q      +  T+ DTG+GIPK   + I   F   + +  + 
Sbjct: 1040 AIKFTLK-GEVKLMLQLITQNNRQVQLRFTVKDTGVGIPKEKQQIIFDRFTQANPETIRK 1098

Query: 727  IGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
             GG GLGLAI   L  L   ++ + S+E KG      +
Sbjct: 1099 FGGTGLGLAIVKRLLELQDSQIHLESEENKGAKFYFDL 1136



 Score =  195 bits (496), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 65/495 (13%), Positives = 147/495 (29%), Gaps = 35/495 (7%)

Query: 49  NQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLAS 108
            + +P +++V L+ I    +     +    +       L+L++  E      N + +L  
Sbjct: 175 MKHVPFMNLVILITILFLVMGFQFMQNLHHKYNNKN-LLLLSKNAEQKEALKNTQKELKK 233

Query: 109 QKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSR 168
                 +L +        S   I     N  +  +S      +G  + E         + 
Sbjct: 234 NVILYQILTE-------NSSDLIERFDRNHQLIYTSPSIERILGYTLQERKKIKLTQIAH 286

Query: 169 SKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISAL 228
                     + +        N          +         +     +   FF      
Sbjct: 287 PDDAHWLLQKIQE--------NTAKQQKYSTYVFRARHKQGHYIWLEVVANAFFDSNGQY 338

Query: 229 LLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIM 288
              I  +  R   +  E +  L         A +    G+W +   N +   S     ++
Sbjct: 339 EGAISSA--RDVSERMEAEKKLQANEERFRLAQNFANIGIWEWTPTNNEMLWSPQTNYLL 396

Query: 289 GIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRA 348
           G+ ++    SF    + +H D++ + +     +   VK+ +    +    G   W++ + 
Sbjct: 397 GLYHQVGKPSFEVFMKAVHPDDQAMVQAKMQHSVNTVKKYELEHRVVWQDGTIYWVKSQG 456

Query: 349 QMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA--LVLWDKNDRLV 405
            + R   G  M ++G+  ++T++   E +   + + LS       EA  +   D    + 
Sbjct: 457 NVQRDQYGNVMKMLGVMQNITQRKVDEHKLKSSHKTLSDFKMALDEATIVATIDLQGNIT 516

Query: 406 MCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWL 465
             N N+    G   H L  G    ++   +     E   +                  W 
Sbjct: 517 YANDNFATISGYATHEL-TGRHYDVLIPKKQALSSEALNTVQSGKV------------WQ 563

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
                    G    + T I    +++    +          D   + + ++ Q  ++ + 
Sbjct: 564 GETNNVHKSGKQYWLKTTIIPFLNDRKLPFQYMIICMDI-TDHKKAEETVKLQYLQIEMQ 622

Query: 526 NAKYQVEKERAETAN 540
           N + Q   E     N
Sbjct: 623 NQELQATNEELRQTN 637


>gi|119898741|ref|YP_933954.1| putative two-component system sensor protein [Azoarcus sp. BH72]
 gi|119671154|emb|CAL95067.1| putative two-component system sensor protein [Azoarcus sp. BH72]
          Length = 916

 Score =  422 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 131/681 (19%), Positives = 262/681 (38%), Gaps = 56/681 (8%)

Query: 97  FQNNNIKFDLASQKKAESMLGQLLAKTRF-LSESFILLAQPNELV--FASSTKNSHYIGK 153
            Q  +I+ D+ + K+ +  L     + R   + + I     N +      S + +   G 
Sbjct: 121 EQYISIRTDITAVKQQQQALLISEERLRRGQAAANIGTWDWNMVTGELFWSERIAPLFG- 179

Query: 154 KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
                +PE  R    +  +        +                  + +  V      R 
Sbjct: 180 -----LPEDLRETRYAAFLSAIHPDDREHV-LAAVRATVDEDRPYEVEHRVVWPDGTVRW 233

Query: 214 EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE-------TALSRGRC 266
            +    V            +    +   + K  +  L E+   +         A+     
Sbjct: 234 LLERGAVTRDAEGN--AVHMLGVVQDIHERKIAELSLAESEQRLRETQARFSFAVEGAGD 291

Query: 267 GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKK-ICEIARSVTGKHV 325
           G+W+++  + +   S     ++G        S +A  R +H  +            G  +
Sbjct: 292 GVWDWDVASGRMMYSGHYEAMLGYAPGEIEPSVKAWMRSVHPADIASAQARMMDYLGGRL 351

Query: 326 KQLDQIFHMRHASGADIWIQVRAQMMRT--ISGGMNIIGIAMDLTEKYHLEKRYAEADQR 383
                 + +    G   W+  R  ++          +IGI  D++E    E+R A     
Sbjct: 352 PTFSTEYRLHCKDGGYKWVLCRGTVVEREPDGRARRLIGIHSDISESKAAEERLA----L 407

Query: 384 LSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYR 443
             + I+ +S+ + + D   RL+  N  + +  G  D  +  G   + +       ++  +
Sbjct: 408 FRRVIDASSQCVGIADGTGRLLYQNRAHARLLGYEDDEIA-GMPVARLLPLDDGGVLAAQ 466

Query: 444 TSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKA 503
                +               +        DG   +  ++I  +K  + Q +        
Sbjct: 467 IFGMVQDARG----------LVGQLPMRRKDGTVFTSFSNIGFVKDARGQTQYIFNIFTD 516

Query: 504 TINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILG 563
                            EL+  N      K+ AE AN+ KS+FL+ MSHELRTP+NA+LG
Sbjct: 517 F--------------TEELARRNE-LAEAKDTAERANQAKSDFLSSMSHELRTPMNAVLG 561

Query: 564 FSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLI 623
           F+++++     +  +    +   +I  +G HLL +IN +L++++IE  +I +  +   L 
Sbjct: 562 FAQLLEC---DDTLTADQRDNVAEILKAGGHLLTLINEVLDLARIEAGRIDLSLEPVALR 618

Query: 624 PIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMM 683
             +++  +LI   A ++ I +E  +P EL   AD+  +K++L  +LSN++K+    G++ 
Sbjct: 619 EAVDDCRQLIQPLAAARAIVLEMSLPDELVVRADRTRLKQVLLNLLSNAVKYNREGGRVS 678

Query: 684 IRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNL 743
           +        + ++++DTG GI    +  + +PFE L      +I G G+GL I+  L  L
Sbjct: 679 LAAQCREGRLRLSVSDTGAGIAPERMAALFEPFERL-GAEASAIEGTGIGLTITRRLMEL 737

Query: 744 HGGRLKIISQEGKGTIVTICM 764
            GG +   S+ G+G+   I +
Sbjct: 738 MGGEIGAESRVGEGSTFWIEL 758



 Score =  204 bits (519), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 55/409 (13%), Positives = 124/409 (30%), Gaps = 39/409 (9%)

Query: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKT-----VQMS 175
                   + + +      +  ++       G    E++    R    ++        + 
Sbjct: 22  LAYVLDQHAIVSVTDAAGRIIDANPLFCEISGYSRDELLGRNHRMLKSTRHGAEFYAGIW 81

Query: 176 EASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFS 235
                 + +H    N   +     + ++ VP                            S
Sbjct: 82  ATIAGGRTWHGEICNRRKDGSEYWVRSTIVPFPGPDGRPEQY----------------IS 125

Query: 236 YYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENK 295
                   K+    LL +   +    +    G W++N    +   S  +  + G+P + +
Sbjct: 126 IRTDITAVKQQQQALLISEERLRRGQAAANIGTWDWNMVTGELFWSERIAPLFGLPEDLR 185

Query: 296 TLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTIS 355
              + A    IH D+++    A   T    +  +    +    G   W+  R  + R   
Sbjct: 186 ETRYAAFLSAIHPDDREHVLAAVRATVDEDRPYEVEHRVVWPDGTVRWLLERGAVTRDAE 245

Query: 356 GG-MNIIGIAMDLTEKYHLEKRYAEADQRLSK-------AIECTSEALVLWDKNDRLVMC 407
           G  ++++G+  D+ E+   E   AE++QRL +       A+E   + +  WD     +M 
Sbjct: 246 GNAVHMLGVVQDIHERKIAELSLAESEQRLRETQARFSFAVEGAGDGVWDWDVASGRMMY 305

Query: 408 NANYQKAYGLPDHVLVPG-NARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQ 466
           + +Y+   G     + P   A             + R  D    +  +   +        
Sbjct: 306 SGHYEAMLGYAPGEIEPSVKAWMRSVHPADIASAQARMMDYLGGRLPTFSTEYR------ 359

Query: 467 INEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
                  DGG   V    T+++            + + I++   + + L
Sbjct: 360 ---LHCKDGGYKWVLCRGTVVEREPDGRARRLIGIHSDISESKAAEERL 405


>gi|209965866|ref|YP_002298781.1| sensory box histidine kinase [Rhodospirillum centenum SW]
 gi|209959332|gb|ACI99968.1| sensory box histidine kinase [Rhodospirillum centenum SW]
          Length = 1057

 Score =  422 bits (1085), Expect = e-115,   Method: Composition-based stats.
 Identities = 135/789 (17%), Positives = 275/789 (34%), Gaps = 76/789 (9%)

Query: 13  LYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVT 72
           LY   +R  +       F       +    +F +     +   ++      A + +    
Sbjct: 158 LYDAEDRVMLFNQRFLDFFPELAPYVRPGITFEAVMRNLMASGTLPIPPEKAEAWLTDRL 217

Query: 73  TRYAQQ-----EKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLS 127
            R+          +     + + E       + ++  D+ + + +E  L  L+  +    
Sbjct: 218 HRHRNPGPPFETALGKDRIIRVAEHRTGAGGHVSLVVDVTALRTSERRLRDLIDGSLQG- 276

Query: 128 ESFILLAQPNELVFASSTKNSHYIGKKIGEII--PELSRSRSRSKTVQMSEASLDQQPYH 185
               ++      V  ++   +   G    E +            +   ++  SLD+    
Sbjct: 277 ----IVIHRGFDVLYANQSFAGIFGFDTAEALLEGGSLDFIIPPENKGLARRSLDRLLRE 332

Query: 186 VLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKE 245
             S           +   R    R+W E     V +    +      L S      +   
Sbjct: 333 GGSFQRS------RVAALRRDGTRIWIEVAVRSVDWLDGPA------LQSIVMDVTERAR 380

Query: 246 NDTILLEANICVETALSRGRCGLWNFNFDNKKF----HLSRSMYEIMGIPYENKTLSFRA 301
            +  L  +       +S     ++ +           ++S    E+ GI  E+    +  
Sbjct: 381 AEDALAASEARFRDLVSTVPGLVYQWYERTGGVHGYSYVSPRSREMYGIAPEDLVRDWSL 440

Query: 302 IARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNII 361
           +   IH +++       +                   G+  W +  ++ +R     +   
Sbjct: 441 LP--IHPEDQDRWRRTIADAVLRETDWSFEGRFILPDGSVRWWRAVSRPVRVGPDEVRFN 498

Query: 362 GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND-RLVMCNANYQKAYGLPDH 420
           GI +D+ E+   E      +  L  +         +WD+       C+       G+   
Sbjct: 499 GIVIDIEEQKRAEAELQSREAMLRYSASLAGLGYWVWDRRLAWTTYCSPELAAIRGVTVE 558

Query: 421 VLVP--GNARSIIQDAQTRPIIEYR-----TSDPERSQDMSKEIKLADS--RWLQINEWC 471
             +   G+    ++  Q      YR      +   R+  +   I   D   R+++     
Sbjct: 559 EYLETLGSFEQQLRWIQPEDRDYYRTHALDVARSRRTYVVEYRILRPDGQTRYVREVGGP 618

Query: 472 THDGG-----TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIAN 526
            +D        +    DIT  K                  +L  +R  LERQ +E++   
Sbjct: 619 VYDDRGELVKYVGALQDITDRKQ--------------RELELEEARDRLERQASEMTALA 664

Query: 527 AKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQ 586
            + Q  ++ AE A++ KS FLA MSHELRTP+  ++G  +++     G   +     Y +
Sbjct: 665 LELQTARDAAEAASRAKSRFLAVMSHELRTPMTGVIGMIDLLL----GTTVTSDQRRYLE 720

Query: 587 DIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEK 646
            +H S   LL ++N+IL+ SKIE  ++ I+     L  ++++ I L   +A  K +++  
Sbjct: 721 TLHSSADALLVVLNDILDFSKIEAGQLVIEAIPVRLQALLDDVIDLFAPAASQKGVELRV 780

Query: 647 KIPS-------ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-----VI 694
           + P              D   ++++L  ++ N++KFT   G + +R     +      + 
Sbjct: 781 RQPERRQKNRLPKELTGDPTRLRQVLMNLVGNAVKFTPA-GSIELRAEAQREDGGTWLLR 839

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
             + DTGIGIP   +  + + F        +  GG GLGLAI   L  + GG + + S+ 
Sbjct: 840 FEVEDTGIGIPPDVVPMLFESFTQADASTTRRFGGTGLGLAICKRLVTMMGGEIGVRSEP 899

Query: 755 GKGTIVTIC 763
            +G++    
Sbjct: 900 RRGSVFWFT 908



 Score = 48.8 bits (115), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 50/131 (38%), Gaps = 11/131 (8%)

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQ---- 432
             EA   L   +E   + L+L+D  DR+++ N  +   +      + PG     +     
Sbjct: 138 AQEAATHLIDGLERLKDGLILYDAEDRVMLFNQRFLDFFPELAPYVRPGITFEAVMRNLM 197

Query: 433 -------DAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDIT 485
                    +             R+     E  L   R +++ E  T  GG +S+  D+T
Sbjct: 198 ASGTLPIPPEKAEAWLTDRLHRHRNPGPPFETALGKDRIIRVAEHRTGAGGHVSLVVDVT 257

Query: 486 LLKHNQAQLRE 496
            L+ ++ +LR+
Sbjct: 258 ALRTSERRLRD 268


>gi|309388338|gb|ADO76218.1| PAS/PAC sensor hybrid histidine kinase [Halanaerobium praevalens
           DSM 2228]
          Length = 921

 Score =  422 bits (1085), Expect = e-115,   Method: Composition-based stats.
 Identities = 130/649 (20%), Positives = 253/649 (38%), Gaps = 54/649 (8%)

Query: 130 FILLAQPNE--LVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVL 187
           FI+    N+       +  +    G K   I  +       ++  Q  +A   +      
Sbjct: 22  FIIEVDQNKDFRFLKLNPTHEKLTGLKTENIYGKTPVEVLGAEMGQAVQACYQRCLDQKQ 81

Query: 188 SVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKEND 247
           ++N          +        +W      ++        +   +  +  R   + K+ +
Sbjct: 82  TINYEE-------VLEFPTGTTVW----ATKLSPVLEAGEVNYIVGSA--RNISQRKKLE 128

Query: 248 TILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIH 307
               E +   + A S    G+W  +    +      M +I  I   +   S+++    I+
Sbjct: 129 EEKEELSRRYKLATSAAAIGVWKLDLVTDELIWDEYMLKIYEIDDHSD-YSYQSWTEHIY 187

Query: 308 YDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMN-IIGIAMD 366
             ++K           + +  D  F +   SG   +I+   + ++   G    +IG+  D
Sbjct: 188 IKDRKETSSKFKKAVANGQIFDHEFRIITKSGTFKYIKSFGKPVKNAEGKTKEVIGVNYD 247

Query: 367 LTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND-RLVMCNANYQKAYGLPDHVLVPG 425
           +TE+   EK+         +  + +   L L +    + V  N    +  G         
Sbjct: 248 ITERKKYEKK-------FKRIFDESLFGLALINPRTTKAVEFNNTVCELLGYTREEFAQL 300

Query: 426 NARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDIT 485
                 +       I ++       + +  E K               DG  I V    +
Sbjct: 301 K-IEDYEALADPSSIRFKLEKLAEGEKLKFETKHIK-----------KDGSLIDVLIKAS 348

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
            +  N   L +        I +   +   +E    EL + N + +  +++A  A++ KSE
Sbjct: 349 SINLNGLNLVQIV---YVDITEKVEALNKMEEYSNELKLKNLELKQARDKAMEASRAKSE 405

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FL+ MSHE+RTP+N+I+G +E++++       S +  +Y      +G+ LL +IN+IL++
Sbjct: 406 FLSTMSHEIRTPMNSIIGMAELLQETEL----SEQQQKYINIFQNAGESLLTLINDILDL 461

Query: 606 SKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKK 663
           SKIE  +I ++ +  +L+  +     +I   A  K +++  +I +E+      D   I++
Sbjct: 462 SKIEAGRIELEAEKFNLVETVENIAEMISLRAFKKGLELPLRIAAEVPECVIGDSERIRQ 521

Query: 664 ILFPILSNSIKFTNNNGKMMIRTSKIGQ-------CVIITIADTGIGIPKSALEKIGQPF 716
           IL  +L N++KFT   G++ +      +        VI  I DTGIGI K+  ++I   F
Sbjct: 522 ILINLLGNAVKFT-EKGQVFLDLRIDSEFKSKDQKQVIFAIKDTGIGIEKAKQKQIFDSF 580

Query: 717 EPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
               +   +  GG GLGL IS  L  L GG++ + S    G+     +P
Sbjct: 581 TQADSSSTRKYGGTGLGLTISKQLVELMGGKIWLKSTPQLGSTFYFSLP 629


>gi|209965762|ref|YP_002298677.1| signal transduction histidine-protein kinase BarA [Rhodospirillum
           centenum SW]
 gi|209959228|gb|ACI99864.1| signal transduction histidine-protein kinase BarA [Rhodospirillum
           centenum SW]
          Length = 780

 Score =  422 bits (1084), Expect = e-115,   Method: Composition-based stats.
 Identities = 126/530 (23%), Positives = 245/530 (46%), Gaps = 22/530 (4%)

Query: 244 KENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYEN-KTLSFRAI 302
           +     L +    ++  ++    G+W++N       ++     I+G      + +S    
Sbjct: 193 RLVRAELRDQKERMDQVIAGTGVGIWDWNPQTGVLIINERWAGIVGYTLAELQPVSIATW 252

Query: 303 ARLIHYDNKKICEIARS-VTGKHVKQLDQIFHMRHASGADIWIQVRAQMM-RTISGGM-N 359
            RL+H  + +  E     V             MRH +G  +W++   ++M R  +G    
Sbjct: 253 RRLVHPQDLEKAETLLEDVFAGRSPLYACDIRMRHKAGHWVWVRDSGRIMGRDSAGRALR 312

Query: 360 IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPD 419
           ++G  +D+TE+    ++  +   ++   +    + ++  D++ R+   N   +  +G P 
Sbjct: 313 MVGTHLDVTEERRTLEQALDYRGQIEAILAAVPDGIMTVDRDLRITRVNRAAEALFGWPA 372

Query: 420 HVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTIS 479
             +V G    ++                 ++++     ++A  R +Q       DG    
Sbjct: 373 DSIV-GQTVDVLLPEGQAETHGRLARAFFKTEEPDARRQMAGWRAVQG---RKRDGSLFP 428

Query: 480 VGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETA 539
           V   ++    +   +  +  +              +E+QK +L     +   + + A+ A
Sbjct: 429 VLVTLSATLIDGQPMVVAALKDMTV----------IEQQKADLRALADEVGEQLKAAQAA 478

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N  K+ FLA +SHELRTPLNAI+GFSE++  +    +   K  EYA D+  +G HLL +I
Sbjct: 479 NHAKNRFLAALSHELRTPLNAIIGFSELVATDTDEHIDPEKRREYAADVAQAGTHLLALI 538

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADK 658
           +++L++++IE  +I ++ +      + ++ +R++G S + K I++E  +  +L    AD+
Sbjct: 539 SDLLDLARIEANRIELEIEPCPPDGLTSDAVRMLGPSLRDKGIELEVAVAPDLPRVAADR 598

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRT---SKIGQCVIITIADTGIGIPKSALEKIGQP 715
           R +++IL  +L N+ KFT   G++ +       +   V  T+ DTG G+P   L  +GQP
Sbjct: 599 RAVQQILTNLLGNAGKFTPKGGRVTVTVGLDRAVPGQVRFTVEDTGCGVPADKLPLLGQP 658

Query: 716 FEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           F  + ++   S  G GLGLAIS  L    GG L+I S+ G+ T V+  +P
Sbjct: 659 FVQVGDKRRASAPGLGLGLAISRGLVERMGGMLRIESELGRWTRVSFGLP 708



 Score = 62.3 bits (150), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 41/382 (10%), Positives = 109/382 (28%), Gaps = 35/382 (9%)

Query: 83  NQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFA 142
             T+  L  A     +   ++  +   +       + + +    +   I    P   V  
Sbjct: 169 VTTATALLRARRAEEKWALVERHMRLVRAELRDQKERMDQVIAGTGVGIWDWNPQTGVLI 228

Query: 143 SSTKNSHYIGKKIGEIIPELSRS---RSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSIL 199
            + + +  +G  + E+ P    +       + ++ +E  L+                +  
Sbjct: 229 INERWAGIVGYTLAELQPVSIATWRRLVHPQDLEKAETLLEDVFAG------RSPLYACD 282

Query: 200 IINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVET 259
           I         +W  +    +   S   AL +      +    + +      L+    +E 
Sbjct: 283 IRMRHKAGHWVWVRDSGRIMGRDSAGRALRMV---GTHLDVTEERRTLEQALDYRGQIEA 339

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
            L+    G+   + D +   ++R+   + G P ++          ++  + +       +
Sbjct: 340 ILAAVPDGIMTVDRDLRITRVNRAAEALFGWPADSIV---GQTVDVLLPEGQAETHGRLA 396

Query: 320 VTGKHVKQLDQIFHM--------RHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKY 371
                 ++ D    M        R   G+   + V       I G   ++    D+T   
Sbjct: 397 RAFFKTEEPDARRQMAGWRAVQGRKRDGSLFPVLVTLSATL-IDGQPMVVAALKDMT--- 452

Query: 372 HLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQK-----AYGLPDHVLVPGN 426
            +E++ A+      +  E    A       +R +   ++  +       G  +   +   
Sbjct: 453 VIEQQKADLRALADEVGEQLKAAQAANHAKNRFLAALSHELRTPLNAIIGFSE---LVAT 509

Query: 427 ARSIIQDAQTRPIIEYRTSDPE 448
                 D + R       +   
Sbjct: 510 DTDEHIDPEKRREYAADVAQAG 531


>gi|186682604|ref|YP_001865800.1| PAS/PAC sensor hybrid histidine kinase [Nostoc punctiforme PCC
           73102]
 gi|186465056|gb|ACC80857.1| PAS/PAC sensor hybrid histidine kinase [Nostoc punctiforme PCC
           73102]
          Length = 709

 Score =  422 bits (1084), Expect = e-115,   Method: Composition-based stats.
 Identities = 115/586 (19%), Positives = 237/586 (40%), Gaps = 28/586 (4%)

Query: 183 PYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKK 242
                       +G  +   +    +        +    ++   A+   I  S  R   +
Sbjct: 6   RRVDTQRETVMTTGQPIRAETEYNTVDGVHCYEYILAPLYNPEQAIAGVIAVS--RDIGE 63

Query: 243 NKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAI 302
            K  +  L ++   ++ A   G+ G W +N    +   S  ++EI+G+    +    +  
Sbjct: 64  RKRTEQALRQSEQRLQMAQRAGKIGTWEWNVATGEVFWSEGIWEILGLEIGTEEPGVKPW 123

Query: 303 ARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMN-II 361
              IH +++              K+    F +       IW+  + Q++R   G     +
Sbjct: 124 VDFIHPNDRPRVMEGVEKVLAEGKEYYDEFRIVRRDNTVIWVASKGQIIRDAEGQAECFL 183

Query: 362 GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHV 421
           G+ +D++E+   E+   E+++R    +  +  A  + D + +++  +  Y   + L    
Sbjct: 184 GVNIDISERKQAEEVRQESEERFQAFMAHSPAAAWITDADGKVIYLSPTYVNTFQLFTQD 243

Query: 422 LVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVG 481
            +   A  +        ++    +  + +Q +                    DG      
Sbjct: 244 AIGKTAFELFDLEIATQLLNNIQTVAKTNQVLETI-----------EMAPRLDGTIGDFL 292

Query: 482 TDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANK 541
                + H   Q       +  T    +   +     +          Q  +E AETAN+
Sbjct: 293 VYKFPIAHLSGQSLVGGVAIDVTSRRRAEEEREELLLRE---------QAAREAAETANR 343

Query: 542 TKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINN 601
            K EFLA +SHELRTPLN ILG+ ++++     +L   K     + I  + +    +I +
Sbjct: 344 IKDEFLAVLSHELRTPLNPILGWIKLLRTH---QLSEEKKAIALETIERNAKLQTQLIAD 400

Query: 602 ILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFF-NADKRI 660
           +L++S+I   K++++  + DL   I      +  +A++K+I+I  +I  ++     D   
Sbjct: 401 LLDVSRILQGKLTLNISSVDLAATIAAANETVALAAEAKSIQIHTEIAPDVQLFMGDASR 460

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH 720
           ++++++ +L+N++KFT   G++ I+         I ++DTG GI    L  + + F    
Sbjct: 461 LQQVVWNLLTNAVKFTPTGGEVKIKLESTNTYTQIQVSDTGKGITPEFLPYVFETFRQAD 520

Query: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ-EGKGTIVTICMP 765
           +   +  GG GLGLAI   +  +HGG +   S+ E +G I T+ +P
Sbjct: 521 SATTRKFGGLGLGLAIVRHIVEMHGGTVHADSKGEDQGAIFTVRLP 566


>gi|71907402|ref|YP_284989.1| PAS/PAC sensor hybrid histidine kinase [Dechloromonas aromatica
           RCB]
 gi|71847023|gb|AAZ46519.1| PAS/PAC sensor hybrid histidine kinase [Dechloromonas aromatica
           RCB]
          Length = 1169

 Score =  422 bits (1084), Expect = e-115,   Method: Composition-based stats.
 Identities = 153/691 (22%), Positives = 275/691 (39%), Gaps = 90/691 (13%)

Query: 102 IKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPE 161
           I  D+ S+ +AE    Q L++    S   I++      +  +++      G  + E I  
Sbjct: 304 ISRDITSRHRAEEE-AQRLSQVIEQSPESIVITDLKTHIIYANSAFKDASGYTVEEAIGR 362

Query: 162 LSRSRSRSKT-----VQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
            +      +T       M       + +    +N   +    L              E  
Sbjct: 363 PAAFLGSGRTPAATKDVMWFTLEQGKVWQGEFINRRKDGSDYL--------------EQV 408

Query: 217 LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
           +          +      +  R     ++ +  +      +   LS    G W ++ D+ 
Sbjct: 409 IISPLRDSSGEVT--HYVAIKRDITTLRQQEQEIARDRKRLINVLSGTGAGPWEWDIDSG 466

Query: 277 KFHLSRSMYEIMGIPYENKTLS-FRAIARLIHYDNKKICEIARS-VTGKHVKQLDQIFHM 334
           K  L  +   ++G            A    IH +++ + E + +       ++ +  + +
Sbjct: 467 KLILDGASSNLVGRSLAEFGDDHLEAWFSRIHPEDRLVLEKSLADHLAGDSERFEIEYRI 526

Query: 335 RHASGADIWIQVRAQMMRT--ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
           +HA    +WIQVR +++        + + G+ +D+T     E++    +  L  AIE   
Sbjct: 527 QHADQRWVWIQVRGKVIDWSKDRKPLTMYGVHLDITAHKQAEEQRQYLESILHSAIEAIG 586

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTR-----------PIIE 441
           E   +++  DRL  CN  Y++ Y +     VPGN+   I                     
Sbjct: 587 EGFSVYNAADRLTWCNEQYRRLYTISAPAFVPGNSFEEIIRYGIEHGQYPEAQANPEAWV 646

Query: 442 YRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRL 501
            R     R  + +   KLAD RWL + E  T DG  +    DIT                
Sbjct: 647 QRRLLAHRQSESNFIQKLADGRWLDVRERKTADGSIVGFRVDIT---------------- 690

Query: 502 KATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAI 561
                                     +    K+ AE AN+ KSEFLA MSHE+RTP+N+I
Sbjct: 691 --------------------------ELMHAKQAAEAANRAKSEFLATMSHEIRTPMNSI 724

Query: 562 LGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNAD 621
           LG ++++      ++   +  +Y + I  SG+ LL ++N++L+++K+E+ ++ +D     
Sbjct: 725 LGMAQIL---CGPDVSDPRSRDYGRVILESGKTLLTILNDVLDLAKVESGRVELDPTPWL 781

Query: 622 LIPIINEGIRLIGSSAQSKNIKI--EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNN 679
              +  + + L    AQ K + I  E   P    + AD   +K++L  ++SN++KFT   
Sbjct: 782 PQQLAQDILALFRGVAQGKGLIISAEWDGPRTQEYLADGYRLKQMLSNLVSNALKFT-AI 840

Query: 680 GKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           G + IR S+I +      +  ++ DTGIGI     + + QPF        +  GG GLGL
Sbjct: 841 GSVDIRISEIDRTNDFATLEFSVTDTGIGISSEKQQGLFQPFTQADGSTTRRYGGSGLGL 900

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +I   L  L GG   + S+E KG+ +   +P
Sbjct: 901 SIVRHLAELMGGEAGLESEEKKGSRLWFRIP 931



 Score = 65.4 bits (158), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 40/339 (11%), Positives = 102/339 (30%), Gaps = 25/339 (7%)

Query: 66  SSIIKVTTRYAQQEKMT---NQTSLMLTEAIEIIFQNNNIKFDLASQKKAESML---GQL 119
             + +      +++            L ++   +     IK D+ + ++ E  +    + 
Sbjct: 387 GKVWQGEFINRRKDGSDYLEQVIISPLRDSSGEVTHYVAIKRDITTLRQQEQEIARDRKR 446

Query: 120 LAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASL 179
           L      + +       +         +S+ +G+ + E   +       S+        L
Sbjct: 447 LINVLSGTGAGPWEWDIDSGKLILDGASSNLVGRSLAEF-GDDHLEAWFSRIHPEDRLVL 505

Query: 180 DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQ 239
           ++        +L  +S    I        + W                     ++  +  
Sbjct: 506 EKSLAD----HLAGDSERFEIEYRIQHADQRWVWIQVRGK-VIDWSKDRKPLTMYGVHLD 560

Query: 240 AKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTL-- 297
              +K+ +         + +A+     G   +N  ++    +     +  I         
Sbjct: 561 ITAHKQAEEQRQYLESILHSAIEAIGEGFSVYNAADRLTWCNEQYRRLYTISAPAFVPGN 620

Query: 298 SFRAIARL-----IHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR 352
           SF  I R       + + +   E          +Q +  F  + A G  + ++ R    +
Sbjct: 621 SFEEIIRYGIEHGQYPEAQANPEAWVQRRLLAHRQSESNFIQKLADGRWLDVRER----K 676

Query: 353 TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
           T  G   I+G  +D+TE  H ++    A++  S+ +   
Sbjct: 677 TADGS--IVGFRVDITELMHAKQAAEAANRAKSEFLATM 713


>gi|312886589|ref|ZP_07746197.1| PAS/PAC sensor hybrid histidine kinase [Mucilaginibacter paludis
           DSM 18603]
 gi|311300992|gb|EFQ78053.1| PAS/PAC sensor hybrid histidine kinase [Mucilaginibacter paludis
           DSM 18603]
          Length = 1025

 Score =  421 bits (1083), Expect = e-115,   Method: Composition-based stats.
 Identities = 126/704 (17%), Positives = 264/704 (37%), Gaps = 53/704 (7%)

Query: 69  IKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSE 128
           I++    A+   +  ++S  L       ++   +  D+  QK+ E    +  +     S 
Sbjct: 213 IELQLLTAKGNLIWVRSSGSLMMEKGKPYRLCGVLQDITEQKQIE----ERNSVIFEQST 268

Query: 129 SFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLS 188
              LL      +   +      +  +    +     +    +     + S+D+       
Sbjct: 269 DAHLLIDETG-IIDCNNAAVQMLRCENKAHLLSCHPAIFSPEYQPDGQKSIDKAKKMDSL 327

Query: 189 VNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDT 248
                      +            +E+ +EV   + I+     +L   +    + K+ + 
Sbjct: 328 AYEKGTHRFEWVHQRMDG------KEIFVEVTL-NAIAFNQKRVLLVVWHDITQRKKAEE 380

Query: 249 ILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHY 308
            L      +    +    G W  +    +   S   + I G+             R+IH 
Sbjct: 381 KLKRNESLLSETQALTHSGSWEIDLKTGRNFWSAEAFRIFGLEPVGAGPDTEEFDRMIHP 440

Query: 309 DNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDL 367
           D+++    A     K     +    +   +G   +IQ   +      G    + G  +D+
Sbjct: 441 DDREKYINAIKQALKGGLTSNFDLRIILKTGELKYIQAIGKPFYNDQGVATRLYGAIIDI 500

Query: 368 TEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA 427
           T+    E+       +L+  IE +   + ++DK  R +  +  +++ Y L    ++    
Sbjct: 501 TKYKKAEEAILMKQAQLNTFIEVSPAPIAVFDKEMRYIAASDLWKQDYKLERKNIIGVCH 560

Query: 428 RSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLL 487
             +  +A       +           ++            + +   +G T     +I   
Sbjct: 561 YDLFPEASLHWRQIHERGMAGEILSNTE------------DSFVRKNGRTQWFRWEIRPW 608

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFL 547
                ++                         T+  +A       KE+AE A   K++FL
Sbjct: 609 FETDKEIGGIIMFT---------------EIITDRKLAEQALIQAKEQAENAASAKTQFL 653

Query: 548 AKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSK 607
           + MSHE+RTP+NA++GF+ ++ +            EY + + +SG++LL +IN+IL+ SK
Sbjct: 654 STMSHEIRTPMNAVIGFTHLLLQN-----PREDQVEYLKILKFSGENLLVLINDILDFSK 708

Query: 608 IETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKIL 665
           IE  K+  +  + +L  ++      +   A  K I+++  +  +L      D   + +IL
Sbjct: 709 IEAGKLEFEHVDFNLKDLVRNIRAAMQQRAIEKGIQLKLLVDEDLPQAVIGDPVRLGQIL 768

Query: 666 FPILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLH 720
             ++SN++KFT+  GK+++  S + +      V   + DTGIGIP    + I + F    
Sbjct: 769 SNLISNALKFTSV-GKVVVSASLVSRNNEYTIVSFEVKDTGIGIPTEKQQAIFESFTQAS 827

Query: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
           +   +  GG GLGL I+  L  + G  +++ S+ GKG+  +  +
Sbjct: 828 SDTTRKYGGTGLGLTITKRLLEMQGSAIQLDSEPGKGSTFSFNL 871



 Score =  116 bits (290), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/388 (12%), Positives = 119/388 (30%), Gaps = 28/388 (7%)

Query: 140 VFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSIL 199
           +           G    +II +     +  +  +     L     +    +L +     +
Sbjct: 35  ILNIDQNCWEVFGINRDDIIADAHNLLALIEYGERE---LLTGHIYRALNSLTNFEWHGM 91

Query: 200 IINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVET 259
           +          W +++          + +LL  +F+         +  T +   N  +  
Sbjct: 92  VATP-----AGWHKQIKAVGQCSGFENEVLLNGVFA---DLTILADLRTAVNNNNQFLSQ 143

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
           A    +   W  +        S  M  +  +      +   +        ++ + + A  
Sbjct: 144 ASKLAKIATWEIDLQTGVVKWSDGMSRLHEMQPGG-MIDIESAIVFYEASSRLVFKEALD 202

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAE 379
                 +       +  A G  IW++    +M        + G+  D+TE+  +E+R   
Sbjct: 203 KALTVGEPYHIELQLLTAKGNLIWVRSSGSLMMEKGKPYRLCGVLQDITEQKQIEERN-- 260

Query: 380 ADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPI 439
                S   E +++A +L D+   ++ CN    +     ++     +    I   + +P 
Sbjct: 261 -----SVIFEQSTDAHLLIDETG-IIDCNNAAVQML-RCENKAHLLSCHPAIFSPEYQPD 313

Query: 440 IEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKR 499
            +      ++   ++ E       W+        DG  I V   +  +  NQ        
Sbjct: 314 GQKSIDKAKKMDSLAYEKGTHRFEWVHQRM----DGKEIFVEVTLNAIAFNQK---RVLL 366

Query: 500 RLKATINDLSTSRQILERQKTELSIANA 527
            +   I     + + L+R ++ LS   A
Sbjct: 367 VVWHDITQRKKAEEKLKRNESLLSETQA 394


>gi|152993440|ref|YP_001359161.1| hypothetical protein SUN_1857 [Sulfurovum sp. NBC37-1]
 gi|151425301|dbj|BAF72804.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 1156

 Score =  421 bits (1083), Expect = e-115,   Method: Composition-based stats.
 Identities = 143/658 (21%), Positives = 256/658 (38%), Gaps = 51/658 (7%)

Query: 113  ESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGE--IIPELSRSRSRSK 170
            +  + + L       +  ++L   N+     + K     G    E  +     +     +
Sbjct: 399  QERMEEDLIALEKSQDGILVL--ENDTFLQCNQKILDMFGYSTTENFVKAYPHKLFPGKQ 456

Query: 171  TVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLL 230
                  +   ++   +   N  H    + +  +  P             +  S       
Sbjct: 457  PDGSYSSVKMEKMKALTKKNGSHQFECLNVKQNGEPFW---------VNIILSYRMINEK 507

Query: 231  FILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGI 290
             I    YR     K  +         +E AL+  +  + +++F +   ++S S  E++G 
Sbjct: 508  EIFHMVYRNVTDKKNQENENSFITNRMELALAGSKTAVLDWDFRDNSMYISPSWKEMLGF 567

Query: 291  PYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL-DQIFHMRHASGADIWIQVRAQ 349
              +    +  +  R  H ++KK          K+  +  +    ++H  G  +W+  RAQ
Sbjct: 568  RDDELPNAPSSWFRRAHTEDKKTILAMLREHEKNKIRFFESNHRLKHKDGHWVWVLGRAQ 627

Query: 350  MMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCN 408
            ++   +G    +IG   D+T++   + +Y +  Q     +E   + +V  D    +   N
Sbjct: 628  ILFDENGKKVRMIGTHTDITKEKESQIKYFQQVQ----IMEQIHDGIVTTDLEGNVTSWN 683

Query: 409  ANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQIN 468
               ++ +G     ++ G   S+I   +  P I+ R                    +    
Sbjct: 684  KGAEELFGYSQSEII-GKHISLIYRKKDIPGIKERIRASLEET----------GLYQGDL 732

Query: 469  EWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK 528
             + T     I V   ++LLK                       R  + +  T+       
Sbjct: 733  TFITKSKKIIPVSLSLSLLKDEH---------------GNVAGRIGINQDITQRKKDEKS 777

Query: 529  YQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
                K +AE + K+KSEFLA MSHE+RTPL+AILGF +++KKE        K  EY   I
Sbjct: 778  LLKAKRKAEESAKSKSEFLANMSHEIRTPLSAILGFIDLLKKENI----EKKAKEYVDII 833

Query: 589  HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI 648
              S + LL +I +IL+ SKIE+ K+ IDK +          I L  +    K+I +   +
Sbjct: 834  DTSSKGLLKIIEDILDFSKIESGKLEIDKIDFSPKIEFETIIHLFLAKCAEKDIALTLIL 893

Query: 649  PSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPK 706
               L    + D   IK+I+  +LSN+IKFT+   K+ +  +     + +++ D G GI K
Sbjct: 894  DESLPETIHTDPLRIKQIISNLLSNAIKFTDQGKKITVTINYKNGFLNVSVKDEGKGIAK 953

Query: 707  SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
              L  I + F    +   +  GG GLGL IS  L  + GG L + S+ G G+     +
Sbjct: 954  EKLSHIFESFAQEDSSTTREYGGTGLGLTISYRLVKILGGELHVKSKVGAGSEFYFSI 1011


>gi|312113732|ref|YP_004011328.1| histidine kinase [Rhodomicrobium vannielii ATCC 17100]
 gi|311218861|gb|ADP70229.1| histidine kinase [Rhodomicrobium vannielii ATCC 17100]
          Length = 630

 Score =  421 bits (1082), Expect = e-115,   Method: Composition-based stats.
 Identities = 165/522 (31%), Positives = 273/522 (52%), Gaps = 6/522 (1%)

Query: 245 ENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIAR 304
             +   L      +   + G  GL  ++        S     +     E++  SFR +  
Sbjct: 101 RAEAARLAIARHAQGVEAAGALGL-RWDLVTGDLVWSGDAGGVF-PTGESRPASFRDLRH 158

Query: 305 LIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIA 364
            +H D+  +            K+++    ++ A       Q+R ++  T  G     G+ 
Sbjct: 159 WLHPDDF-LYASISQALKSGQKRVNWPVRIKDAEKGWRTFQLRGEISSTPQGAPAFEGLL 217

Query: 365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP 424
           + +        +  E    L + +E    ++ +WD+ +RLV+CN  +++ Y +     +P
Sbjct: 218 VPIDPSQS--PQGLEGFPSLPEIVESLPISIAIWDRENRLVLCNRKFRQLYRVSAAAALP 275

Query: 425 GNARSIIQDAQTRPIIEYRTSDPERSQDMSK-EIKLADSRWLQINEWCTHDGGTISVGTD 483
           G +   IQ      I +               E +L D  WLQI E+ T +G  +S GTD
Sbjct: 276 GTSYEAIQAQTQEAIAQRPPEGRGVVGRFQLQERQLGDGTWLQIGEYWTGEGTLVSFGTD 335

Query: 484 ITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTK 543
           IT+ K  Q ++ E +++++A ++    SR+ LE Q  +L      Y  EK RAE AN+ K
Sbjct: 336 ITMQKQTQHRVLEREQQMRARVDGFEQSRRQLEIQARQLRELAESYNEEKIRAEAANQAK 395

Query: 544 SEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL 603
           SEFLA +SHELRTPLNAI+GFSE+++  + G +G+ KY  Y +DIH SG++LL MIN+IL
Sbjct: 396 SEFLANVSHELRTPLNAIIGFSEMMRDGVLGPIGNPKYESYVKDIHNSGRYLLEMINDIL 455

Query: 604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKK 663
           +MSKIE  + ++  +   +  +  E + ++   A   N+++ +   + +    D+R +K+
Sbjct: 456 DMSKIEAGRWTLSPEWFTMSDVFQECLSVVSPVAMEGNVELSQSGNTSISLYGDRRALKQ 515

Query: 664 ILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQY 723
           +L  +LSN++KFT  +GK+ +R  +    + I IADTG+GIPK  L ++G+PFE + NQ 
Sbjct: 516 VLINLLSNAVKFTPQDGKVSLRAYRYRGSIRIAIADTGVGIPKHDLGRLGRPFEQVSNQL 575

Query: 724 DQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            +   G GLGLAIS +L  +HGG+L I S+ G+GT VT  +P
Sbjct: 576 TKGHKGTGLGLAISRSLVEMHGGKLDIKSRVGEGTTVTCILP 617


>gi|149174262|ref|ZP_01852889.1| probable sensor/response regulator hybrid [Planctomyces maris DSM
            8797]
 gi|148846807|gb|EDL61143.1| probable sensor/response regulator hybrid [Planctomyces maris DSM
            8797]
          Length = 2453

 Score =  421 bits (1082), Expect = e-115,   Method: Composition-based stats.
 Identities = 134/681 (19%), Positives = 272/681 (39%), Gaps = 40/681 (5%)

Query: 90   TEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTK 146
               I+++ +     F    + +AE+ L +  A+ R L+++      +A     +F  + +
Sbjct: 1647 AVVIDLLQELTPRIFVRLERARAEAALRESEARFRDLADNMSQFAWMADEKGFIFWYNQR 1706

Query: 147  NSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVP 206
               Y G  + E+     +     + V      +               +           
Sbjct: 1707 WFEYTGTTLEEMQGWGWKKVHHPEHVDRVVKRIQHSWD-------TGETWEDTF--PIRS 1757

Query: 207  LLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRC 266
                +R  ++  V        +L    F         +E +  +  +   +  A+     
Sbjct: 1758 KEGEFRWFLSRAVPIRDASGKIL--RWFGTNTDITSTREQEQRVRASEARLRLAMQAANL 1815

Query: 267  GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK 326
             LW ++ D  K + S   +E+  +         +    L+H ++++  E +      + K
Sbjct: 1816 SLWQWDIDKDKIYWSHDSHELSSMEPRQAVGGLQHFLNLVHRNDREAVEHSLRSCLSNGK 1875

Query: 327  QLDQIFHMRHASGADIWIQVRAQMMRT-ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLS 385
                 F  R +     W+   A +          ++G+ +D+TE+   E     +++RL 
Sbjct: 1876 PFQAEFRTRKSENTYAWVLSTAYLTTDSTDNSTVMVGVNLDITERKKSELEIKLSEERLR 1935

Query: 386  KAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTS 445
             A E     ++  D  +     +   ++  GLPD+         +      +    YR  
Sbjct: 1936 NAAESAGFGMLHIDLLEETTAFSPEMKRMLGLPDNAENNLKFGEVPDWIHPKDRSAYRKH 1995

Query: 446  DPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATI 505
              E +     + +  D R +        DG T  V      +   +   R++ + +    
Sbjct: 1996 LQESAALPEGKNQSLDHRII------RPDGETRWVRLHARPVFTGKGSRRKATQLIGTL- 2048

Query: 506  NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS 565
                          T         +  ++ AE AN++KS FLA MSHE+RTP+ AI+G+ 
Sbjct: 2049 -----------LDITSQRQFEQSLKEARQMAEAANESKSAFLANMSHEIRTPMTAIMGYI 2097

Query: 566  EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPI 625
            ++I + I  ++ +     Y   +  +G+ LL++IN+IL++SKIE  K+ I ++      +
Sbjct: 2098 DLIDELIDHKIATA----YLSTVRRNGEFLLDIINDILDLSKIEAGKLDIIRERFSPHQL 2153

Query: 626  INEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMM 683
            + +   ++   A    ++++     ++     +D + +K+IL  ++ N+IKFT   G + 
Sbjct: 2154 LEDVCSIMDVRAAENRLELDIFYYGKIPAEIESDPKRLKQILINLVGNAIKFTMK-GSVK 2212

Query: 684  IRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNL 743
            I  S   Q +   I DTGIGI     +++ +PF    +  ++  GG GLGLAIS  L N+
Sbjct: 2213 IFVSCNDQQLQFIIVDTGIGITTRQQKRLFRPFSQGDHTVNREFGGTGLGLAISQRLANM 2272

Query: 744  HGGRLKIISQEGKGTIVTICM 764
             GG + + S++ KG+  T+ +
Sbjct: 2273 LGGEICVESEKDKGSKFTVTI 2293



 Score =  123 bits (308), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 56/452 (12%), Positives = 124/452 (27%), Gaps = 26/452 (5%)

Query: 117  GQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSE 176
             +L       S   + +     +V   S     + G+   E       +       Q + 
Sbjct: 827  QELFQLLIDASSQIVWMTDAAGIVVEDSPSWREFTGQTYEEWKGTGWLNAIHPDDQQATI 886

Query: 177  ASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSY 236
             +      ++ + ++ +                 WR      V       ++L       
Sbjct: 887  QAWQTAVSNIETFSVEYRLWHQQ---------GEWRWMHARGVPQKLPDGSIL--RWIGM 935

Query: 237  YRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT 296
                 + KE   ++LE++  ++  +     GL   ++ N    L+     I G+ Y+   
Sbjct: 936  NTDITEQKEAQRVILESSRQLQLGVEIANLGLARVDYANNCITLTPEAAAIYGLGYQEIL 995

Query: 297  LSFRAIARLIHYDNKKICEIARSVTGKH--VKQLDQIFHMRHASGADIWIQVRAQMMRTI 354
            ++   +  L H ++++          +     + D    +   SG   WI  R Q+    
Sbjct: 996  ITRDEMLDLYHPEDRQDAADQIQACIQECGDGRCDLEHRLILPSGEIRWISARKQIYFDR 1055

Query: 355  SGGMNI----IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNAN 410
            S    +      +A D+T     E   A     LS           + D  +      A 
Sbjct: 1056 SVEPAVPVYATLVAQDITISKREELNLA----FLSDLQTQLIPLYNVDDLMEVATRETAK 1111

Query: 411  YQKAY-GLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK---LADSRWLQ 466
            Y   +  L        +   I+ +     +         R      E +     +  ++ 
Sbjct: 1112 YLDLFRCLIVEFDANADYADILFEHHDDSLHSIVGKHRVRDFHTESERQKLLAGEQFFIS 1171

Query: 467  INEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIAN 526
               +   D         I +  +  +     +            + Q    +   L    
Sbjct: 1172 DTLYPEQDSRIAENFQSINVRAYCNSAYITPQGIKFVISAVKREAYQWRPDELKLLQEIT 1231

Query: 527  AKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
             +  +  ERA  A    ++  A +   +   L
Sbjct: 1232 NRLCIRIERA-RAEAELADREAHLRRVINNQL 1262



 Score =  118 bits (295), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 46/409 (11%), Positives = 109/409 (26%), Gaps = 20/409 (4%)

Query: 72   TTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFI 131
                  ++++      M     E+   N  +       + A   L     +      + +
Sbjct: 652  YELQCSRDELEKTLQDMDVAHEELKSTNEELLSMNEELQSANEELETSKEEI-TAVSNSV 710

Query: 132  LLAQPNELVFASSTKNSHYI--GKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
                 +      ST+ +      + +                  +        P      
Sbjct: 711  ARTNSDLENLLRSTQIATVFLDDELLIRSFTPAITEIYSLIHTDIGRPLERFVPLVEEMP 770

Query: 190  NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
             LP              ++    +     V+ +   S     I+   +    +       
Sbjct: 771  PLPDPRKLQQSHPIEHTVVADSGKVYIRRVLPYQSYSGQNEGIVV-TFIDVSE------- 822

Query: 250  LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
            L  +    +  +      +W  +        S S  E  G  YE    +       IH D
Sbjct: 823  LHNSQELFQLLIDASSQIVWMTDAAGIVVEDSPSWREFTGQTYEEWKGTG--WLNAIHPD 880

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLT 368
            +++    A      +++     + + H  G   W+  R    +   G +   IG+  D+T
Sbjct: 881  DQQATIQAWQTAVSNIETFSVEYRLWHQQGEWRWMHARGVPQKLPDGSILRWIGMNTDIT 940

Query: 369  EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA- 427
            E+   ++   E+ ++L   +E  +  L   D  +  +         YGL    ++     
Sbjct: 941  EQKEAQRVILESSRQLQLGVEIANLGLARVDYANNCITLTPEAAAIYGLGYQEILITRDE 1000

Query: 428  -RSIIQDAQTRPIIEYRTS----DPERSQDMSKEIKLADSRWLQINEWC 471
               +      +   +   +      +   D+   + L       I+   
Sbjct: 1001 MLDLYHPEDRQDAADQIQACIQECGDGRCDLEHRLILPSGEIRWISARK 1049



 Score = 75.8 bits (185), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 48/471 (10%), Positives = 130/471 (27%), Gaps = 38/471 (8%)

Query: 108  SQKKAESMLGQLLAKTRF---LSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSR 164
             + +AE+ L    A  R         + +   +  +      +    G    ++I +   
Sbjct: 1239 ERARAEAELADREAHLRRVINNQLGLVGVIGRDGRLLEVDDDSMKIAGLTREDVIGKHFA 1298

Query: 165  SRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSI 224
              +     +     + +      +  +      +          RL  + +   V   + 
Sbjct: 1299 ECAWWTYDEAVSQKMRESMQKAFAGEVVRYDVPLFAAGLGGAERRLMIDFMMAPVFNKNG 1358

Query: 225  ISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSM 284
                L+           +    + +  E    +E+  +    G+   N       ++ + 
Sbjct: 1359 EVEYLIPSGV----DISERVAVENLHKETAARLESMFNSAVDGMITINAAGNMDSINPAA 1414

Query: 285  YEIMGIPYENKTLSFRAIA--RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADI 342
             ++ G   E        +      H ++              +    +        G+  
Sbjct: 1415 LDLFGYELEELQGQNVNMLMPDPWHSEHDSYLNAYLKTGQAKIIGSKREVLGLRKDGSTF 1474

Query: 343  WIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
             +++ A     + G +  +G   D++E+        + +  L+   E            +
Sbjct: 1475 AMEL-AVSEAYMRGEILFVGTVRDISERK-------QRELNLAFIDELQLLLGAPLLIEE 1526

Query: 403  RLVMCNANYQKAYGLPDHVLVPGNARSIIQDA-------------QTRPIIEYRTSDPER 449
             +    A      G+   +L+  +  + I D                  I  +     + 
Sbjct: 1527 IMQQTCARITDFLGVSRCLLIELDTEAEIADVVYEAHESGLSDISGRHTITNFLEEQEQE 1586

Query: 450  SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
                 + I + D++        T +   + +G+ + +   ++ +L+              
Sbjct: 1587 PLLAGQPILIGDTQNHHRISKRTKNFAALDIGSLLLIPFVSEKRLKFVLTICNQQPCQWQ 1646

Query: 510  TSRQILERQKT-------ELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
                 L ++ T       E + A A  +  + R        S+F A M+ E
Sbjct: 1647 AVVIDLLQELTPRIFVRLERARAEAALRESEARFRDLADNMSQF-AWMADE 1696



 Score = 59.2 bits (142), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 47/383 (12%), Positives = 115/383 (30%), Gaps = 74/383 (19%)

Query: 293  ENKTLSFRAIARLIHYDNKKICEIARSVTGK-----HVKQLDQIFHMRH---ASGADIWI 344
             + T +   I  LIH D  +  E    +  +       ++L Q   + H   A    ++I
Sbjct: 738  RSFTPAITEIYSLIHTDIGRPLERFVPLVEEMPPLPDPRKLQQSHPIEHTVVADSGKVYI 797

Query: 345  QVRAQMMRTISGGMN-IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDR 403
            + R    ++ SG    I+   +D++E          + +     I+ +S+ + + D    
Sbjct: 798  R-RVLPYQSYSGQNEGIVVTFIDVSE-------LHNSQELFQLLIDASSQIVWMTDAAGI 849

Query: 404  LVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE--RSQDMSKEIKLAD 461
            +V  + ++++  G            + I     +  I+   +      +  +   +    
Sbjct: 850  VVEDSPSWREFTGQTYEEWKGTGWLNAIHPDDQQATIQAWQTAVSNIETFSVEYRLWHQQ 909

Query: 462  SRWLQINEW----CTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILER 517
              W  ++         DG  +                      +   I +   +++++  
Sbjct: 910  GEWRWMHARGVPQKLPDGSIL------------------RWIGMNTDITEQKEAQRVILE 951

Query: 518  QKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAI--LGFSEVI--KKEIF 573
               +L +      +   R + AN   +         L     AI  LG+ E++  + E+ 
Sbjct: 952  SSRQLQLGVEIANLGLARVDYANNCIT---------LTPEAAAIYGLGYQEILITRDEML 1002

Query: 574  GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
                     + A  I    Q   +              +  ++ +       I       
Sbjct: 1003 DLYHPEDRQDAADQIQACIQECGD-------------GRCDLEHRLILPSGEIRWI---- 1045

Query: 634  GSSAQSKNIKIEKKIPSELFFNA 656
               +  K I  ++ +   +   A
Sbjct: 1046 ---SARKQIYFDRSVEPAVPVYA 1065


>gi|126658537|ref|ZP_01729684.1| serine/threonine kinase with two-component sensor domain [Cyanothece
            sp. CCY0110]
 gi|126620124|gb|EAZ90846.1| serine/threonine kinase with two-component sensor domain [Cyanothece
            sp. CCY0110]
          Length = 3557

 Score =  420 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 138/677 (20%), Positives = 265/677 (39%), Gaps = 51/677 (7%)

Query: 105  DLASQKKAESMLGQL---LAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPE 161
            D+  +K+ E  L +    L      +   + +      +   ++  +    + I  ++ +
Sbjct: 2687 DITQRKQTEQELQESNIILRSVIESTPDVVFVKDLQGRIVVGNSTFAEVFNQPIETLLGK 2746

Query: 162  LSRSRSRSKTVQMSEASLDQ----QPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTL 217
             +  R         + +  +             LPH  G    + ++ P           
Sbjct: 2747 NNDERWSPDIAAYLKENDQRIIQLGRSETFEETLPHPQGMRTYLTTKSP----------- 2795

Query: 218  EVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKK 277
               ++     ++  I  +  R     K  +  L  +   + T  +     L+  + D + 
Sbjct: 2796 ---WYDPQGQIIGVIGIA--RDISDRKAAEAALKRSEQDLRTLFNNSYDALFIHDLDGRF 2850

Query: 278  FHLSRSMYEIMGIPYENKTL-SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRH 336
              ++  + E++G   EN    S    A      ++ + EI  +V      + +     R 
Sbjct: 2851 LDINDRVVELLGTSRENILARSVADFAAEEAPIDQ-LAEIFNNVAQGKSLRFEWKGK-RF 2908

Query: 337  ASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV 396
               +    +V  + +      + + G+  D++++   EK   ++++      E ++  LV
Sbjct: 2909 DDNSTFDAEVALRKVSLGEKDVILAGV-RDISDRKAAEKALRQSEEYNRTLFETSTIGLV 2967

Query: 397  LWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKE 456
            L   +  LV  N  Y    G      +      I  +                ++    E
Sbjct: 2968 LCRMDGTLVDVNPAYAAILGRTVEETLNLTYWEITPE------------TYAEAEAAQLE 3015

Query: 457  IKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
                  R+    E+   DG  + V     +++ N  Q   S     +       + +   
Sbjct: 3016 SMAKTGRYAFEKEYIRKDGSLVPVALSGLIVERNGEQYIWSCVEDISQRKQAEVALKEAN 3075

Query: 517  RQKTELS-IANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
             Q  +      A+ Q  KE AE AN+ KS FLA MSHELRTPLN I+G+++++++     
Sbjct: 3076 NQLEQRVLERTAQLQQAKELAEEANQAKSAFLANMSHELRTPLNGIMGYAQILQRS---P 3132

Query: 576  LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
              S  +    Q I+  G HLL +I +IL++SKIE  ++ +  Q   L   +   + +   
Sbjct: 3133 QLSSDHKSNIQVIYQCGSHLLTLIEDILDISKIEAGRMELYCQEFPLNSFLQGVVEICRI 3192

Query: 636  SAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNG---KMMIRTSKI- 689
             A+ K++    + PS L    N D++ ++++L  +L N+IKFT+      ++   +S+  
Sbjct: 3193 KAEQKSLTFTYERPSSLPTVINTDQKRLRQVLLNLLGNAIKFTSLGSIKFRVSFTSSRTN 3252

Query: 690  -GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
                +   I DTG+GI    L++I  PFE +     Q   G GLGLAIS  L  + G +L
Sbjct: 3253 HNGFLQFEIEDTGVGISAEQLDRIFLPFEQV-GSLSQKAEGTGLGLAISQKLLQMMGTQL 3311

Query: 749  KIISQEGKGTIVTICMP 765
             + S  G G+I +  +P
Sbjct: 3312 TVESTLGVGSIFSFILP 3328



 Score =  198 bits (504), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/438 (12%), Positives = 140/438 (31%), Gaps = 37/438 (8%)

Query: 105  DLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSHYIGKKIGEIIPE 161
            D++ +K+AE  L +     + + ++    +            +   ++       +I+ +
Sbjct: 2302 DISDRKEAEQALEESRNMFKLVLDTIPQRVFWKDRQSRFLGCNPAFANDYQLTHADIVGK 2361

Query: 162  LSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVF 221
                   +K   +  A          +  +   +  +        L        + ++  
Sbjct: 2362 TDLELPWAKWGDLYRADD--------ARVMNTRTPQLNYEEPTNNLAGENIWIRSSKIPL 2413

Query: 222  FSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLS 281
             +    ++  +    Y    + K+ +  L E+   +  AL     GL++ N    K  +S
Sbjct: 2414 TNTQGEVVGVL--GCYDDVTERKQAEQALEESEERLRLALKSANQGLYDLNLTTGKAIVS 2471

Query: 282  RSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC-EIARSVTGKHVKQLDQIFHMRHASGA 340
                 ++G        +       +H D+ +    +  +     +      F  +   G 
Sbjct: 2472 AEYATMLGYDPATFEETNGKWIERLHPDDVERVTNVYLNYVAGTITDYRVEFRQQTQQGK 2531

Query: 341  DIWIQVRAQMM-RTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
              WI    +++    SG    ++G   D++++  +E++  + +++L  A++ +      W
Sbjct: 2532 WKWILSVGKIVAWDESGQPLRMLGTHTDISDRKSIEEQLIKREEQLRAALDASETGTFRW 2591

Query: 399  DKNDRLVMCNANYQKAYGLP--DHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKE 456
                + +  + N  + +GLP            +++     + +I+      +   D  +E
Sbjct: 2592 YIATKQLEWDDNLNRLFGLPLGATAHELDEFITLVHPDDRQTVIDACNRSLQEGVDFEEE 2651

Query: 457  IKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
             +               DG    +       K      ++      A      T R+  E
Sbjct: 2652 FR-----------VVWPDGSIHWLF-----DKGKLFCDQQGNPCYMAGACVDITQRKQTE 2695

Query: 517  RQKTELSIANAKYQVEKE 534
            +   EL  +N   +   E
Sbjct: 2696 Q---ELQESNIILRSVIE 2710



 Score =  190 bits (482), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 51/394 (12%), Positives = 127/394 (32%), Gaps = 17/394 (4%)

Query: 105  DLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSR 164
            D+  +K+AE  L +   + R   +S         L   + T     +  +   ++     
Sbjct: 2429 DVTERKQAEQALEESEERLRLALKSA-----NQGLYDLNLTTGKAIVSAEYATMLGYDPA 2483

Query: 165  SRSRSKTVQMSEASLDQQPYHVLSV--NLPHNSGSILIINSRVPLLRLWREEVTLEVVFF 222
            +   +    +     D            +        +   +      W+  +++     
Sbjct: 2484 TFEETNGKWIERLHPDDVERVTNVYLNYVAGTITDYRVEFRQQTQQGKWKWILSVGK-IV 2542

Query: 223  SIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSR 282
            +   +     +   +      K  +  L++    +  AL     G + +    K+     
Sbjct: 2543 AWDESGQPLRMLGTHTDISDRKSIEEQLIKREEQLRAALDASETGTFRWYIATKQLEWDD 2602

Query: 283  SMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADI 342
            ++  + G+P             L+H D+++    A + + +     ++ F +    G+  
Sbjct: 2603 NLNRLFGLPLGATAHELDEFITLVHPDDRQTVIDACNRSLQEGVDFEEEFRVVWPDGSIH 2662

Query: 343  WIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKN 401
            W+  + ++     G    + G  +D+T++   E+   E++  L   IE T + + + D  
Sbjct: 2663 WLFDKGKLFCDQQGNPCYMAGACVDITQRKQTEQELQESNIILRSVIESTPDVVFVKDLQ 2722

Query: 402  DRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIE--YRTSDPERSQDMSKEIKL 459
             R+V+ N+ + + +  P   L+  N            + E   R     RS+   + +  
Sbjct: 2723 GRIVVGNSTFAEVFNQPIETLLGKNNDERWSPDIAAYLKENDQRIIQLGRSETFEETLPH 2782

Query: 460  ADSRWLQ------INEWCTHDGGTISVGTDITLL 487
                           +      G I +  DI+  
Sbjct: 2783 PQGMRTYLTTKSPWYDPQGQIIGVIGIARDISDR 2816



 Score =  184 bits (466), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 65/508 (12%), Positives = 168/508 (33%), Gaps = 42/508 (8%)

Query: 97   FQNNNIKFDLASQKKAESMLGQLLAKTRF---LSESFILLAQPNELVFASSTKNSHYIGK 153
            FQ   I+F++  +K+AE  L +  A+ R     +   I LA         + K    +  
Sbjct: 1256 FQYMAIRFEITQRKQAEIALQESEARFRVFFEHAAVGIALASMTGQFITVNQKFCDILDY 1315

Query: 154  KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
            +  E+  +  +  +    +  ++            V+   N+ S+     +      W  
Sbjct: 1316 QESELRGKTFQEITYPDDLPDTKTYAQ------QLVSGEVNAYSVEKRYVKRDGQITWSN 1369

Query: 214  EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF 273
                 V   +      + ++       ++ K  +  L  +     T       G++  + 
Sbjct: 1370 TTASLVRDATGTPQYFVGVI----EDIEQRKIAEQKLQASERRYATLTELSPTGIFRTDP 1425

Query: 274  DNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK-QLDQIF 332
                 +++    E+ G+  E+     +     +H D+++          ++ +   +   
Sbjct: 1426 QGNCCYVNTRWCEMAGLTPEDAQG--QGWVNALHPDDRERMMQEWDQAAQNRQMPFNTDC 1483

Query: 333  HMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
              +   G  IW+ V+A       G     +G   D++++   E    E+++R  +A +  
Sbjct: 1484 RFQKPDGTVIWLVVQATEETDHQGNVTGYVGSITDISDRKQKEIALQESEERFRQAFDYA 1543

Query: 392  SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ 451
            S  + L     + +  N++  +  G  +  L+       I       I           +
Sbjct: 1544 SIGMGLVSPEGQWLKVNSSLCEIIGYSEAELLN-TTFQDITHPDDLDIDLNFVRQMLAGE 1602

Query: 452  DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             ++ ++   + R++         G  I +  +++L++ +     + +     +     + 
Sbjct: 1603 IVTYKM---EKRYIH------KQGDIIWILLNVSLVRDH-----QGEPLYFISQIQDISD 1648

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS-----E 566
            R+  E+   +                   +    F+     EL     AI+G+S     +
Sbjct: 1649 RKAAEQALQDSEQYVRTLFETSPIGLLLCRMDGNFV-----ELNPAFAAIIGYSLAETQQ 1703

Query: 567  VIKKEIFGELGSVKYYEYAQDIHYSGQH 594
            +   +I  E  S +     + +  +G +
Sbjct: 1704 LSYWQITPESYSEQEQVMLKQLEETGYY 1731



 Score =  174 bits (441), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 54/507 (10%), Positives = 143/507 (28%), Gaps = 60/507 (11%)

Query: 90   TEAIEIIFQNNNIKFDLASQ-KKAESMLGQLL-AKTRFLSESFILLAQPNELVFASSTKN 147
              A++  +    ++  +A + KK +    +L   K      + + +      +  ++   
Sbjct: 1124 AIALDNAYLYQELEQRVAERTKKLQISQQELSDLKYSIDQSAIVAITDTQGKITYANDHF 1183

Query: 148  SHYIGKKIGEIIPELSRSRSRSKTVQ-----MSEASLDQQPYHVLSVNLPHNSGSILIIN 202
                     E+I +     +           +       + +     N   +     +  
Sbjct: 1184 CEVFQYNREELIGQTHHLVNSGYHSPAFFQELWTTIGQGKVWKGEIKNQAKDGSHYWVDT 1243

Query: 203  SRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALS 262
              VP L    +                     +   +  + K+ +  L E+         
Sbjct: 1244 VIVPFLDEAGKPFQY----------------MAIRFEITQRKQAEIALQESEARFRVFFE 1287

Query: 263  RGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI-ARSVT 321
                G+   +   +   +++   +I+    +   L  +    + + D+    +  A+ + 
Sbjct: 1288 HAAVGIALASMTGQFITVNQKFCDILDY--QESELRGKTFQEITYPDDLPDTKTYAQQLV 1345

Query: 322  GKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEA 380
               V             G   W    A ++R  +G     +G+  D+ ++   E++   +
Sbjct: 1346 SGEVNAYSVEKRYVKRDGQITWSNTTASLVRDATGTPQYFVGVIEDIEQRKIAEQKLQAS 1405

Query: 381  DQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII 440
            ++R +   E +   +   D        N  + +  GL           + +       ++
Sbjct: 1406 ERRYATLTELSPTGIFRTDPQGNCCYVNTRWCEMAGLTPEDAQGQGWVNALHPDDRERMM 1465

Query: 441  EYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKR 499
            +      + R    + + +               DG  I +    T    +Q  +     
Sbjct: 1466 QEWDQAAQNRQMPFNTDCRFQK-----------PDGTVIWLVVQATEETDHQGNVTGYVG 1514

Query: 500  RLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE-----L 554
             +                  ++        Q  +ER   A    S  +  +S E     +
Sbjct: 1515 SIT---------------DISDRKQKEIALQESEERFRQAFDYASIGMGLVSPEGQWLKV 1559

Query: 555  RTPLNAILGFSEV-IKKEIFGELGSVK 580
             + L  I+G+SE  +    F ++    
Sbjct: 1560 NSSLCEIIGYSEAELLNTTFQDITHPD 1586



 Score =  148 bits (374), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 65/526 (12%), Positives = 162/526 (30%), Gaps = 58/526 (11%)

Query: 102  IKFDLASQKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
               D++ +K+ E  L +   + R     +   + L  P       ++     IG    E+
Sbjct: 1515 SITDISDRKQKEIALQESEERFRQAFDYASIGMGLVSPEGQWLKVNSSLCEIIGYSEAEL 1574

Query: 159  IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
            +    +  +    + +    + Q                +     +  + +       L 
Sbjct: 1575 LNTTFQDITHPDDLDIDLNFVRQMLA----------GEIVTYKMEKRYIHKQGDIIWILL 1624

Query: 219  VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
             V              S  +     K  +  L ++   V T       GL     D    
Sbjct: 1625 NVSLVRDHQGEPLYFISQIQDISDRKAAEQALQDSEQYVRTLFETSPIGLLLCRMDGNFV 1684

Query: 279  HLSRSMYEIMGIP-YENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
             L+ +   I+G    E + LS+  I    + + ++   + +     +    ++ +   H 
Sbjct: 1685 ELNPAFAAIIGYSLAETQQLSYWQITPESYSE-QEQVMLKQLEETGYYGPYEKEY--IHK 1741

Query: 338  SGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL 397
             G  + +++  +++           I  D+T++   EK+  +++ R    ++  +E +  
Sbjct: 1742 EGYLVPVRLSGRIIERHGEKFIWSSI-EDITDRKTAEKQLQDSETRYRGIVQDQTEFISR 1800

Query: 398  WDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEI 457
            +  +  ++  N  + + +G+    ++  N + +I +                        
Sbjct: 1801 FLPDGTILFVNEAFCRYFGVNASDIIGQNYQPVIYEPDRE-------------------- 1840

Query: 458  KLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILER 517
                 R +Q     + D     +   I  + + + +  +   R+           Q + R
Sbjct: 1841 -----RVMQQVSTLSPDNPITIIENRI--IVNGEIRWTQWVNRILFDDTGNFLEYQSVGR 1893

Query: 518  QKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL---------GFSEVI 568
                   A    Q   E  E     ++E LA+   +LR   N +          G    +
Sbjct: 1894 DIQARKEAEIALQQLNEELEQRVYERTEELARSEQDLRAIFNNVYDALFIYDGDGTLLDV 1953

Query: 569  KKEIFGELGSVKYYEYAQDIH--YSGQHLLNMINNILEMSKIETEK 612
                    G  +    A  ++   +  + L +I   LE  +++  +
Sbjct: 1954 NHRALELHGVTREQLLAATMNDFRTSNNALELIPEYLE--RLQQGE 1997



 Score =  117 bits (294), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 50/454 (11%), Positives = 125/454 (27%), Gaps = 50/454 (11%)

Query: 108  SQKKAESMLGQ---LLAKTRFLSESFILLAQPNELVFASSTKN-SHYIGKKIGEIIPELS 163
             +++A+  L +    L          +            +             EII +  
Sbjct: 2047 ERQQAQIALQESQRFLQTVLDTFPLNVFWKDRQSRFLGCNRTFMLGAELASPEEIIGKTD 2106

Query: 164  RSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFS 223
                 + T      + D+Q        L        II  ++          T ++   +
Sbjct: 2107 YDMPWASTEADLYRADDRQVMDSGQAKLG-------IIEPQLTADGSTIWLETNKLPLRN 2159

Query: 224  IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH---- 279
            +   ++  +    Y+     K  +  L +    + +        ++              
Sbjct: 2160 LEGEVIGVL--GTYQDISDRKRAEAQLAQQEQFLRSIYEGAEMPIFVVEVLPDNQFRYAG 2217

Query: 280  LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASG 339
             + +  ++ G+   +          ++  +  +          +  K +    H+   +G
Sbjct: 2218 WNLASEKMSGLRAVDVLGKHP--VEVLGEEIGQHFCQNYCRCLETGKAIQYEEHLDLPNG 2275

Query: 340  ADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
              +W       ++   G    I+G A+D++++   E+   E+       ++   + +   
Sbjct: 2276 -VVWTLTTLNPLKNSEGNIYRIVGTAVDISDRKEAEQALEESRNMFKLVLDTIPQRVFWK 2334

Query: 399  DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA--QTRPIIEYRTSDPERSQDMSKE 456
            D+  R + CN  +   Y L    +V      +            + R  +    Q   +E
Sbjct: 2335 DRQSRFLGCNPAFANDYQLTHADIVGKTDLELPWAKWGDLYRADDARVMNTRTPQLNYEE 2394

Query: 457  IKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
                              G  I + +    L + Q ++                      
Sbjct: 2395 ------------PTNNLAGENIWIRSSKIPLTNTQGEVVGVLGCYD-------------- 2428

Query: 517  RQKTELSIANAKYQVEKERAETANKTKSEFLAKM 550
               TE   A    +  +ER   A K+ ++ L  +
Sbjct: 2429 -DVTERKQAEQALEESEERLRLALKSANQGLYDL 2461



 Score =  114 bits (286), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 40/416 (9%), Positives = 121/416 (29%), Gaps = 37/416 (8%)

Query: 58   VFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIK-----FDLASQKKA 112
            V+L ++A +          Q ++   +  L + + +        ++      D++ +K  
Sbjct: 2507 VYLNYVAGTITDYRVEFRQQTQQGKWKWILSVGKIVAWDESGQPLRMLGTHTDISDRKSI 2566

Query: 113  ESMLGQLLAKTRFLSES--------FILLA----QPNELVFASSTKNSHYIGKKIGEIIP 160
            E  L +   + R   ++        +I         N          +     ++ E I 
Sbjct: 2567 EEQLIKREEQLRAALDASETGTFRWYIATKQLEWDDNLNRLFGLPLGA--TAHELDEFIT 2624

Query: 161  ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
             +     ++     + +  +   +      +  +     + +              +   
Sbjct: 2625 LVHPDDRQTVIDACNRSLQEGVDFEEEFRVVWPDGSIHWLFDKGKLFCDQQGNPCYMA-- 2682

Query: 221  FFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHL 280
                                 + K+ +  L E+NI + + +      ++  +   +    
Sbjct: 2683 --------------GACVDITQRKQTEQELQESNIILRSVIESTPDVVFVKDLQGRIVVG 2728

Query: 281  SRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGA 340
            + +  E+   P E               D     +       +  +       + H  G 
Sbjct: 2729 NSTFAEVFNQPIETLLGKNND--ERWSPDIAAYLKENDQRIIQLGRSETFEETLPHPQGM 2786

Query: 341  DIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDK 400
              ++  ++         + +IGIA D++++   E     ++Q L      + +AL + D 
Sbjct: 2787 RTYLTTKSPWYDPQGQIIGVIGIARDISDRKAAEAALKRSEQDLRTLFNNSYDALFIHDL 2846

Query: 401  NDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKE 456
            + R +  N    +  G     ++  +      +      +    ++  + + +  E
Sbjct: 2847 DGRFLDINDRVVELLGTSRENILARSVADFAAEEAPIDQLAEIFNNVAQGKSLRFE 2902



 Score =  111 bits (279), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 53/460 (11%), Positives = 138/460 (30%), Gaps = 23/460 (5%)

Query: 79   EKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNE 138
            + +           I +   N  ++  +  + +  +   Q L          + +   + 
Sbjct: 1889 QSVGRDIQARKEAEIALQQLNEELEQRVYERTEELARSEQDLRAIFNNVYDALFIYDGDG 1948

Query: 139  LVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSI 198
             +   + +     G    +++         S           ++     +V      G  
Sbjct: 1949 TLLDVNHRALELHGVTREQLLAATMNDFRTSNNALELIPEYLERLQQGETVQF-EWEGRR 2007

Query: 199  LIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE 258
            L   +        R           +    +     ++    ++ ++    L E+   ++
Sbjct: 2008 LGDRTLFDAEISMRSLALGNRPVILVGVRDISQKQAAF----RERQQAQIALQESQRFLQ 2063

Query: 259  TALSRGRCGLWNFNFDNKKFHLSRSMYEIMG--IPYENKTLSFRAIARLIHYDNKKICEI 316
            T L      ++  +  ++    +R+   ++G  +    + +               +   
Sbjct: 2064 TVLDTFPLNVFWKDRQSRFLGCNRTF--MLGAELASPEEIIGKTDYDMPWASTEADLYRA 2121

Query: 317  -ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLE 374
              R V      +L  I     A G+ IW++     +R + G  + ++G   D++++   E
Sbjct: 2122 DDRQVMDSGQAKLGIIEPQLTADGSTIWLETNKLPLRNLEGEVIGVLGTYQDISDRKRAE 2181

Query: 375  KRYAEADQRLSKAIECTSEALVLW----DKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
             + A+ +Q L    E     + +     D   R    N   +K  GL    ++  +   +
Sbjct: 2182 AQLAQQEQFLRSIYEGAEMPIFVVEVLPDNQFRYAGWNLASEKMSGLRAVDVLGKHPVEV 2241

Query: 431  IQDAQTRPIIEYRTSDPERSQDMSKEIK--LADS-RWLQINEWCTHDG-----GTISVGT 482
            + +   +   +      E  + +  E    L +   W         +        +    
Sbjct: 2242 LGEEIGQHFCQNYCRCLETGKAIQYEEHLDLPNGVVWTLTTLNPLKNSEGNIYRIVGTAV 2301

Query: 483  DITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTEL 522
            DI+  K  +  L ES+   K  ++ +       +RQ   L
Sbjct: 2302 DISDRKEAEQALEESRNMFKLVLDTIPQRVFWKDRQSRFL 2341


>gi|144899595|emb|CAM76459.1| sensory transduction histidine kinase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 565

 Score =  420 bits (1080), Expect = e-115,   Method: Composition-based stats.
 Identities = 138/527 (26%), Positives = 242/527 (45%), Gaps = 26/527 (4%)

Query: 246 NDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL 305
               L E+      A+     GLW++N   K+ +LS  +  I+G   E    +     ++
Sbjct: 50  TTRALRESEERYALAMRGPNEGLWDWNPITKELYLSARLLAILGFSGETVRTTSHDWLKM 109

Query: 306 IHYDNK-KICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGI 363
           +H D++                  +  + +R  +G   WI  R   +R  +G    ++G 
Sbjct: 110 VHPDDRVPYQSTLVQHLKGQTDHFECEYRVRGRNGEYRWILSRGLAVRDENGVATRMVGS 169

Query: 364 AMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLV 423
             D+T++   E     ++ R    +E  +  +V+   + R+   N   ++ +GL     +
Sbjct: 170 IGDVTDRKRREAVLRASEARFRSLVEAAASIIVVVGADGRVREFNREAERMFGLSAAAAI 229

Query: 424 PGNARSIIQDAQTRPIIEYRTSD-----PERSQDMSKEIKLADSRWLQINEWCTHDGGTI 478
            G A S I D+        R         +  Q   +E  L            + D G +
Sbjct: 230 -GRAWSTILDSNRVGQDGDRFDQWLDEVRKGWQVRDRETVLGQHIISWNLAPLSDDDGIV 288

Query: 479 SVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAET 538
            VG DIT  +  +  LR++   L+  +   +   +   RQ                 AE 
Sbjct: 289 IVGQDITQRRRAETALRQANDLLEYRVAARTAEAEAACRQ-----------------AEE 331

Query: 539 ANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
           AN+ KSEFLA MSHELRTPLNAI+GFS+ ++  + G + +  Y EY Q I  SG HLL++
Sbjct: 332 ANRGKSEFLANMSHELRTPLNAIIGFSDAMRLGVMGPVENPLYAEYVQAIWESGTHLLSI 391

Query: 599 INNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNAD 657
           IN++L++SK+E     +  +   L P+  + IRL+   A    +++  ++  +      D
Sbjct: 392 INDVLDLSKVEAGHFDLAPERLPLTPLAEQVIRLMAEKAMRHRLELRLQVDGDPGHALVD 451

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFE 717
              +K++LF +L+N++KFT   G +++   +      I +AD+GIG+    ++++ +PF 
Sbjct: 452 PLRLKQVLFNLLANAVKFTPAGGHVILSLGRDDGGSWIKVADSGIGMRPEDIDRVLEPFV 511

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
            + +   +   G GLGL ++     LHGG L + SQ G+GT+VTI +
Sbjct: 512 QIDSHLSRRNMGTGLGLPLAKRFIELHGGTLALASQPGQGTVVTIRL 558



 Score = 64.2 bits (155), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 37/304 (12%), Positives = 87/304 (28%), Gaps = 19/304 (6%)

Query: 91  EAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSES----FILLAQPNELVFASST- 145
               +    + I     +QK+A +    L+A TR L ES     + +  PNE ++  +  
Sbjct: 19  RRAVLSRLRSRISELELAQKEANASRDALMATTRALRESEERYALAMRGPNEGLWDWNPI 78

Query: 146 KNSHYIGKKIGEIIPELSRSRSRSKTV--QMSEASLDQQPYHVLSVNLPHNSGSILIINS 203
               Y+  ++  I+     +   +     +M            L  +L   +        
Sbjct: 79  TKELYLSARLLAILGFSGETVRTTSHDWLKMVHPDDRVPYQSTLVQHLKGQTDHFECEYR 138

Query: 204 RVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSR 263
                  +R  ++  +         +   +          K  + +L  +     + +  
Sbjct: 139 VRGRNGEYRWILSRGLAVRDENG--VATRMVGSIGDVTDRKRREAVLRASEARFRSLVEA 196

Query: 264 GRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRA--IARLIHYDNKKICEIARSVT 321
               +     D +    +R    + G+          +  +       +    +      
Sbjct: 197 AASIIVVVGADGRVREFNREAERMFGLSAAAAIGRAWSTILDSNRVGQDGDRFDQWLDEV 256

Query: 322 GKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEAD 381
            K  +  D+        G  I I      +    G   I+ +  D+T++   E    +A+
Sbjct: 257 RKGWQVRDRE----TVLGQHI-ISWNLAPLSDDDG---IVIVGQDITQRRRAETALRQAN 308

Query: 382 QRLS 385
             L 
Sbjct: 309 DLLE 312


>gi|298676132|ref|YP_003727881.1| multi-sensor signal transduction histidine kinase [Methanohalobium
           evestigatum Z-7303]
 gi|298289120|gb|ADI75085.1| multi-sensor signal transduction histidine kinase [Methanohalobium
           evestigatum Z-7303]
          Length = 995

 Score =  420 bits (1079), Expect = e-115,   Method: Composition-based stats.
 Identities = 144/667 (21%), Positives = 257/667 (38%), Gaps = 49/667 (7%)

Query: 105 DLASQKKAESMLG---QLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPE 161
           D+  +K  E  L      + K    S   I     N  +  ++      +G    +I   
Sbjct: 363 DITYRKIIEQDLRTERDFIEKVADTSPICITKVDRNGYIVYANHAAEMVLGLSKSKIQER 422

Query: 162 LSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV-V 220
                    T         ++        +      +  +   +      R+ +++    
Sbjct: 423 TYDDVKWKITDFDGNYYPQEELPF---ELVQKYLEPVYDVRHAIQWPDGQRKLLSINAAP 479

Query: 221 FFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHL 280
            F   +      L +      +  E +  L E+       +     G++  N D     +
Sbjct: 480 IFDDYNRFDG--LVAAIENISEKIEKERELKESEKKFRNYIDHSPIGIFVANKDGYYVDV 537

Query: 281 SRSMYEIMGIPYENKTLSFRAIARLIHYDN-KKICEIARSVTGKHVKQLDQIFHMRHASG 339
           + +   I G   +   LS   I   +H  +  +    A +   ++ K             
Sbjct: 538 NPAASSITGYTRDE-LLSMNLID--LHPQDVLEQIYQAYNYLVENGKT-SVELPFITKKS 593

Query: 340 ADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWD 399
              +  + A  +         +G   D+TE+  +E    E++ R    IE  ++A++  D
Sbjct: 594 ELRYFILDAVKLSDD----KYLGFTTDITERKKVEDELKESEGRFRTVIEQAADAIIAHD 649

Query: 400 KNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKL 459
            +  ++  N       G     L+  N   I       P I+           +S     
Sbjct: 650 FDGNILYVNDLTCDNLGYTKDELLSMNLADI------DPNIDTYEPRKRYWDKLSYHS-- 701

Query: 460 ADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQK 519
               +L        DG    V   +TL+  +   +                      R  
Sbjct: 702 ---SYLIETVNRRKDGSEFPVEVKMTLMNLSGKPVILGFV-----------------RDI 741

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
           T    A  K    K  AE AN+ KSE LA +SHELRTPL +I+GFS+VI K   G+L   
Sbjct: 742 TVRKQAEEKLINAKLEAEAANQAKSELLANVSHELRTPLTSIIGFSDVILKRKVGDLN-D 800

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
               Y   IH SGQHLL++IN+IL+++KIE+ K+ + ++   +  ++N+    +   A  
Sbjct: 801 NQTRYLDKIHKSGQHLLDLINDILDLAKIESGKLELHREKISIPALLNDLESKLYPFASK 860

Query: 640 KNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIA 698
           K + ++ +I   + +  AD+  +++IL+ ++ N+IKFTN  G + +   +       ++ 
Sbjct: 861 KGLSLDSEIDPNIEYIYADEIKLRQILYNLIYNAIKFTNK-GSVTVTVRQKNDAYQFSVI 919

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           DTGIGIP+   ++I + F  L     +   G GLGLA+   L  +HGG++ + S+E KGT
Sbjct: 920 DTGIGIPEDKQDEIFESFRQLDTGASRRYAGTGLGLALVKRLVEIHGGQIWVESEESKGT 979

Query: 759 IVTICMP 765
             T  +P
Sbjct: 980 TFTFTIP 986



 Score = 85.4 bits (210), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 63/572 (11%), Positives = 169/572 (29%), Gaps = 63/572 (11%)

Query: 51  TIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQK 110
               + ++ +  +    I      Y     +    S              ++   +  +K
Sbjct: 45  LFIYLVILPVFLLFGIVIASAMGEYKNLNNVFQSVS--------------DVNQLIIREK 90

Query: 111 KAESMLGQL---LAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS 167
             E +L +    L  +R    ++I+L   +  + ASS      +G    + +    R   
Sbjct: 91  NVEQLLQRTCDILTNSRTFESTWIILFDEDGNITASSESG---VGPSFNDFLKRYERGEM 147

Query: 168 RSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISA 227
                 +   S +         N       +        + RL        ++  S    
Sbjct: 148 SRCLQDLFYQSDNLLVIENKKSNCSDCPLILKETGYNALVSRLEHGNKLYGILAVSGSDD 207

Query: 228 LLLFILFSYYRQAKKNK-------ENDTILLEANICVETA----LSRGRCGLWNFNFDNK 276
           ++       + +   +        E++  L+E      T     L   + G++  +    
Sbjct: 208 IISERGKQLFHEVTSDISYALYNLESENKLIEKEERHRTIVDDVLDSSKVGIFILDSCFH 267

Query: 277 KFHLSRSMYEIMGIPYENKTLS-----FRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
              ++  M +  GI  E+              + I  D+ +      +    +    +  
Sbjct: 268 VVWINEPMEDYFGIDREDIIGKDKRQLVEDKLKHIFEDSDEFANRLLATYDDNSYIENFE 327

Query: 332 FHMR-HASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
            H+   ++  + W++  +Q +++       I    D+T +  +E+        + K  + 
Sbjct: 328 CHVLPDSNREERWLEHWSQPIKSGLYAGGRIEHYYDITYRKIIEQDLRTERDFIEKVADT 387

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS 450
           +   +   D+N  +V  N   +   GL    +        ++   T     Y    P+  
Sbjct: 388 SPICITKVDRNGYIVYANHAAEMVLGLSKSKIQERT-YDDVKWKITDFDGNYY---PQEE 443

Query: 451 QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLST 510
                  K  +  +   +     DG    +  +   +  +  +       ++     +  
Sbjct: 444 LPFELVQKYLEPVYDVRHAIQWPDGQRKLLSINAAPIFDDYNRFDGLVAAIENISEKIEK 503

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK---MSHELRTPLNAILGFS-- 565
            R        EL  +  K++   +     +     F+A       ++    ++I G++  
Sbjct: 504 ER--------ELKESEKKFRNYID-----HSPIGIFVANKDGYYVDVNPAASSITGYTRD 550

Query: 566 EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLN 597
           E++   +          +  + I+ +  +L+ 
Sbjct: 551 ELLSMNLIDLHP----QDVLEQIYQAYNYLVE 578


>gi|209522754|ref|ZP_03271312.1| multi-sensor hybrid histidine kinase [Arthrospira maxima CS-328]
 gi|209496803|gb|EDZ97100.1| multi-sensor hybrid histidine kinase [Arthrospira maxima CS-328]
          Length = 1769

 Score =  420 bits (1079), Expect = e-115,   Method: Composition-based stats.
 Identities = 137/723 (18%), Positives = 279/723 (38%), Gaps = 72/723 (9%)

Query: 102  IKFDLASQKKAESMLGQLLAKTRFLSESFIL---LAQPNELVFASSTKNSHYIGKKIGE- 157
            +  D+   ++AE+ L     + R + +S ++          +  ++ +    +G    + 
Sbjct: 897  VNLDITDIRQAEAALQASETRFRRVFDSNVVGMMFTNFAGDIIEANDRFLEMLGYSRAQR 956

Query: 158  ---IIPEL--SRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
               +I     +    R   +Q  E        H       H  G ++ +   V +L    
Sbjct: 957  PMGLINWAEITPPEYRELDLQAIEHLRQSGFIHPFEKAYRHQDGHLVFVLIGVAMLSQ-- 1014

Query: 213  EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
                            ++  + +     ++  + +  L E+ + +E  L+    GLW++ 
Sbjct: 1015 ---------TDGSCVCVVVNISAQKAALQERTKAEQALQESKLRLELGLASANTGLWDWK 1065

Query: 273  FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC-EIARSVTGKHVKQLDQI 331
                +   ++    ++G                +H D+     +          +     
Sbjct: 1066 MQTGELWFNKQWKSMLGYQEHEIENRLTEWQSRVHPDDLAQVYQDVERHIQGKTELYRNE 1125

Query: 332  FHMRHASGADIWIQVRAQ-MMRTISGGM-NIIGIAMDLTEKYHLE---KRYAEADQRLSK 386
              +R   G+  WI  + + + R   G +   IG   D++++   E   ++ A+ ++ L +
Sbjct: 1126 HRLRCKDGSYRWILAQGRMVERDAEGRLLRFIGTHTDISDRKKAEQTIEQQAQRERLLRE 1185

Query: 387  A---IECTSEALVLWDKNDRLVMCN---------ANYQKAYGLPDHVLVPGNARSIIQDA 434
                I  + +   ++D   R + CN           +    G  D   V  +  +     
Sbjct: 1186 TNQRISQSLDLPTIFDTASREI-CNCLQGSRVGIFKFYPDSGYDDGEFVAESVVNDFPSV 1244

Query: 435  QTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHD-------GGTISVGTDITLL 487
               P+ ++   +   S        +AD       E C  D          + +      +
Sbjct: 1245 LAIPVHDHCFGENYASLYAQGRYYVADDIHHDGLENCHVDILSQFQVRANLVIPIICQDV 1304

Query: 488  KHNQAQLRESKRRLKATINDLSTSRQ------ILERQKTELSIANAKYQVE--------- 532
                  + +         +D+  ++Q      I  +Q         + +           
Sbjct: 1305 LWGLLCIHQCDGPRHWEQSDIDLAQQFSFQLAIAIQQSNLFEQLQQELRERQQAQQQLTQ 1364

Query: 533  -KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYS 591
              +    A + K EFLA MSHELRTPLNAILG +E + +E+FG +   +  +  Q +  S
Sbjct: 1365 RNQELIRATRLKDEFLANMSHELRTPLNAILGMTEGLHEEVFGPVN-DRQLKALQTVERS 1423

Query: 592  GQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE 651
              HLL +IN+IL+++KIE+ ++ ++     + P+    I  I   A  K I++   +P  
Sbjct: 1424 ASHLLALINDILDVAKIESGQVELECSPTAIAPLCKSSIAFIKQQALKKRIQLSVNLPLN 1483

Query: 652  LF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT-----SKIGQ---CVIITIADTGI 702
            L     D+R I+++L  +L+N++KFT   G + +        +       +  ++ DTGI
Sbjct: 1484 LPDIILDERRIRQVLINLLNNAVKFTPEGGSITLEVILPPPREAEGESPYLRFSVRDTGI 1543

Query: 703  GIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
            GI    ++K+ QPF  + +  ++   G GLGLA++  +  LHGGR+ + S+ G G+  +I
Sbjct: 1544 GISPENIKKLFQPFMQIDSALNRQYQGTGLGLALTKQIVELHGGRVGLTSEVGVGSCFSI 1603

Query: 763  CMP 765
             +P
Sbjct: 1604 DLP 1606



 Score =  136 bits (343), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 53/556 (9%), Positives = 132/556 (23%), Gaps = 42/556 (7%)

Query: 16   PGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRY 75
            P   Q +   + +   +    +        S             L  +   +  K  +  
Sbjct: 689  PTRHQILEPQATEILDQTLDCLFQ--DEAESRTR----------LPILEALTTGKTVSFE 736

Query: 76   AQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAES---MLGQLLAKTRFLSESFIL 132
             Q +    +     + +     +   +  D+  +K+AE+    L Q L            
Sbjct: 737  YQIDLEDRRIYFEASISPMSDRRVIWVARDMTKRKQAEAEIFQLSQRLKIALSSGNIGFW 796

Query: 133  LAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLP 192
                 +       +     G              +             Q    +L   + 
Sbjct: 797  DWDLRQNQITWDEQMYALYGVDNSSYFSSPESVVAYEVWSHGVHPDDRQAAADLLQKAI- 855

Query: 193  HNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLE 252
               G          L                   A     +          ++ +  L  
Sbjct: 856  --LGEADYNTEFRVLHPDGSLHYIKASGLVVRDEAGQPISMIGVNLDITDIRQAEAALQA 913

Query: 253  ANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKK 312
            +             G+   NF       +    E++G     + +     A +   + ++
Sbjct: 914  SETRFRRVFDSNVVGMMFTNFAGDIIEANDRFLEMLGYSRAQRPMGLINWAEITPPEYRE 973

Query: 313  ICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKY- 371
            +   A     +           RH  G  +++ +   M+    G    + + ++++ +  
Sbjct: 974  LDLQAIEHLRQSGFIHPFEKAYRHQDGHLVFVLIGVAMLSQTDGSC--VCVVVNISAQKA 1031

Query: 372  ------HLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG 425
                    E+   E+  RL   +   +  L  W      +  N  ++   G  +H +   
Sbjct: 1032 ALQERTKAEQALQESKLRLELGLASANTGLWDWKMQTGELWFNKQWKSMLGYQEHEIENR 1091

Query: 426  -NARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDI 484
                           +        + +      +               DG    +    
Sbjct: 1092 LTEWQSRVHPDDLAQVYQDVERHIQGKTELYRNEHR---------LRCKDGSYRWILAQG 1142

Query: 485  TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKS 544
             +++ +              I+D   + Q +E+Q           +   +R   +    +
Sbjct: 1143 RMVERDAEGRLLRFIGTHTDISDRKKAEQTIEQQA----QRERLLRETNQRISQSLDLPT 1198

Query: 545  EFLAKMSHELRTPLNA 560
             F    S E+   L  
Sbjct: 1199 IF-DTASREICNCLQG 1213



 Score =  103 bits (257), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 51/456 (11%), Positives = 129/456 (28%), Gaps = 51/456 (11%)

Query: 73  TRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESML---------------- 116
                + ++    S+ L  A++   Q+  ++ ++  ++KA+  L                
Sbjct: 465 DWQTGEIELLQALSIQLAIALKQATQHEQLQNEIRQRQKAQLALASLNSELESRVEQRTA 524

Query: 117 --GQLLAKTR---FLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKT 171
                 A+ R     +   I LA P   +  ++       G    +              
Sbjct: 525 ELQAREARYRGLMEGASDAIFLATPEGYLIEANRAAEDLFGYSRDDFSGLS--LERSPLH 582

Query: 172 VQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLF 231
           +       +          +      + ++     +L+    E+ +++    I       
Sbjct: 583 ISQLHPPEELDRIFSSFERIIEE-KQLWVL--DTRILKADGSEIPVDISGSLIK-VGQTH 638

Query: 232 ILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIP 291
           I+   +R        +  L  +   + +        +     D +K ++  + ++I+   
Sbjct: 639 IVQGIFRDIGDRAAFEEKLRSSETELRSVFEAMGDLVLIIAPDARKVNVMPTRHQIL--E 696

Query: 292 YENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM 351
            +   +  + +  L   + +    +         K +   + +       I+ +     M
Sbjct: 697 PQATEILDQTLDCLFQDEAESRTRLPILEALTTGKTVSFEYQIDLED-RRIYFEASISPM 755

Query: 352 RTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANY 411
                   +I +A D+T++   E    +  QRL  A+   +     WD     +  +   
Sbjct: 756 SD----RRVIWVARDMTKRKQAEAEIFQLSQRLKIALSSGNIGFWDWDLRQNQITWDEQM 811

Query: 412 QKAYGL-------PDHVLVPGNARSIIQDAQTRPIIEYRTSDP---ERSQDMSKEIKLAD 461
              YG+           +V     S       R             E   +    +   D
Sbjct: 812 YALYGVDNSSYFSSPESVVAYEVWSHGVHPDDRQAAADLLQKAILGEADYNTEFRVLHPD 871

Query: 462 S--RWLQINEWCTHDG-----GTISVGTDITLLKHN 490
               +++ +     D        I V  DIT ++  
Sbjct: 872 GSLHYIKASGLVVRDEAGQPISMIGVNLDITDIRQA 907


>gi|119356453|ref|YP_911097.1| multi-sensor hybrid histidine kinase [Chlorobium phaeobacteroides DSM
            266]
 gi|119353802|gb|ABL64673.1| multi-sensor hybrid histidine kinase [Chlorobium phaeobacteroides DSM
            266]
          Length = 1398

 Score =  420 bits (1079), Expect = e-115,   Method: Composition-based stats.
 Identities = 131/626 (20%), Positives = 252/626 (40%), Gaps = 49/626 (7%)

Query: 180  DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQ 239
              + + +  + L   SG  +     +  +  ++  +   +    I   ++L +LF +   
Sbjct: 474  QGKSWRLNFLPLEDASGRTIGRMLVIQDVSFYQAGIFRMITLAGIALLVILSLLFGFLFV 533

Query: 240  AKKNKEN-----DTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYEN 294
              K  +      +  L+++      A++    G+W+++  +   +LS    + +G   ++
Sbjct: 534  VLKRIDRGVINREQELIDSREQYRLAVNGSNDGIWDWDMRSDTLYLSPKWKKTLGYEDDD 593

Query: 295  KTLSFRAIARLIHYDNKKICEIARSV-TGKHVKQLDQIFHMRHASGADIWIQVRAQMMRT 353
             +  ++    L+H ++K +            +   +  F +RH  GA +WI  R +++R 
Sbjct: 594  LSNIYKTFEDLVHPEDKPVFRTYLDRYLNGEIPLFNIEFRIRHKDGAYVWILGRGEVLRD 653

Query: 354  ISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND---------- 402
             SG    + G   D+T +   E             +   +   V    ++          
Sbjct: 654  KSGSPYRMAGSMSDITGRKKDEDELKRRSA-FQLVVMDLAIGFVNTPLDELDRSIERALA 712

Query: 403  --------------RLVMCNANYQKAYGLPDHVLVP-GNARSIIQDAQTRPIIEYRTSDP 447
                          R    N      +      + P  N    + ++     +    +  
Sbjct: 713  LVGEFLQVDRSYLFRYDFANGTMSNTHEWCSEGIAPEKNNLQNLLNSIIPDWVATHLA-- 770

Query: 448  ERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIND 507
             R   +S    L D   L++          IS+                 +   K   ++
Sbjct: 771  GRIVHISSVDALDDESALKMILASQGIKTLISLPLIYHEHCFGFVGFDAVREVKKWGDDE 830

Query: 508  LSTSRQILER-QKTELS-IANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS 565
            +S  R + E     EL           +  AE+AN+ KSEFLA MSHE+RTP+N ++G +
Sbjct: 831  ISLLRVLAELFTNAELRFRHETALVDARYAAESANRAKSEFLANMSHEIRTPMNGVIGMA 890

Query: 566  EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPI 625
             ++         S +  ++A  +  SG+ LL +IN+IL+ SKIE  K+ ++    DL  +
Sbjct: 891  NLLLDTDL----SDEQRDFADMLLASGESLLTVINDILDFSKIEAGKLELEHIVFDLRKL 946

Query: 626  INEGIRLIGSSAQSKNIKIEKKIPSELFFN--ADKRIIKKILFPILSNSIKFTNNNGKMM 683
            +     ++G  A  KN++    +  E+      D   I++IL  +  N+IKFT  NG + 
Sbjct: 947  LESFGAVMGLKAVEKNLEFNCVVSPEVPVFFKGDPGRIRQILNNLAGNAIKFT-QNGNVT 1005

Query: 684  IRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISD 738
            +  S   +      +  ++ DTGIGIP++ L+++ + F  +     +  GG GLGLAIS 
Sbjct: 1006 VAVSMQSENNGDAVLRFSVKDTGIGIPEAKLDRLFKSFTQVDASTTRKYGGTGLGLAISR 1065

Query: 739  ALTNLHGGRLKIISQEGKGTIVTICM 764
             L  L GG++ +IS EG G+     +
Sbjct: 1066 QLVELMGGKIGVISHEGNGSEFWFTI 1091


>gi|298675091|ref|YP_003726841.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanohalobium evestigatum Z-7303]
 gi|298288079|gb|ADI74045.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanohalobium evestigatum Z-7303]
          Length = 996

 Score =  419 bits (1078), Expect = e-115,   Method: Composition-based stats.
 Identities = 135/665 (20%), Positives = 271/665 (40%), Gaps = 57/665 (8%)

Query: 105 DLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSR 164
           D+ + K+ E  L  L+  T   S + I ++  +  +  +++ +         EI+ +   
Sbjct: 385 DITAYKEKEDTL-HLMKNTLESSINAIAISDLDGYLTYANSASLDMWEYNKEEILGKHIT 443

Query: 165 SRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSI 224
              + K   ++              +  H +GS      +         +V   +   + 
Sbjct: 444 EFWQYKENAINV------------YHYLHENGS-WKSEGKAKTKHGNVFDVYSLINLVND 490

Query: 225 ISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSM 284
            S   + I  S+     K K  +  L ++   +   +     G++  + +     ++ + 
Sbjct: 491 ESGKPVAIAGSFV-DITKRKSYEEKLKKSEQQLRNYIDNSPIGIFVIDKNGNYVDVNPAA 549

Query: 285 YEIMGIPYENKTLSFRAIARLIHYDN-KKICEIARSVTGKHVKQLDQIFHMRHASGADI- 342
             I+G   +   LS   I   +H DN  ++         ++ K +         + +   
Sbjct: 550 CHIIGYTKDE-LLSMNIID--LHPDNAHELAGQIFEELLENGK-VSAELPFITKNDSLRY 605

Query: 343 WIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
           WI    +++         IG   D+T++  +E+   E+++R     E  ++A++  D + 
Sbjct: 606 WILDAVKLLED-----KYIGFTTDITDRKRIEEELRESEERFRTLTEQAADAIIAHDFDG 660

Query: 403 RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADS 462
            +V  N    +  G     L+  N             I    +  +  + +  E      
Sbjct: 661 NIVYVNNLACENLGYSKEELLSMNIAD----------ISAYINSYD-PKTVYWEKLSPSD 709

Query: 463 RWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTEL 522
            +L   +    DG        +T +      +                      R+ T  
Sbjct: 710 SYLVETKLRRKDGSYYPAEVKLTRIDLKGRSVILGFV-----------------REITIR 752

Query: 523 SIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYY 582
             A       K  AE A++ KSE LA +SHELRTPL +I+GFS+++ K   G+L      
Sbjct: 753 KQAEESLINSKLEAEAASQAKSELLANVSHELRTPLTSIIGFSDILLKGKLGDLN-ESQK 811

Query: 583 EYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNI 642
            Y   +H SG+HLL++I +IL++SKIE+ K  +  +   +  ++ +    I   A  K +
Sbjct: 812 TYLSKVHRSGKHLLDLITDILDLSKIESGKHELHCEKVSIPQLMKDLKENIYPFASQKGL 871

Query: 643 KIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTG 701
           +I   I   + +  ADK  +++IL+ ++ N++KFT   G + ++       ++ ++ DTG
Sbjct: 872 EINIDINRSIEYIYADKIKLRQILYNLVYNAVKFT-EQGSVTVKLDWNDNDMLFSVIDTG 930

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           IGIP    ++I   F+ L +   +   G GLGLA+ + L  +HGG++ + S+E +G+  +
Sbjct: 931 IGIPADKQDEIFDSFKQLDSGASRRYSGTGLGLALVERLVEMHGGKIWVESEEREGSRFS 990

Query: 762 ICMPQ 766
             +P+
Sbjct: 991 FIIPE 995



 Score = 95.4 bits (236), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/439 (10%), Positives = 109/439 (24%), Gaps = 63/439 (14%)

Query: 67  SIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFL 126
           +   +  ++ +   ++   S  +T              D+ SQ+K +  L  +       
Sbjct: 89  TYFSLFGKHIRITVISPNKSKFITIF-----------TDITSQRKTDDELKTIYENV--- 134

Query: 127 SESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHV 186
               I++      +F  +     + G    E++        R         SL       
Sbjct: 135 -PMVIMMVDSERRIFKVNKSAELFSGTTSDEMVG------LRGGEALRCLNSLSNPDGCG 187

Query: 187 LSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSY---------- 236
                        +I++       +  E +L  +    +  L   I  S           
Sbjct: 188 FGQYCQECKVKNTVIDTFETGNNHYNVETSLPFMIDGDVKYLTFLISTSLINNDEKPKVI 247

Query: 237 --YRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYEN 294
                  + K+    L +     E         +   N +    + + +   ++G+    
Sbjct: 248 VSLLDITERKKTQKNLNKEKDFFEKVAETSPVCITKVNKNGNIVYANSAAENVLGLSKSE 307

Query: 295 KTLS--------FRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
                              +  + +   E+ +          D    +   +G    + +
Sbjct: 308 IEGRTYDNVKWKITDFKGNLFPETELPFELVQKY---QKPVYDVRHAIEWPNGQRKLLSI 364

Query: 347 RAQMMRTISGGMN-IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLV 405
            A  +   +G    II    D+T     E         L    E +  A+ + D +  L 
Sbjct: 365 NAAPIFDDNGNFGSIIATIEDITAYKEKEDTLHLMKNTL----ESSINAIAISDLDGYLT 420

Query: 406 MCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWL 465
             N+     +      ++  +                     + +          +  W 
Sbjct: 421 YANSASLDMWEYNKEEILGKHITEF--------------WQYKENAINVYHYLHENGSWK 466

Query: 466 QINEWCTHDGGTISVGTDI 484
              +  T  G    V + I
Sbjct: 467 SEGKAKTKHGNVFDVYSLI 485



 Score = 63.5 bits (153), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 43/386 (11%), Positives = 105/386 (27%), Gaps = 65/386 (16%)

Query: 137 NELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSG 196
           +  +   +      +G K  E++ +L+ +   +                   V       
Sbjct: 34  DYKIIDINPAYESIVGLKRDEVVGQLASNIYDTGEAPFLHTY--------AKVAETGEQT 85

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
                        L+ + + + V+  +    + +      +      ++ D  L      
Sbjct: 86  C------FETYFSLFGKHIRITVISPNKSKFITI------FTDITSQRKTDDELK----- 128

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTL-----SFRAIARLIHYD-- 309
             T        +   + + + F +++S     G   +         + R +  L + D  
Sbjct: 129 --TIYENVPMVIMMVDSERRIFKVNKSAELFSGTTSDEMVGLRGGEALRCLNSLSNPDGC 186

Query: 310 -------NKKICEIARSVTGKHVKQLDQI----FHMRHASGADIWI-QVRAQMMRTISGG 357
                    K+               +      F +    G   ++  + +  +      
Sbjct: 187 GFGQYCQECKVKNTVIDTFETGNNHYNVETSLPFMI---DGDVKYLTFLISTSLINNDEK 243

Query: 358 MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL 417
             +I   +D+TE+   +K   +      K  E +   +   +KN  +V  N+  +   GL
Sbjct: 244 PKVIVSLLDITERKKTQKNLNKEKDFFEKVAETSPVCITKVNKNGNIVYANSAAENVLGL 303

Query: 418 PDHVLVPGNAR-----------SIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQ 466
               +                 ++  + +    +  +   P      + E      + L 
Sbjct: 304 SKSEIEGRTYDNVKWKITDFKGNLFPETELPFELVQKYQKPVYDVRHAIEWPNGQRKLLS 363

Query: 467 INEWCTHD-----GGTISVGTDITLL 487
           IN     D     G  I+   DIT  
Sbjct: 364 INAAPIFDDNGNFGSIIATIEDITAY 389



 Score = 46.5 bits (109), Expect = 0.017,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 51/164 (31%), Gaps = 16/164 (9%)

Query: 103 KFDLASQKKAESMLGQLLAKTRFLSE---SFILLAQPNELVFASSTKNSHYIGKKIGEII 159
             D+  +K+ E  L +   + R L+E     I+    +  +   +      +G    E++
Sbjct: 622 TTDITDRKRIEEELRESEERFRTLTEQAADAIIAHDFDGNIVYVNNLACENLGYSKEELL 681

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
                  S               P  V    L  +   ++    R      +  EV L  
Sbjct: 682 SMNIADISAYINS--------YDPKTVYWEKLSPSDSYLVETKLRRKDGSYYPAEVKLTR 733

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSR 263
           +     S +L      + R+    K+ +  L+ + +  E A   
Sbjct: 734 IDLKGRSVIL-----GFVREITIRKQAEESLINSKLEAEAASQA 772


>gi|218441882|ref|YP_002380211.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7424]
 gi|218174610|gb|ACK73343.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7424]
          Length = 955

 Score =  419 bits (1077), Expect = e-114,   Method: Composition-based stats.
 Identities = 139/685 (20%), Positives = 260/685 (37%), Gaps = 51/685 (7%)

Query: 92  AIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNS 148
            +        I  ++++ K+ E  L       R + E+    I + QP+     +S    
Sbjct: 158 NLSQPEHFLGIIRNISNCKRVELQLRHNEHLYRAIGETIDYGIWVCQPDGRNIYASESFL 217

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
           + +G    E       +       Q + ++  +        +  H    +          
Sbjct: 218 NLVGLTQEECSNFGWGNVLHPDDAQETISAWKECSRIGSFWDREHRYRGVD--------- 268

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
             W   +   V        ++            + K+ +  L E+              +
Sbjct: 269 GQWHPILARGVPVRDANGDII--CWAGINLDISRLKQTEEKLRESEERFRILADSAPVLI 326

Query: 269 WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL 328
           W   F+     ++++  +  G           A +  +H D+    ++    T K  +  
Sbjct: 327 WMNGFEGGCEFVNKAYLDFFGKTLSEVQG--LAWSDYLHPDDASYIQVYLK-TFKERQPF 383

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
                 + A G   W++ RA    + +G     IG + D++E    E+   + +QR S  
Sbjct: 384 RAQGRFKRADGQYRWLESRANPRFSSTGEFLGYIGTSSDISEIKEAEEALLQREQRFSTL 443

Query: 388 IECTSEALVLW-----DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
                + ++++           +  N    K  G     L+  + R I+        I  
Sbjct: 444 FNGMEDWILVYPVTEEGHPGNFIEVNEQACKKLGYSREELLQMSVRDIVNTLFINAEI-- 501

Query: 443 RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
                      + +  L+    +  +   T DG  I V    TL                
Sbjct: 502 -----------NFKKLLSAKHLVLESVHRTKDGENIPVEVSATLFT----------LNGL 540

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
            T+  +       ++ + E      + Q  +E AE+AN+ K EFLA +SHELR+PLN IL
Sbjct: 541 PTVQAICRDITERKQIEQERENLLIQEQAAREVAESANRIKDEFLAVLSHELRSPLNPIL 600

Query: 563 GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
           G+++++            + +    I  + Q    +I ++L++S+I   K+++   + +L
Sbjct: 601 GWAKLLNTHTLEPAT---HQKALSIIERNAQLQAELIEDLLDVSRILRGKLTLKIVSVNL 657

Query: 623 IPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGK 681
             II+  I  I  +AQ+KNI+I+ K+   +     D   +++I++ +LSN++KFT   GK
Sbjct: 658 GFIIDSAIETIRLAAQAKNIQIQTKLDPNIGEVLGDPARLQQIVWNLLSNAVKFTPTGGK 717

Query: 682 MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
           + I  + +G    I + DTG GI    L  I   F    +   +  GG GLGLAI+  L 
Sbjct: 718 VEIELNSLGNWAKIRVTDTGKGITSDFLPHIFDYFRQADSTTTRIFGGLGLGLAIARHLV 777

Query: 742 NLHGGRLKIIS-QEGKGTIVTICMP 765
            LHGG +K  S  EG+G    + +P
Sbjct: 778 ELHGGTIKAESLGEGQGATFIVKLP 802



 Score = 66.5 bits (161), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/258 (9%), Positives = 82/258 (31%), Gaps = 26/258 (10%)

Query: 279 HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS 338
           +    + ++ G+P +    S + +   I     +    A +        ++  + +    
Sbjct: 91  YWGSHLSQVYGLPTDILKKSIQEV---ISVSVGEQITEAFARLQVGQSLVNLEYSLVVNE 147

Query: 339 GADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
             + + ++R   +  +S   + +GI  +++    +E +    +       E     + + 
Sbjct: 148 QEEFY-EIR---LVNLSQPEHFLGIIRNISNCKRVELQLRHNEHLYRAIGETIDYGIWVC 203

Query: 399 DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK 458
             + R +  + ++    GL           +++     +  I              KE  
Sbjct: 204 QPDGRNIYASESFLNLVGLTQEECSNFGWGNVLHPDDAQETISAW-----------KECS 252

Query: 459 LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
              S W + + +   DG    +      ++     +             ++     L++ 
Sbjct: 253 RIGSFWDREHRYRGVDGQWHPILARGVPVRDANGDII--------CWAGINLDISRLKQT 304

Query: 519 KTELSIANAKYQVEKERA 536
           + +L  +  ++++  + A
Sbjct: 305 EEKLRESEERFRILADSA 322


>gi|120610741|ref|YP_970419.1| multi-sensor hybrid histidine kinase [Acidovorax citrulli AAC00-1]
 gi|120589205|gb|ABM32645.1| multi-sensor hybrid histidine kinase [Acidovorax citrulli AAC00-1]
          Length = 1622

 Score =  419 bits (1076), Expect = e-114,   Method: Composition-based stats.
 Identities = 130/690 (18%), Positives = 259/690 (37%), Gaps = 57/690 (8%)

Query: 91   EAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFIL------LAQPNELVFASS 144
              I I+  + N+   + + ++ +    +         ++ I       L   +  +   +
Sbjct: 450  RRIAIVGLHENVTERITAHQELQR--RERELNEALAQQTAIFDNAPPVLIVADGRLLRFN 507

Query: 145  TKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSR 204
                  +G + G++           + +                  +     +   +   
Sbjct: 508  PACLELLGAQPGQLEGRGVEVIFGGEELHRR-----------FLERVEGRLEAGESVREV 556

Query: 205  VPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRG 264
              L+R         +    +                 + + ++  + E N  +  A   G
Sbjct: 557  ARLVRRDGTVFEARLSGRLLPLQGYGLACIWVVEDVTEARRSEAAMREMNERLILAQEAG 616

Query: 265  RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKH 324
            R G+++ +        S  +  + G+P++ + L        +H +++   +         
Sbjct: 617  RVGVFDLDLARDHLVFSEKLASLYGLPHQPQGLRLMDWMDSLHLEDRPRVQARLDAALAG 676

Query: 325  VKQLDQI-FHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQ 382
                 Q  + +    G++ W+   A++ R   G    +IG+ +D+ E+  LE R A+   
Sbjct: 677  AATGLQDSWRVVRPDGSERWLLCSARIERDAEGRARRLIGVQVDVHEQKQLEARLADQLA 736

Query: 383  RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
                 ++     L   D + R    N  Y++A+G+     +       + +A      E 
Sbjct: 737  FQQALVDAIPIPLFHKDGDGRYRGFNRAYEEAFGIRREDFLGKT----VHEADFLNQAER 792

Query: 443  RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
               + +           A    +      T+  G          + H    +   +R   
Sbjct: 793  AEFEADA------RTIRAGGPPIHKEVDLTYADG---------EIHHTLFWMHGFQRPDG 837

Query: 503  ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
            +    + T   I +RQ+ E      + +  KE AE     KS FLA MSHE+RTP+NAI+
Sbjct: 838  SPGGSIGTLVDITDRQRAE-----RELRRAKELAEETTALKSNFLANMSHEIRTPMNAII 892

Query: 563  GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
            G S +  K         +  +Y   I  +GQHLL +IN+IL+ S+IE  K+ ++KQ   L
Sbjct: 893  GMSHLALKSGLTP----RQADYVAKIQQAGQHLLGVINDILDFSRIEAGKLVVEKQPFML 948

Query: 623  IPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNG 680
              ++     ++G  A  K +++   +  ++      D   + +IL    +N+IKFT   G
Sbjct: 949  DRVLEGMADVVGYKAGVKGLELVLDVAPDVPPHLVGDALRLGQILINFANNAIKFT-ERG 1007

Query: 681  KMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLA 735
            ++ +R   + +      +   + DTGIG+    + ++ Q F+       +  GG GLGLA
Sbjct: 1008 EIHVRVRVVERHGRRVLLRFEVRDTGIGVAPEQMGRLFQSFQQADASTTRRFGGSGLGLA 1067

Query: 736  ISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            IS  L  L GG +   S  G+G+   + +P
Sbjct: 1068 ISKNLAELMGGEVGAESVLGEGSTFWVMLP 1097



 Score =  102 bits (254), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/396 (11%), Positives = 110/396 (27%), Gaps = 47/396 (11%)

Query: 120 LAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKT-----VQM 174
           L      S   +++      +   +++     G  + E+        +  +T      QM
Sbjct: 352 LGAALQSSPVAVVITDAEGRIDWVNSQYEANTGYSLDEVRGRRPSLVASGQTPPETYRQM 411

Query: 175 SEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILF 234
               +   P+    +N   +        +  P+       +                 + 
Sbjct: 412 WSRLIAGLPWRGEFINQRQDGTIYHDEATLSPVFDDHGRRIA----------------IV 455

Query: 235 SYYRQAKKNKENDTILLEANICVETALSRGRCGLWN-----FNFDNKK-FHLSRSMYEIM 288
             +    +       L      +  AL++ +  +++         + +    + +  E++
Sbjct: 456 GLHENVTERITAHQELQRRERELNEALAQ-QTAIFDNAPPVLIVADGRLLRFNPACLELL 514

Query: 289 GIPYENKTLSFRAIA---RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQ 345
           G            +      +H    +  E          + + ++  +    G     +
Sbjct: 515 GAQPGQLEGRGVEVIFGGEELHRRFLERVEGRLEA----GESVREVARLVRRDGTVFEAR 570

Query: 346 VRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLV 405
           +  +++     G+  I +  D+TE    E    E ++RL  A E     +   D     +
Sbjct: 571 LSGRLLPLQGYGLACIWVVEDVTEARRSEAAMREMNERLILAQEAGRVGVFDLDLARDHL 630

Query: 406 MCNANYQKAYGLP--DHVLVPGNARSIIQDAQT---RPIIEYRTSDPERSQDMSKEIKLA 460
           + +      YGLP     L   +    +        +  ++   +        S  +   
Sbjct: 631 VFSEKLASLYGLPHQPQGLRLMDWMDSLHLEDRPRVQARLDAALAGAATGLQDSWRVVRP 690

Query: 461 DS--RWLQINEWCTHDG-----GTISVGTDITLLKH 489
           D   RWL  +     D        I V  D+   K 
Sbjct: 691 DGSERWLLCSARIERDAEGRARRLIGVQVDVHEQKQ 726



 Score = 81.6 bits (200), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 41/392 (10%), Positives = 101/392 (25%), Gaps = 30/392 (7%)

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
              G      + +    R  ++   +       +  ++   +       +        +L
Sbjct: 251 RQFGALFDNGVAQALPFRPDAREAVVGGVRYALERRNLEWHDPDGPWQIV--------ML 302

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC-VETALSRGRCG 267
              +  +     +   +    L ++                L       +  AL      
Sbjct: 303 DDLQALLPGPQRWQIGVGVFTLLVVLGGMLLDMMRHRARMALAMERFRVLGAALQSSPVA 362

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIAR--LIHYDNKKICEIARSVTGKHV 325
           +   + + +   ++       G   +       ++        +         S      
Sbjct: 363 VVITDAEGRIDWVNSQYEANTGYSLDEVRGRRPSLVASGQTPPE---TYRQMWSRLIA-G 418

Query: 326 KQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRL 384
                 F  +   G     +     +    G    I+G+  ++TE+    +     ++ L
Sbjct: 419 LPWRGEFINQRQDGTIYHDEATLSPVFDDHGRRIAIVGLHENVTERITAHQELQRREREL 478

Query: 385 SKAIECTSEAL-----VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPI 439
           ++A+   +        VL   + RL+  N    +  G     L       I    +    
Sbjct: 479 NEALAQQTAIFDNAPPVLIVADGRLLRFNPACLELLGAQPGQLEGRGVEVIFGGEELHRR 538

Query: 440 IEYRTSDPERSQDMSKEI---KLADSRWLQI--NEWCTHDGGT----ISVGTDITLLKHN 490
              R      + +  +E+      D    +   +       G     I V  D+T  + +
Sbjct: 539 FLERVEGRLEAGESVREVARLVRRDGTVFEARLSGRLLPLQGYGLACIWVVEDVTEARRS 598

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTEL 522
           +A +RE   RL             L+  +  L
Sbjct: 599 EAAMREMNERLILAQEAGRVGVFDLDLARDHL 630



 Score = 49.6 bits (117), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 55/160 (34%), Gaps = 13/160 (8%)

Query: 370 KYHLEKRYA-EADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR 428
           ++      A E  + L  A++ +  A+V+ D   R+   N+ Y+   G     +      
Sbjct: 337 RHRARMALAMERFRVLGAALQSSPVAVVITDAEGRIDWVNSQYEANTGYSLDEVRGRRP- 395

Query: 429 SIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
             +  +   P   YR         +    +  + R          DG        ++ + 
Sbjct: 396 -SLVASGQTPPETYRQMWSRLIAGLPWRGEFINQR---------QDGTIYHDEATLSPVF 445

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK 528
            +  +        +    +  T+ Q L+R++ EL+ A A+
Sbjct: 446 DDHGRRIAIVGLHENV-TERITAHQELQRRERELNEALAQ 484


>gi|326317893|ref|YP_004235565.1| multi-sensor hybrid histidine kinase [Acidovorax avenae subsp. avenae
            ATCC 19860]
 gi|323374729|gb|ADX46998.1| multi-sensor hybrid histidine kinase [Acidovorax avenae subsp. avenae
            ATCC 19860]
          Length = 1624

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 128/690 (18%), Positives = 249/690 (36%), Gaps = 57/690 (8%)

Query: 91   EAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFIL------LAQPNELVFASS 144
              I I+  + N+   + + ++ +    +         ++ I       L   ++ +   +
Sbjct: 452  RRIAIVGLHENVTERITAHQELQR--RERELNDALAQQTAIFDNAPPVLIVADDRLLRFN 509

Query: 145  TKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSR 204
                  +G + G++      +    + +                  +     +   +   
Sbjct: 510  PACLELLGVQPGQLEGRRVETIFGGEELHRR-----------FMARIEGRLEAGESVREV 558

Query: 205  VPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRG 264
              L+R         +    +                 + +  +  + E N  +  A   G
Sbjct: 559  ARLVRRDGTVFEARLSGRLLPLQGYAHACIWVVEDVTEARRAEAAMREMNERLILAQEAG 618

Query: 265  RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTG-K 323
            R G+++ +        S  +  + G+P+  + L        +H +++   +         
Sbjct: 619  RVGVFDLDLARDHLVFSEKLGSLYGLPHRPQGLRLVDWMDSLHMEDRPRVQARLDAALAG 678

Query: 324  HVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQ 382
                L   + +    G++ W+   A++ R   G    +IG+ +D+ E+  LE R A+   
Sbjct: 679  RATGLQDSWRVVRPDGSERWLLCSARIERDAEGRARRLIGVQVDVHEQKQLEARLADQLA 738

Query: 383  RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
                 ++     L   D + R    N  Y++A+G+     +           Q       
Sbjct: 739  FQQALVDAIPIPLFHKDGDGRYRGFNRAYEEAFGIRREDFLGKTVHEAGFLNQAERAEFE 798

Query: 443  RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
              +   R+                        G  I    D+T                +
Sbjct: 799  ADARTIRAG-----------------------GPPIHKEVDLTYADGEIHHTLFWMHGFQ 835

Query: 503  ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
                    S   L    T+   A  + +  KE AE     KS FLA MSHE+RTP+NAI+
Sbjct: 836  RPDGSPGGSIGTLV-DITDRQRAERELRRAKELAEETTALKSNFLANMSHEIRTPMNAII 894

Query: 563  GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
            G S +  K         +  +Y   I  +GQHLL +IN+IL+ S+IE  K+ ++KQ   L
Sbjct: 895  GMSHLALKSGLTP----RQADYVAKIQQAGQHLLGVINDILDFSRIEAGKLVVEKQPFML 950

Query: 623  IPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNG 680
              ++     ++G  A  K +++   +  ++      D   + +IL    +N+IKFT   G
Sbjct: 951  DRVLEGMADVVGYKAGVKGLELVLDVAPDVPPHLVGDALRLGQILINFANNAIKFT-ERG 1009

Query: 681  KMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLA 735
            ++ +R   + +      +   + DTGIG+    + ++ Q F+       +  GG GLGLA
Sbjct: 1010 EIHVRVRVVERHGRRVLLRFEVRDTGIGVAPEQMGRLFQSFQQADASTTRRFGGSGLGLA 1069

Query: 736  ISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            IS  L  L GG +   S  G+G+   + +P
Sbjct: 1070 ISKNLAELMGGEVGAESAVGEGSTFWVMLP 1099



 Score =  107 bits (268), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 47/388 (12%), Positives = 111/388 (28%), Gaps = 31/388 (7%)

Query: 120 LAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASL 179
           L      S   +++      +   +++     G  + E+        +  +T        
Sbjct: 354 LGAALQSSPVAVVITDAEGRIDWVNSQYEANTGYSLDEVRGRKPSLVASGQTPP------ 407

Query: 180 DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQ 239
            +    + S  +         IN       ++ +E TL  VF      + +      +  
Sbjct: 408 -ETYRQMWSRLIAGLPWRGEFINQ-RQDGTIYHDEATLSPVFDDRGRRIAIV---GLHEN 462

Query: 240 AKKNKENDTILLEANICVETALSRGRCGLWN-----FNFDNKK-FHLSRSMYEIMGIPYE 293
             +       L      +  AL++ +  +++         + +    + +  E++G+   
Sbjct: 463 VTERITAHQELQRRERELNDALAQ-QTAIFDNAPPVLIVADDRLLRFNPACLELLGVQPG 521

Query: 294 NKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRT 353
                          +  +          +  + + ++  +    G     ++  +++  
Sbjct: 522 QLEGRRVETI-FGGEELHRRFMARIEGRLEAGESVREVARLVRRDGTVFEARLSGRLLPL 580

Query: 354 ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQK 413
                  I +  D+TE    E    E ++RL  A E     +   D     ++ +     
Sbjct: 581 QGYAHACIWVVEDVTEARRAEAAMREMNERLILAQEAGRVGVFDLDLARDHLVFSEKLGS 640

Query: 414 AYGLP-DHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDM----SKEIKLADS--RWLQ 466
            YGLP     +           + RP ++ R       +      S  +   D   RWL 
Sbjct: 641 LYGLPHRPQGLRLVDWMDSLHMEDRPRVQARLDAALAGRATGLQDSWRVVRPDGSERWLL 700

Query: 467 INEWCTHDG-----GTISVGTDITLLKH 489
            +     D        I V  D+   K 
Sbjct: 701 CSARIERDAEGRARRLIGVQVDVHEQKQ 728



 Score = 83.9 bits (206), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 42/392 (10%), Positives = 101/392 (25%), Gaps = 30/392 (7%)

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
              G      + +    R  ++   +       +  ++   +       +        +L
Sbjct: 253 RQFGTLFDNGVAQALPFRPDAREAVVGGVRYAVERRNLEWHDPDGPWQLV--------ML 304

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC-VETALSRGRCG 267
                 +     +   +    L ++                L       +  AL      
Sbjct: 305 DDLHALLPAPQRWQIGVGVFALLVVLGGMLLDMMRHRARMALAMERFRVLGAALQSSPVA 364

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIAR--LIHYDNKKICEIARSVTGKHV 325
           +   + + +   ++       G   +       ++        +         S      
Sbjct: 365 VVITDAEGRIDWVNSQYEANTGYSLDEVRGRKPSLVASGQTPPE---TYRQMWSRLIA-G 420

Query: 326 KQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRL 384
                 F  +   G     +     +    G    I+G+  ++TE+    +     ++ L
Sbjct: 421 LPWRGEFINQRQDGTIYHDEATLSPVFDDRGRRIAIVGLHENVTERITAHQELQRREREL 480

Query: 385 SKAIECTSEAL-----VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPI 439
           + A+   +        VL   +DRL+  N    +  G+    L      +I    +    
Sbjct: 481 NDALAQQTAIFDNAPPVLIVADDRLLRFNPACLELLGVQPGQLEGRRVETIFGGEELHRR 540

Query: 440 IEYRTSDPERSQDMSKEI---KLADSRWLQI--NEWCTHDGGT----ISVGTDITLLKHN 490
              R      + +  +E+      D    +   +       G     I V  D+T  +  
Sbjct: 541 FMARIEGRLEAGESVREVARLVRRDGTVFEARLSGRLLPLQGYAHACIWVVEDVTEARRA 600

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTEL 522
           +A +RE   RL             L+  +  L
Sbjct: 601 EAAMREMNERLILAQEAGRVGVFDLDLARDHL 632



 Score = 47.3 bits (111), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 56/160 (35%), Gaps = 13/160 (8%)

Query: 370 KYHLEKRYA-EADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR 428
           ++      A E  + L  A++ +  A+V+ D   R+   N+ Y+   G     +      
Sbjct: 339 RHRARMALAMERFRVLGAALQSSPVAVVITDAEGRIDWVNSQYEANTGYSLDEVRGRKP- 397

Query: 429 SIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
             +  +   P   YR         +    +  + R          DG        ++ + 
Sbjct: 398 -SLVASGQTPPETYRQMWSRLIAGLPWRGEFINQR---------QDGTIYHDEATLSPVF 447

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK 528
            ++ +        +    +  T+ Q L+R++ EL+ A A+
Sbjct: 448 DDRGRRIAIVGLHENV-TERITAHQELQRRERELNDALAQ 486


>gi|144901258|emb|CAM78122.1| sensory transduction histidine kinase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 975

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 146/684 (21%), Positives = 261/684 (38%), Gaps = 66/684 (9%)

Query: 101 NIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVFASSTKNSHYIGKKIGE 157
            I  D+ ++++  + L   +   R         I+       + + +       G    E
Sbjct: 317 RILRDVTARRQVTASLHDSVTWLRGIMNTVVDGIITIDDTASILSFNAAAERIFGYGADE 376

Query: 158 IIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTL 217
            +   + S    +          ++        +      +        +       + L
Sbjct: 377 TVGR-NVSMLMPEPYHSEHDDYMRRYAETGEARVIGIGRQVKGKRKDGTVFP-----LEL 430

Query: 218 EVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKK 277
            V   +    +         R     K  +  L+E+               W  + D + 
Sbjct: 431 AVTRMNQGGLITY---IGLVRDITDRKRVEDALVESEQRFRDLAESASDWFWELDADLRF 487

Query: 278 FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
             +S  + +++G+          +       D +      +    +  +     F   H 
Sbjct: 488 TFVSGRVRQVLGVGPGYFIGRPFSDLATSCEDPRDW--DVQQSLIRGRRPFRG-FIFVHP 544

Query: 338 --SGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA 394
             SGA  ++++  +      G      G A D+T     E+  A         I+   + 
Sbjct: 545 MPSGAVKFVEMAGRPAFDADGKFDGYRGTAADITPLKRHEQELATQSAMRQTIIDNMGQG 604

Query: 395 LVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA------------RSIIQDAQTRPIIEY 442
           +V++D ++RLV  N++ ++   LP+  +  G +                        ++ 
Sbjct: 605 VVVFDGDERLVALNSHARQLLDLPETEIETGTSNLEALLLYLAVQGEFGHSGAIMVKVQR 664

Query: 443 RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
           R +   R      E    +   L+I       GG I   TDIT                 
Sbjct: 665 RLARLRRDPRRVFEHARPNGSVLEIRSTAMPGGGLILTFTDITDR--------------- 709

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
                                      +  ++ AE  N+ K+ FLA +SHELRTPLNAI+
Sbjct: 710 --------------------KKVEVTLREARDAAERGNRAKATFLANISHELRTPLNAII 749

Query: 563 GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
           GFSE++K EIFG L    Y  Y  D+H SG HLL +IN+IL+MSK E     + +   D+
Sbjct: 750 GFSELMKHEIFGPLQPPAYRSYVDDVHESGMHLLELINDILDMSKAEAGMTDLVESPVDV 809

Query: 623 IPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGK 681
             ++   +R++   A +  I +E  +P  L F  AD+R I++IL  +LSN++KFT++ G 
Sbjct: 810 AAVVRASLRMMDKRASANGISLEADLPDGLAFLRADERRIRQILLNLLSNAVKFTDDGGM 869

Query: 682 MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
           + +     G+ ++I + DTGIG+    ++K+ +PF     +  +   G GLGL ++ AL 
Sbjct: 870 VRVTAQVDGRGMVIEVIDTGIGMTPEDMDKVMEPFVQADTRLSRKYEGTGLGLPLTKALV 929

Query: 742 NLHGGRLKIISQEGKGTIVTICMP 765
           N HGG +++ S    GT VT+  P
Sbjct: 930 NAHGGTMELHSIPDHGTTVTVTFP 953



 Score = 81.2 bits (199), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 33/327 (10%), Positives = 90/327 (27%), Gaps = 25/327 (7%)

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI-----CVETALSRGRCG 267
            +  + V  F +   L + +  +   +    ++                +  ALS  + G
Sbjct: 164 SDHAIAVWGFFVAQLLSVLMALALLLEVLMRQQAVAESEGQRANLLQSRLVDALSSVQDG 223

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ 327
           +  F+   +    +  +Y     P        R    ++  + +           +  K 
Sbjct: 224 VALFDPRERLVTAND-LYRQFMAPVAEIIKPGRLFQDIVDAEFEMGVVRQECEVVRSGKL 282

Query: 328 LDQIFHMRHA------SGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEAD 381
            D               G   W+ +              + I  D+T +  +     ++ 
Sbjct: 283 ADHAVPAVQGCEAELFDG--RWVSINVYPTADGG----YLRILRDVTARRQVTASLHDSV 336

Query: 382 QRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIE 441
             L   +    + ++  D    ++  NA  ++ +G      V G   S++         +
Sbjct: 337 TWLRGIMNTVVDGIITIDDTASILSFNAAAERIFGYGADETV-GRNVSMLMPEPYHSEHD 395

Query: 442 YRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRL 501
                   + +      +   R ++       DG    +   +T +            R 
Sbjct: 396 DYMRRYAETGEA---RVIGIGRQVKG---KRKDGTVFPLELAVTRMNQGGLITYIGLVRD 449

Query: 502 KATINDLSTSRQILERQKTELSIANAK 528
                 +  +    E++  +L+ + + 
Sbjct: 450 ITDRKRVEDALVESEQRFRDLAESASD 476


>gi|222110175|ref|YP_002552439.1| multi-sensor hybrid histidine kinase [Acidovorax ebreus TPSY]
 gi|221729619|gb|ACM32439.1| multi-sensor hybrid histidine kinase [Acidovorax ebreus TPSY]
          Length = 1611

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 139/715 (19%), Positives = 270/715 (37%), Gaps = 61/715 (8%)

Query: 70   KVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIK--FDLASQKKAESMLGQLLAKTRFLS 127
             +    A    + +     +     +      I+   +L  +++  S L +        +
Sbjct: 433  TLYHEEATLSPVFDAKGRRIAIVGLLQDVTARIEAAQELERRERHLSELLEQQTALFDNA 492

Query: 128  ESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVL 187
               +L+      +   +   +  + +   E +                  +    P  + 
Sbjct: 493  PPIVLVCD--GQIRQFNRALAELL-RSSDEALAGTPVQELFGGEAGYGAFTARTVPMLLA 549

Query: 188  SVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKEND 247
              ++       ++                L++    I S  ++           + +  +
Sbjct: 550  GGSVRE---QAVLRRPDGTSFTARMAGRGLKMEGVQIASLWVI-------EDVTEAQRAE 599

Query: 248  TILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGI-------PYENKTLSFR 300
                EAN  +E A   G  G++++N   ++   S  + ++ G                F+
Sbjct: 600  AATREANARLELAQEAGHIGVFDYNLLTQRMVWSPQLEQLYGAASLPAQKDGHAAERPFQ 659

Query: 301  AIARLIHYDNKKICEIARSVTGKHVK--QLDQIFHMRHASGADIWIQVRAQMMRTISGGM 358
            A   +IH +++   +   +         +L   + +  A G+  WI   A+++R  +G  
Sbjct: 660  AWVDVIHPEDRARVQGLLAQAQAGQGGGRLRDSWRIVRADGSTRWILCTARVVRDEAGQA 719

Query: 359  -NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL 417
              IIG+ +D+ ++  LE R AE        I+     L   D   R +  N  Y +A+ +
Sbjct: 720  ARIIGVQVDVHDQKMLEARVAEQLAFQQALIDAIPVPLFYKDAQGRYLGFNRAYVQAFDI 779

Query: 418  PDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGT 477
                 +       + D +  P++E      +    +            +       DG  
Sbjct: 780  HTEDFIGKT----VLDLEFLPMLERERLHADTEAAL-----RGAQSVHREVAMPYADG-- 828

Query: 478  ISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAE 537
                    L+ H    L    R   +    + T   + +RQ+ E+       +  KE AE
Sbjct: 829  --------LVHHTMFWLHGFNRPDGSAGGVIGTFVDVSDRQRAEVE-----LRRAKELAE 875

Query: 538  TANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLN 597
                 KS FLA MSHE+RTPLNAI+G S +  K         +   Y   +  +GQHLL 
Sbjct: 876  ETAALKSRFLANMSHEIRTPLNAIIGMSHLALKSGLD----ARQSGYVVRMQQAGQHLLG 931

Query: 598  MINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FN 655
            +IN+IL+ SKIE  K+ +++    L  ++     ++G  A +K +++   +  ++     
Sbjct: 932  VINDILDFSKIEAGKLVVERSPFALDRMLEGVADVVGFKAAAKGLELVLDVAPDVPQHLV 991

Query: 656  ADKRIIKKILFPILSNSIKFTNNNGKMM--IRTSKIGQ---CVIITIADTGIGIPKSALE 710
             D   + +IL    +N++KFT   G++   +R  +       +   + DTGIGI    ++
Sbjct: 992  GDALRLGQILINFANNAVKFT-EQGEIHLLVRLERNEGARVWLRFEVRDTGIGIAPQQMQ 1050

Query: 711  KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            ++ Q FE       +  GG GLGLAIS +L  L GG + + S+ G G+   + +P
Sbjct: 1051 RLFQSFEQADTSTTRRYGGTGLGLAISKSLAELMGGEVGVRSELGHGSAFWVTVP 1105



 Score = 95.4 bits (236), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/412 (12%), Positives = 111/412 (26%), Gaps = 41/412 (9%)

Query: 106 LASQKKAESMLGQL--LAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELS 163
           L ++++    + +   L      S   I++     ++   + +     G  +GE+     
Sbjct: 336 LRNRRRLAESMQRFSVLGAALENSPISIVITDAEGVIAWVNPQYERNTGYTLGEVRGRKP 395

Query: 164 RSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFS 223
                  ++  SE +       + S  L  +S     +N R         E       F 
Sbjct: 396 -------SIAASEHTPAGTYRDMWSRLLAGHSWRGRFVNRRRD--GTLYHEEATLSPVFD 446

Query: 224 IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFD------NKK 277
                +   +    +      E    L      +   L + +  L++           + 
Sbjct: 447 AKGRRIA--IVGLLQDVTARIEAAQELERRERHLSELLEQ-QTALFDNAPPIVLVCDGQI 503

Query: 278 FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
              +R++ E++    E    +                     +        +Q   +R  
Sbjct: 504 RQFNRALAELLRSSDEALAGTPVQELFGGEAGYGAFTARTVPMLLAGGSVREQAV-LRRP 562

Query: 338 SGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL 397
            G     ++  + ++     +  + +  D+TE    E    EA+ RL  A E     +  
Sbjct: 563 DGTSFTARMAGRGLKMEGVQIASLWVIEDVTEAQRAEAATREANARLELAQEAGHIGVFD 622

Query: 398 WDKNDRLVMCNANYQKAYGL---------PDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
           ++   + ++ +   ++ YG                      +I       +         
Sbjct: 623 YNLLTQRMVWSPQLEQLYGAASLPAQKDGHAAERPFQAWVDVIHPEDRARVQGLLAQAQA 682

Query: 449 RSQDM----SKEIKLADS--RWLQINEWCTHD-----GGTISVGTDITLLKH 489
                    S  I  AD   RW+        D        I V  D+   K 
Sbjct: 683 GQGGGRLRDSWRIVRADGSTRWILCTARVVRDEAGQAARIIGVQVDVHDQKM 734



 Score = 87.7 bits (216), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 40/400 (10%), Positives = 101/400 (25%), Gaps = 33/400 (8%)

Query: 136 PNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNS 195
             E + A   +++   G +    +         S+   +           V   +     
Sbjct: 240 TQERIDAV--RSTRQFGSRFDNGLVSALPFSIDSREALIDGVRYAVGRRAVDWEDPAGP- 296

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI 255
             +++++    ++                 +  L  ++ +    A +N+     L E+  
Sbjct: 297 WQLVLLDDMSAIMP------MGLRWMVGGGAFALFALVGAMALDALRNRR---RLAESMQ 347

Query: 256 CVE---TALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKK 312
                  AL      +   + +     ++       G           +IA   H     
Sbjct: 348 RFSVLGAALENSPISIVITDAEGVIAWVNPQYERNTGYTLGEVRGRKPSIAASEHT-PAG 406

Query: 313 ICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKY 371
                 S            F  R   G     +     +    G    I+G+  D+T + 
Sbjct: 407 TYRDMWSRLLA-GHSWRGRFVNRRRDGTLYHEEATLSPVFDAKGRRIAIVGLLQDVTARI 465

Query: 372 HLEKRYAEADQRLSKAIECTSEAL-----VLWDKNDRLVMCNANYQKAYGLPDHVLVPGN 426
              +     ++ LS+ +E  +        ++   + ++   N    +         + G 
Sbjct: 466 EAAQELERRERHLSELLEQQTALFDNAPPIVLVCDGQIRQFNRALAELL-RSSDEALAGT 524

Query: 427 ARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITL 486
               +   +         +        +  + LA     +       DG + +       
Sbjct: 525 PVQELFGGE---------AGYGAFTARTVPMLLAGGSVREQAVLRRPDGTSFTARMAGRG 575

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIAN 526
           LK    Q+         T    + +       + EL+   
Sbjct: 576 LKMEGVQIASLWVIEDVTEAQRAEAATREANARLELAQEA 615



 Score = 53.1 bits (126), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/165 (16%), Positives = 54/165 (32%), Gaps = 15/165 (9%)

Query: 375 KRYAEADQRLS---KAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSII 431
           +R AE+ QR S    A+E +  ++V+ D    +   N  Y++  G     +         
Sbjct: 340 RRLAESMQRFSVLGAALENSPISIVITDAEGVIAWVNPQYERNTGYTLGEVRG------- 392

Query: 432 QDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQ 491
                +P I      P  +        LA   W         DG        ++ +   +
Sbjct: 393 ----RKPSIAASEHTPAGTYRDMWSRLLAGHSWRGRFVNRRRDGTLYHEEATLSPVFDAK 448

Query: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERA 536
            +       L+     +  ++  LER++  LS    +     + A
Sbjct: 449 GRRIAIVGLLQDVTARIEAAQ-ELERRERHLSELLEQQTALFDNA 492


>gi|297568619|ref|YP_003689963.1| multi-sensor hybrid histidine kinase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924534|gb|ADH85344.1| multi-sensor hybrid histidine kinase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 1263

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 144/696 (20%), Positives = 262/696 (37%), Gaps = 88/696 (12%)

Query: 105 DLASQKKAESMLGQLLAKTRFL---SESFILLAQPN-ELVFASSTKNSHYIGKKIGEI-- 158
           D   + +A   L +  ++ R L        +L  P   L    +      +G    E   
Sbjct: 125 DRTEEHRAREQLKERESRFRTLFELYPDATVLIDPESGLPVQFNRLAHEQLGYTAEEFAR 184

Query: 159 --IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
             IP+     + ++T    +A  ++      + +   +   I +                
Sbjct: 185 LRIPDYEALETPAETGAHIQAIFERGHDDFETRHRRKDGSLIDV---------------R 229

Query: 217 LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
           + VV  ++       +  + +R   + K     L  +   +  A      G+W+++  + 
Sbjct: 230 VSVVLLNLEGQ---TLFLAVFRDITEEKAASRELERSRERLALATESAELGIWDYDMASG 286

Query: 277 KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM-- 334
                  M+ + GI   +   SF   A  +  ++++    A        +  D    M  
Sbjct: 287 HLEWDDGMFRLYGIAPADFGHSFEDWAAALTPESREAAVAAFQAAVSSDRPFDI--RMVI 344

Query: 335 -RHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEAD-QRLSKAIECT 391
            R A GA   +  +AQ++R  SG  + ++G+  D+TE+    +  A    Q LS      
Sbjct: 345 LRAADGAIRTLHGQAQIIRDGSGTPVRVVGVNRDVTEEEENRRHLAAFFAQSLSGFFFMM 404

Query: 392 SEALVLW---DKND------------RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            +  V W   D+ +            R+ M N      YG  +  L+   AR +      
Sbjct: 405 LDEPVDWQGADEEEKEALLDYVMDHQRITMVNQAMLDQYGATERDLIGMTAREMFAHDLE 464

Query: 437 RPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRE 496
                              +      RW         DG  I +  D   L   Q ++  
Sbjct: 465 H-------------GRFIWKGLFDQGRWHVETREQRLDGTPIIIDGDYICLYDEQGRVTG 511

Query: 497 SKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
                             ++   TE        +  +  AE A++ KSEFLA MSHE+RT
Sbjct: 512 HFG---------------VQHDVTERKQQQEALEQARREAERASRAKSEFLANMSHEIRT 556

Query: 557 PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
           P+NA++G S+++ +       + +  +  + IH S + LL +IN+IL+ SKIE+ ++ ++
Sbjct: 557 PMNAVIGLSQLLAQTEL----NEEQRDQVRKIHQSSRMLLGIINDILDFSKIESGRLELE 612

Query: 617 KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIK 674
            ++  L  ++ +   L G    +  +++   IP  L      D   + +IL  +LSN+ K
Sbjct: 613 CRDFRLNEVVEQVATLFGDKVHAGGLELLYDIPPHLPRTLVGDSLRLSQILVNLLSNATK 672

Query: 675 FTNNNGKMMIRTSK------IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
           FT   G + +              +   + DTGIG+ K  L ++ +PF        +  G
Sbjct: 673 FTERGGTVELGIRVVAPVANDQATLRFHVRDTGIGMSKEQLARLFRPFSQADTSTTRRYG 732

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
           G GLGL IS  L    GG L++ S  GKG+  +  +
Sbjct: 733 GTGLGLVISRRLVEKMGGELEVESAPGKGSTFSFTL 768



 Score =  116 bits (290), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/284 (16%), Positives = 81/284 (28%), Gaps = 31/284 (10%)

Query: 261 LSRGRCGLWNFNFDNKK--FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIAR 318
              G   L+ +  +      ++S ++ +I+G             + L+H D+        
Sbjct: 16  FPGGPVVLFVWRPEPGWPVHYVSPNVEQILGYSPSEILAPGFRFSDLVHPDDMGAINDEV 75

Query: 319 SVTGKHVKQ-LDQIFHMRHASGADIWIQVRAQMMRTISGGMNII-GIAMDLTEKYHLEKR 376
           +      +   +Q + +R  SG   W            G   +I G  +D TE++   ++
Sbjct: 76  ATFLARGETTYEQHYRLRTRSGDYRWFHDYTVPEYDDQGKPRLISGYILDRTEEHRAREQ 135

Query: 377 YAEADQRLSKAIECTSEALVLWDKN-DRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQ 435
             E + R     E   +A VL D      V  N    +  G               +  +
Sbjct: 136 LKERESRFRTLFELYPDATVLIDPESGLPVQFNRLAHEQLGYTAEEFARLR-IPDYEALE 194

Query: 436 TRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLR 495
           T                   E +               DG  I V   + LL      L 
Sbjct: 195 TPAETGAHIQAIFERGHDDFETRH-----------RRKDGSLIDVRVSVVLLNLEGQTLF 243

Query: 496 ESKRRLKATINDLSTSRQILERQK--TELSIANAKYQVEKERAE 537
            +              R I E +    EL  +  +  +  E AE
Sbjct: 244 LAVF------------RDITEEKAASRELERSRERLALATESAE 275



 Score =  109 bits (272), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 55/447 (12%), Positives = 118/447 (26%), Gaps = 29/447 (6%)

Query: 142 ASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILII 201
             S      +G    EI+    R         +            ++  L     +    
Sbjct: 36  YVSPNVEQILGYSPSEILAPGFRF------SDLVHPDDMGAINDEVATFLARGETTYEQH 89

Query: 202 NSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETAL 261
                    +R      V  +       L   +   R   +       L E      T  
Sbjct: 90  YRLRTRSGDYRWFHDYTVPEYDDQGKPRLISGYILDR--TEEHRAREQLKERESRFRTLF 147

Query: 262 SRGRCGLWNFNFDNKK-FHLSRSMYEIMGIPYENKT-LSFRAIARLIHYDNKKICEIARS 319
                     + ++      +R  +E +G   E    L       L              
Sbjct: 148 ELYPDATVLIDPESGLPVQFNRLAHEQLGYTAEEFARLRIPDYEALETP---AETGAHIQ 204

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAE 379
              +     D     R   G+ I ++V   ++  + G    + +  D+TE+    +    
Sbjct: 205 AIFERGHD-DFETRHRRKDGSLIDVRVSV-VLLNLEGQTLFLAVFRDITEEKAASRELER 262

Query: 380 ADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG--NARSIIQDAQTR 437
           + +RL+ A E     +  +D     +  +    + YG+          +  + +      
Sbjct: 263 SRERLALATESAELGIWDYDMASGHLEWDDGMFRLYGIAPADFGHSFEDWAAALTPESRE 322

Query: 438 PIIEYRTSDPERSQDMSKE---IKLADS--RWLQINEWCTHDGG-----TISVGTDITLL 487
             +    +     +        ++ AD   R L        DG       + V  D+T  
Sbjct: 323 AAVAAFQAAVSSDRPFDIRMVILRAADGAIRTLHGQAQIIRDGSGTPVRVVGVNRDVTEE 382

Query: 488 KHNQAQLRESKRRLKATINDLSTSR-QILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           + N+  L     +  +    +        +    E   A   Y ++ +R    N+   + 
Sbjct: 383 EENRRHLAAFFAQSLSGFFFMMLDEPVDWQGADEEEKEALLDYVMDHQRITMVNQAMLDQ 442

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIF 573
                 +L   + A   F+  ++   F
Sbjct: 443 YGATERDLI-GMTAREMFAHDLEHGRF 468


>gi|119509677|ref|ZP_01628823.1| two-component hybrid sensor and regulator [Nodularia spumigena
           CCY9414]
 gi|119465696|gb|EAW46587.1| two-component hybrid sensor and regulator [Nodularia spumigena
           CCY9414]
          Length = 896

 Score =  417 bits (1071), Expect = e-114,   Method: Composition-based stats.
 Identities = 121/670 (18%), Positives = 258/670 (38%), Gaps = 37/670 (5%)

Query: 104 FDLASQKKAESMLGQ---LLAKTRFLSESFILLAQP-NELVFASSTKNSHYIGKKIGEII 159
            D+  +K+AE+ L +    + +    +   + +     +    ++++  + +G    +I 
Sbjct: 255 RDVTEKKQAEAKLRESQQFIERIADTTPGILYVYDLMKQQNVYTNSQVINLLGYTCQQIK 314

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
             +      +       A   +   H+  +N+  N   +            W    + + 
Sbjct: 315 G-MDSEFLSTLMHPEDRARFLE---HLQLINVAENGEILEFEYRMRHANGEWLWFYSRD- 369

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
             F+         +        + K+ +  L  +N   + A +   C +++ +  N    
Sbjct: 370 TVFNRNVDGSPRQIVGTAFDITERKQAEEQLRLSNERFQLAAAAVNCLIYDRDIKNNIVS 429

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASG 339
            +  +  I+G   E    S       +H ++++      +            + MRH   
Sbjct: 430 RTEGLTRILGYSLEEADPSAEWWIEKVHPEHRERLLNQLTDFFNRENYYTIEYKMRHKDQ 489

Query: 340 ADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
              ++  +  +++   G  +  +G   D++E+   E    E+++R     +   + +   
Sbjct: 490 EYRYVLDQGIIVQDPHGQVVRTVGSVTDISERKQAETALRESEERYRYLSDLIPQLVWTC 549

Query: 399 DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK 458
           +        N  + +  G             +I       +I   T   +R +   +E++
Sbjct: 550 NSQGECEYVNQRWYELTGQMLEEAKGFGWTKVIHPDDLSSVIPEWTQALQRKKPYEQEMR 609

Query: 459 LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
                      +  HDG          L+++   +  + +             R+ LE  
Sbjct: 610 -----------YQKHDGSYCW-----HLVRNVAIKDEQGRVVKWFGTATDIDHRKQLE-- 651

Query: 519 KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
             E      + Q  +  AE AN+TK EF+A +SH+LR+PLNAILG++++++         
Sbjct: 652 -AERDRLLQREQAARSAAEKANQTKDEFVAMVSHDLRSPLNAILGWAKLLRTRQLPP--- 707

Query: 579 VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
                    I  + Q    ++ ++L MS+I   ++ ++    +L+ I+   +     SA 
Sbjct: 708 DTVTNALATIERNAQSQEKLLEDLLNMSRILRGQLQLEVCPVNLVNIVKASVETAYPSAH 767

Query: 639 SKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ-CVIIT 696
           +K I +   I   +     D   + ++L  +LSN+IKFT + G++ ++ +K     ++I 
Sbjct: 768 AKGIHLASVIDESIPPIVGDTHRLLQVLGNLLSNAIKFTPSGGRVQVQLAKSDDSEILIQ 827

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ-EG 755
           ++DTG+GI    L  +   +   H        G GLGLAI+  L  LHGG ++  SQ EG
Sbjct: 828 VSDTGLGIKPEFLPHVFDRYRQAH--CTAKHSGLGLGLAIARHLVELHGGTIQAHSQGEG 885

Query: 756 KGTIVTICMP 765
            G   +I +P
Sbjct: 886 LGATFSIKLP 895



 Score =  140 bits (352), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 55/443 (12%), Positives = 133/443 (30%), Gaps = 33/443 (7%)

Query: 49  NQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLAS 108
            Q IP + M+        ++  + +           T   L   I    +N  +  +L  
Sbjct: 78  QQAIPAVIMLTGYGNEAVAVQAMKSGVQDYLVKGQTTGEYLRSTIHSAIKNAQLSQEL-- 135

Query: 109 QKKAESMLGQLLAKTRFLSESFILLAQPNELVF-----ASSTKNSHYIGKKIGEIIPELS 163
            +++E      +         F  +      +        +     +     GE      
Sbjct: 136 -QRSEERFRTSVENMLDCFGIFSAVRYETGEILNFRVDYMNAAACEFSQMSSGE------ 188

Query: 164 RSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFS 223
               + + +     ++ +         +      ++        L   ++          
Sbjct: 189 ----QGEYLGEILLNIRENGLFDECCQVVKTGQPLVKEALVYTSLNSQQQSTR----VID 240

Query: 224 IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF-DNKKFHLSR 282
           I    +     + +R   + K+ +  L E+   +E         L+ ++    +  + + 
Sbjct: 241 IRITKMGDGFVAAWRDVTEKKQAEAKLRESQQFIERIADTTPGILYVYDLMKQQNVYTNS 300

Query: 283 SMYEIMGIPYENKTLSFRAIAR-LIHYDNKKICEIARSVT--GKHVKQLDQIFHMRHASG 339
            +  ++G   +            L+H +++        +    ++ + L+  + MRHA+G
Sbjct: 301 QVINLLGYTCQQIKGMDSEFLSTLMHPEDRARFLEHLQLINVAENGEILEFEYRMRHANG 360

Query: 340 ADIWIQVRAQMM-RTISGGMN-IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL 397
             +W   R  +  R + G    I+G A D+TE+   E++   +++R   A    +  +  
Sbjct: 361 EWLWFYSRDTVFNRNVDGSPRQIVGTAFDITERKQAEEQLRLSNERFQLAAAAVNCLIYD 420

Query: 398 WDKNDRLVMCNANYQKAYGLPDHVLVPG--NARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
            D  + +V       +  G       P        +       ++   T    R    + 
Sbjct: 421 RDIKNNIVSRTEGLTRILGYSLEEADPSAEWWIEKVHPEHRERLLNQLTDFFNRENYYTI 480

Query: 456 EIKLADSRWLQINEWCTHDGGTI 478
           E K+   R          D G I
Sbjct: 481 EYKM---RHKDQEYRYVLDQGII 500



 Score = 62.3 bits (150), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 53/403 (13%), Positives = 121/403 (30%), Gaps = 37/403 (9%)

Query: 185 HVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNK 244
                     +   +I+ +      +  + +   V  + +        L S    A KN 
Sbjct: 70  MAELKQQSQQAIPAVIMLTGYGNEAVAVQAMKSGVQDYLVKGQTTGEYLRSTIHSAIKNA 129

Query: 245 ENDTILLEANICVETALSRGRC--GLWN-FNFDNKKF------HLSRSMYEIMGIPYENK 295
           +    L  +     T++       G+++   ++  +       +++ +  E   +    +
Sbjct: 130 QLSQELQRSEERFRTSVENMLDCFGIFSAVRYETGEILNFRVDYMNAAACEFSQMSSGEQ 189

Query: 296 TLSFRAIARLIHY----DNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM 351
                 I   I      D             K          +     +   I +R   M
Sbjct: 190 GEYLGEILLNIRENGLFDECCQVVKTGQPLVKEALVYTS---LNSQQQSTRVIDIRITKM 246

Query: 352 RTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDK-NDRLVMCNAN 410
                    +    D+TEK   E +  E+ Q + +  + T   L ++D    + V  N+ 
Sbjct: 247 GDG-----FVAAWRDVTEKKQAEAKLRESQQFIERIADTTPGILYVYDLMKQQNVYTNSQ 301

Query: 411 YQKAYGLPDHVLVPGNAR---SIIQDAQTRPIIEYR----TSDPERSQDMSKEIKLADSR 463
                G     +   ++    +++        +E+      ++     +    ++ A+  
Sbjct: 302 VINLLGYTCQQIKGMDSEFLSTLMHPEDRARFLEHLQLINVAENGEILEFEYRMRHANGE 361

Query: 464 WLQINEW-----CTHDGG---TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
           WL             DG     +    DIT  K  + QLR S  R +     ++      
Sbjct: 362 WLWFYSRDTVFNRNVDGSPRQIVGTAFDITERKQAEEQLRLSNERFQLAAAAVNCLIYDR 421

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
           + +   +S      ++     E A+ +   ++ K+  E R  L
Sbjct: 422 DIKNNIVSRTEGLTRILGYSLEEADPSAEWWIEKVHPEHRERL 464


>gi|170076780|ref|YP_001733418.1| two-component hybrid sensor kinase/response regulator
           [Synechococcus sp. PCC 7002]
 gi|169884449|gb|ACA98162.1| two-component hybrid sensor and regulator; PAS domain S-box protein
           [Synechococcus sp. PCC 7002]
          Length = 1076

 Score =  417 bits (1071), Expect = e-114,   Method: Composition-based stats.
 Identities = 123/640 (19%), Positives = 238/640 (37%), Gaps = 45/640 (7%)

Query: 135 QPNELVFASSTKNSHYIGKKIGEII--PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLP 192
                +   S       G    E+   PE  +     + +Q    +L Q       +   
Sbjct: 171 DCINNIEYLSPSFKRMFGYADHELPNRPESWQKLIFPEDLQKVNHNLQQHIASHGEIPFC 230

Query: 193 HNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLE 252
           +      +         +W   V          +      +   +      K  +  L  
Sbjct: 231 NE-----VRYRHRDGSTVW---VLCSGKVIEWDAQGQPLRIIGSHIDLTPYKRFEERLKR 282

Query: 253 ANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKK 312
           +   ++ A      G W  +    +   S  +  + G+       ++     LIH D+++
Sbjct: 283 SEASLQEAQRLAHIGSWEVDLATGRLSWSPELLRMFGLNMAQGPPTYDEHWALIHPDDQE 342

Query: 313 ICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKY 371
             +       +  +     +  +  +G   + + R    +  SG  +   G A+D+TE+ 
Sbjct: 343 RLKRCVETAMRTGESYMVQYRAQLTNGQIFYHEARGSSQKDASGKTIRFFGTALDITERV 402

Query: 372 HLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVL--VPGNARS 429
             E+   E++ R   A+E + + +  W+     V  +  ++   G  +  +        S
Sbjct: 403 LAEQALRESELRWQFALEGSGDGVWDWNAQTNRVFFSRQWKAMLGYSEAEIGDTLMEWES 462

Query: 430 IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
            +         +   +  +       EI  ++ R          DG    +         
Sbjct: 463 RVHPDDLAMTYQAIQAHLDGQT----EIYRSEHRV------RCKDGSYKWIL-------- 504

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
                 +  + ++ T +              +   A       KE AE A   KS FLA 
Sbjct: 505 ------DRGKVIEWTPSGEPLRIIGTHSDIGDRKQAELALIDAKEAAEAAAHAKSMFLAT 558

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           MSHE+RTP+N I+G   ++    + E  + +  E+A     S + LL ++N+IL+ SK+E
Sbjct: 559 MSHEIRTPMNGIIGMLNLLL---YSEGLTTEQQEHAHIALSSAESLLMLLNDILDFSKME 615

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI--PSELFFNADKRIIKKILFP 667
             K+ ++  + DL        +L+  +AQ K + +   +          D   +++IL  
Sbjct: 616 AGKLQLETVDFDLHQFFENFAKLMAFAAQEKGLNLIFDLRGLRHGSIQGDPGRLRQILTN 675

Query: 668 ILSNSIKFTNNNGK-MMIRTSKIGQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYD 724
           ++SN+IKFTN     +  +T ++G  +    ++ DTGIGI    L  + +PF  L     
Sbjct: 676 LVSNAIKFTNQGEVMIRCQTERVGDRLDFTCSVTDTGIGIAAEKLNDLFEPFTQLEAGTT 735

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
           +  GG GLGLAI+  L  + GG +++IS  G+G+  T  +
Sbjct: 736 RRYGGTGLGLAITQRLCQVMGGTIEVISTPGEGSCFTFTL 775


>gi|313672986|ref|YP_004051097.1| multi-sensor hybrid histidine kinase [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939742|gb|ADR18934.1| multi-sensor hybrid histidine kinase [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 1095

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 141/664 (21%), Positives = 237/664 (35%), Gaps = 47/664 (7%)

Query: 109 QKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSR 168
             K    + ++ A                  V  S       +G    E   E+S  +  
Sbjct: 2   IDKINISIDEIWAALESGDIGIWFWDNSTGKVLWSDHAY-KMLGYYPNEF--EMSYEKWV 58

Query: 169 SKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISAL 228
                            V       NS S+            W       + +    S  
Sbjct: 59  ELLHPEDVEYAQ---LSVAKQLEFKNSFSVDFRLRAKDGSYKWIRGSGKVIRYADDGS-- 113

Query: 229 LLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIM 288
            +  L   +    + K  + +L E    +E A    + G W+ +  N K   S  +Y I 
Sbjct: 114 -MLYLTGTHTDITEKKNAEILLQEKLYILEEAEKIAKLGSWDLDIKNNKLFWSNEIYNIF 172

Query: 289 GIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRA 348
            I  +    S+ A   L+H D++K  +     + +  K       +    G   ++  R 
Sbjct: 173 EIDKDEFGASYDAFISLVHPDDRKKIDDVYWESVRSKKSYQVEHRLLMPDGRIKYVIERG 232

Query: 349 QMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMC 407
           +      G  +  IG   D+TEK  LE+   E +       E     ++  D    +++ 
Sbjct: 233 KTFYDKDGDPIRSIGTVQDITEKVLLERSVKEQEIVFKSIFERAPVGIIFTDILGNIILV 292

Query: 408 NANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQI 467
           N    +            N   I      +    +         D  +  K         
Sbjct: 293 NNYLAELLDYEHEDFKNKNISEITFAEDYKKEQIFIQGLLNNEIDYYRIEKR-------- 344

Query: 468 NEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANA 527
             +   DG    V +  T LK     ++     +    +                 +A  
Sbjct: 345 --YIKRDGSLNWVDSSRTSLKDEDGNIKNFISVVLNINDK---------------KVAEQ 387

Query: 528 KYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD 587
           +    KE AE AN+ KS FLA MSHE+RTPLN I+G ++++K E           EY + 
Sbjct: 388 ELIKAKENAERANQAKSTFLANMSHEIRTPLNGIIGIAQLLKNENL----PKHVVEYVKH 443

Query: 588 IHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK 647
           ++ +  HLL++IN+I + S+IE+ ++ I      L   INE ++++   A+ KNI++   
Sbjct: 444 LNMASHHLLDLINDIFDFSRIESGEMKIINDIFSLKDTINEVVKVLYYRAKEKNIELTVF 503

Query: 648 IPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADT 700
           +   +      D   +K+IL  +L N+IKFT   G + +             ++  I DT
Sbjct: 504 VDPLIPSKIIGDSLRVKQILTNLLGNAIKFT-EVGYVSLDVFIKNSTEKSVDILFVIKDT 562

Query: 701 GIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIV 760
           GIGI     +K+  PF        +  GG GLGL I   L +   G +  IS+ GKGT  
Sbjct: 563 GIGISGDKKQKLFTPFFQGDQSVTKKYGGTGLGLTIVKRLIDAMNGDINFISEPGKGTTF 622

Query: 761 TICM 764
            + +
Sbjct: 623 YVTL 626


>gi|189425062|ref|YP_001952239.1| multi-sensor signal transduction histidine kinase [Geobacter lovleyi
            SZ]
 gi|189421321|gb|ACD95719.1| multi-sensor signal transduction histidine kinase [Geobacter lovleyi
            SZ]
          Length = 1109

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 137/691 (19%), Positives = 248/691 (35%), Gaps = 73/691 (10%)

Query: 102  IKFDLASQKKAESMLGQLLA-----KTRFLSESFILLAQPNELVFASSTKNSHYIGKKIG 156
            +  D+  +K+AE  L ++ A     K        I      +L   S+        K+  
Sbjct: 447  VISDITHRKQAEDTLREMEATAQAAKRHLEEAQRIAHLGSWQLNIVSNQ---LVWSKECY 503

Query: 157  EIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
             I      +    ++        D+        +    +   +     V     W  E  
Sbjct: 504  AIFGIQQDTSLTFESFVNCIHPDDRDLVSTAWSSALTGAPYDITHRICVGDKVKWVVEQA 563

Query: 217  LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
              V   +  +           +   + KE D  L EA    +  +   + G W+++    
Sbjct: 564  DIVFDNNGNALH----GVGTVQDITERKETDNALREAKERFQFVIEGSQLGFWDWDIATG 619

Query: 277  KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKK-ICEIARSVTGKHVKQLDQIFHMR 335
                +    E++G   ++   S R     IH D++    +  +       +     + M 
Sbjct: 620  SVIRNERWAEMLGYTVQDIENSVRQWIDYIHPDDRDPAMQSLQDHLDGKTEMHKAEYRML 679

Query: 336  HASGADIWIQVRAQMMRTISGGM--NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
              +G   WI  +A+++   S G    + G   D+TE+  +     E+++R    ++    
Sbjct: 680  TKAGQYRWILDQAKIVSRDSHGKPLRMCGTHTDITERKQILNALQESEERYRNLVDNLQN 739

Query: 394  ALVLW---DKNDR--LVMCNANYQKAYGLPDHVLVPG--NARSIIQDAQTRPIIEYRTSD 446
             +V     D          +   ++   +    ++         I       +       
Sbjct: 740  VVVYQITGDLEGNRKFAYISRAVERLNEITVEEVLTDANVIYRQILPQYHDELQLKEVEA 799

Query: 447  PERSQDMSKEIK--LADSRWLQI----NEWCTHDGGTISVGTDITLLKHNQAQLRESKRR 500
                  +  E++  L            +    HDG  I                      
Sbjct: 800  ISNHAPLHIEVQSLLPSGIVKWFEFTVSPRIRHDGQIIW--------------------- 838

Query: 501  LKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNA 560
                          +E   T    +  +    K  A+ AN  KSEFLA MSHE+RTP+N 
Sbjct: 839  ------------DGVEVDITHRKQSEQELIEAKLSADAANLAKSEFLANMSHEIRTPMNG 886

Query: 561  ILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNA 620
            ++G + +++          +  +Y  +I  S   L  +I++IL++SKIE+ K+ ++    
Sbjct: 887  VVGMTHLLRTTDLTP----EQEQYLANIEISANSLTTLISDILDLSKIESGKMVLESTAF 942

Query: 621  DLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNN 678
             L   I + +       Q K I++  +I  EL      D+   ++IL  IL N+IKFT  
Sbjct: 943  SLRSCIQDILSSQQFFIQQKAIRVTTEIADELPNTLIGDQLRTRQILLNILGNAIKFT-E 1001

Query: 679  NGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLG 733
             G++ I    + Q      V + I DTGIG+ +   E+I  PF    +   +  GG GLG
Sbjct: 1002 QGQINIVAELVEQHDRDIHVRMAIRDTGIGMSEQLQEQIFAPFVQADSSTTRRYGGSGLG 1061

Query: 734  LAISDALTNLHGGRLKIISQEGKGTIVTICM 764
            LAI   L +L GGR+ + S+EG G+   I +
Sbjct: 1062 LAICRRLADLMGGRIWVESREGAGSCFYIEL 1092



 Score = 63.5 bits (153), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 82/219 (37%), Gaps = 11/219 (5%)

Query: 327 QLDQIFHMRHASGA-DIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLS 385
            +   +  R +     +++     ++ +    ++   +  ++ E+   E+  A++ ++L+
Sbjct: 283 NITIDYRARWSDIPIWVYLLGGVVILFSTVIIVSNRRLKREMAERNRAEQASADSAKQLN 342

Query: 386 KAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTR---PIIEY 442
             I  T   ++L      +   N      + LP + L+       +  ++ +     +  
Sbjct: 343 AIINTTDAGIILVSPLGVIEFANNRMADMFTLPLNDLIGTRYVERLHPSERQIGDERMRQ 402

Query: 443 RTSDPERSQDMSKEIKLADSR--WLQINEWCTH--DG---GTISVGTDITLLKHNQAQLR 495
                 RS  + +    AD    W  ++       DG     + V +DIT  K  +  LR
Sbjct: 403 LIKGEIRSVTLDRHYIRADGTDFWGHLSGSRMEHADGSLKSLVGVISDITHRKQAEDTLR 462

Query: 496 ESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           E +   +A    L  +++I      +L+I + +    KE
Sbjct: 463 EMEATAQAAKRHLEEAQRIAHLGSWQLNIVSNQLVWSKE 501


>gi|186473345|ref|YP_001860687.1| multi-sensor hybrid histidine kinase [Burkholderia phymatum STM815]
 gi|184195677|gb|ACC73641.1| multi-sensor hybrid histidine kinase [Burkholderia phymatum STM815]
          Length = 989

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 140/667 (20%), Positives = 252/667 (37%), Gaps = 50/667 (7%)

Query: 112 AESMLGQLLAKTRF---LSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSR 168
           AE  L +   +           +L    +  V   +       G    E      R   R
Sbjct: 129 AERRLRESEQRYAITLSSIGDGVLSTDADGFVTFVNPAGEALTGWSRSEATGRRLREVFR 188

Query: 169 SKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISAL 228
                      D     + S +        ++       L +                A 
Sbjct: 189 LHDEHTRVLIDDPTAAVMQSASDGGLPARAILRVRDGSDLPV----ECTGTPMTDERGAR 244

Query: 229 LLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK-----KFHLSRS 283
              ++       K+  +   IL E N  +E A+     G+W  +             S +
Sbjct: 245 QGIVIVFRDVTQKRRAQEAEILRETNARLEMAMYGSNVGVWEIDMPEGDYKRGFARYS-N 303

Query: 284 MYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK-QLDQIFHMRHASGADI 342
           +YE +G    +  L + A   ++H D++   + A +   +      +    +RH  G D 
Sbjct: 304 IYEWLGFDTPHARLDYEAYMSVLHPDHRDSTDRAVASFLESGDGVFELENRLRHRDGTDR 363

Query: 343 WIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKN 401
           W+ VR    R  +G     +G  +D+T+    E+    +++R     E  +  +   D +
Sbjct: 364 WVLVRGTARRDATGKPVRFVGSLVDITQLKVTEQALRASEERFRGTFENAAVGVAHCDLD 423

Query: 402 DRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA-QTRPIIEYRTSDPERSQDMSKEIKLA 460
              +  N    +  G P   L       +I        I  +R     + +  S+E+ L 
Sbjct: 424 GCFLRVNHRSGEIVGWPRGALQQRRLHELIHHDFIAASIDRFRLLTEGKLEHYSEEVPL- 482

Query: 461 DSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKT 520
                        DG  + V   + L      Q                    ++ +  +
Sbjct: 483 ----------VRVDGSRVWVTLSVALQHDASGQTSHV---------------IVIIQDIS 517

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
                    +V KE AE AN+ K +FLA +SHELRTPLN ILG++++++++        +
Sbjct: 518 ARKALEDTVRVAKEAAEAANRAKDQFLANISHELRTPLNGILGYAQMLQRDAR---LDAR 574

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
                  I  SGQHLL +IN+IL+ +++   K+ +      L   +     ++   AQ K
Sbjct: 575 QLASVGVIEQSGQHLLTLINDILDFARLGAGKLELQVGEVSLRGFLETIAEIVAVRAQQK 634

Query: 641 NIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK-IGQCVIITI 697
            + +      +L      D+R ++++L  +L+N++KFT + G++ +  S+     V   +
Sbjct: 635 RLVLNYVAAPDLPAVVRVDERRLRQVLLNLLANAVKFT-DRGEVTLSVSRGAAGRVRFEV 693

Query: 698 ADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKG 757
            DTGIG+    LE I QPFE     + +  GG GLGLAIS  L  + GG +++ S  G+G
Sbjct: 694 RDTGIGVSADRLEAIFQPFEQA-GDHTRRSGGAGLGLAISRQLVRMMGGEIEVTSSAGEG 752

Query: 758 TIVTICM 764
           ++    +
Sbjct: 753 SVFGFEL 759



 Score = 56.5 bits (135), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/159 (13%), Positives = 47/159 (29%), Gaps = 10/159 (6%)

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           K+  E+R  E++QR +  +    + ++  D +  +   N   +   G           R 
Sbjct: 126 KHGAERRLRESEQRYAITLSSIGDGVLSTDADGFVTFVNPAGEALTGWSRSEATGRRLRE 185

Query: 430 I--IQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLL 487
           +  + D  TR +I+  T+   +S          D            DG  + V    T +
Sbjct: 186 VFRLHDEHTRVLIDDPTAAVMQSAS--------DGGLPARAILRVRDGSDLPVECTGTPM 237

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIAN 526
              +   +      +            + R+        
Sbjct: 238 TDERGARQGIVIVFRDVTQKRRAQEAEILRETNARLEMA 276


>gi|153869805|ref|ZP_01999330.1| sensor histidine kinase FexB [Beggiatoa sp. PS]
 gi|152073733|gb|EDN70674.1| sensor histidine kinase FexB [Beggiatoa sp. PS]
          Length = 681

 Score =  415 bits (1068), Expect = e-113,   Method: Composition-based stats.
 Identities = 138/568 (24%), Positives = 244/568 (42%), Gaps = 70/568 (12%)

Query: 230 LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMG 289
           +    S      + K  +  L ++    E A+     GLW+ N++ +K + S    +++G
Sbjct: 48  VVEFQSVGIDITERKLAEKALRKSEERFELAMRGASDGLWDINYETEKAYYSPRFKQMLG 107

Query: 290 IPYENKTLSFRAIARLIHYDNKKICEI-ARSVTGKHVKQLDQIFHMRHASGADIWIQVRA 348
                  ++   I   +H D+     + +++   K + +    F +RH  G  IW+  RA
Sbjct: 108 FSEHES-MTPDDIIHWVHPDDFDKVLLNSKAYVEKKIPKFQHTFRLRHKKGHYIWVLSRA 166

Query: 349 QMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMC 407
             +    G    ++G  MDLT +  +E++  +  + L   I+   + +   D+N R + C
Sbjct: 167 IAVWNEQGQPLRMVGTNMDLTIQKQIEEKLRQQQEFLRLVIDSIPQFIFWKDRNSRYLGC 226

Query: 408 NANYQKAYGL-PDHVLVPGNARSIIQDAQT---RPIIEYRTSDPERSQDMSKE-IKLADS 462
           N N+ +   +     ++      +   A+       ++ R  + +  +    E I+LAD 
Sbjct: 227 NQNFAQIANVNTPKQIIDKTDFDLPWTAEQITYYRNVDRRVMEGDTPEYHIIETIQLADG 286

Query: 463 --RWLQINEWCTHD--GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
             RWL  N+   H+  G  I +                                      
Sbjct: 287 QQRWLDTNKIPLHNVQGQVIGILGSF--------------------------------ED 314

Query: 519 KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
            TE   A  + Q   + AETAN TKS FLA MSHELRTPLNA+LG++++ ++    +  +
Sbjct: 315 ITERKQAEVQLQKALQTAETANHTKSVFLANMSHELRTPLNAVLGYTQIFQQ---DDTLN 371

Query: 579 VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
            +  E    IH +G++LL +IN+IL++SK+E  ++    ++  L   +   ++L     Q
Sbjct: 372 KQQREGIDIIHRNGEYLLTLINDILDISKVEAGQLEFYPKDMKLSQFLQGIVQLFQMRTQ 431

Query: 639 SKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG------ 690
            K I+   K  S L    +AD++ +++I   +LSN+IKFT + G +              
Sbjct: 432 QKKIEFSYKPLSALPEIIHADEKRLRQIFINLLSNAIKFT-DKGSVTFTVKTEQAKIKNE 490

Query: 691 --------------QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAI 736
                           +   I DTGIGI    L+KI  PF+     +     G GLGL+I
Sbjct: 491 PSWVKNTLSTFYSYSRLHFQIEDTGIGIASHELDKIFLPFQQADKNHYNKPMGTGLGLSI 550

Query: 737 SDALTNLHGGRLKIISQEGKGTIVTICM 764
           +  L ++  G + + S  GKG+I  +  
Sbjct: 551 TKNLVDMMDGSIHVESLLGKGSIFWVEF 578



 Score = 67.3 bits (163), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 35/337 (10%), Positives = 99/337 (29%), Gaps = 37/337 (10%)

Query: 324 HVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQ 382
           +++Q      +   +G   W +   + +R   G  +    + +D+TE+   EK   ++++
Sbjct: 14  NIEQQSHEHQVFDVNGKIAWQRWTNRAIRDEHGSVVEFQSVGIDITERKLAEKALRKSEE 73

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
           R   A+   S+ L   +        +  +++  G  +H         II         + 
Sbjct: 74  RFELAMRGASDGLWDINYETEKAYYSPRFKQMLGFSEHE--SMTPDDIIHWVHPDDFDKV 131

Query: 443 RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
             +     +    + +                G  I V +    + + Q Q         
Sbjct: 132 LLNSKAYVEKKIPKFQ-------HTFRLRHKKGHYIWVLSRAIAVWNEQGQPLRMVGTNM 184

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELR------- 555
                                    K + ++E       +  +F+       R       
Sbjct: 185 DLTIQ---------------KQIEEKLRQQQEFLRLVIDSIPQFIFWKDRNSRYLGCNQN 229

Query: 556 -TPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHY---SGQHLLNMINNILEMSKIETE 611
              +  +    ++I K  F    + +   Y +++      G      I   ++++  +  
Sbjct: 230 FAQIANVNTPKQIIDKTDFDLPWTAEQITYYRNVDRRVMEGDTPEYHIIETIQLADGQQR 289

Query: 612 KISIDKQNA-DLIPIINEGIRLIGSSAQSKNIKIEKK 647
            +  +K    ++   +   +       + K  +++ +
Sbjct: 290 WLDTNKIPLHNVQGQVIGILGSFEDITERKQAEVQLQ 326



 Score = 51.9 bits (123), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 37/259 (14%), Positives = 73/259 (28%), Gaps = 33/259 (12%)

Query: 14  YYPGNRQKITVSSKQAFKRAYTSIISHLFSFF-------SSFNQTIPMISMVFLVFIATS 66
           Y P  +Q +  S  ++          H   F        +   + IP     F +     
Sbjct: 98  YSPRFKQMLGFSEHESMTPDDIIHWVHPDDFDKVLLNSKAYVEKKIPKFQHTFRLRHKKG 157

Query: 67  SIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFL 126
             I V +R         Q   M+   +           DL  QK+ E  L Q     R +
Sbjct: 158 HYIWVLSRAIAVWNEQGQPLRMVGTNM-----------DLTIQKQIEEKLRQQQEFLRLV 206

Query: 127 SESF---ILLAQPNELVFASSTKNSHYIGK-KIGEIIPELSRSR-SRSKTVQMSEASLDQ 181
            +S    I     N      +   +         +II +        ++ +         
Sbjct: 207 IDSIPQFIFWKDRNSRYLGCNQNFAQIANVNTPKQIIDKTDFDLPWTAEQITYYRNVDR- 265

Query: 182 QPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAK 241
                    +  ++    II +        R   T ++   ++   ++   +   +    
Sbjct: 266 -------RVMEGDTPEYHIIETIQLADGQQRWLDTNKIPLHNVQGQVIG--ILGSFEDIT 316

Query: 242 KNKENDTILLEANICVETA 260
           + K+ +  L +A    ETA
Sbjct: 317 ERKQAEVQLQKALQTAETA 335


>gi|17229771|ref|NP_486319.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17131370|dbj|BAB73978.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 1299

 Score =  414 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 141/736 (19%), Positives = 273/736 (37%), Gaps = 69/736 (9%)

Query: 81  MTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLS-ESFILLAQPNEL 139
            +    L L +A      +          +K E     L  +T   S +S ILL   N+ 
Sbjct: 134 DSVSDYLFLLQAKNSALADAQKLTTKLKDQKTELQTTALRLRTLIESLQSGILLEDANQH 193

Query: 140 VFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSIL 199
           +   + +   Y    +              + +Q  +     +    L         +  
Sbjct: 194 IILVNQEFCDYFRIPL------------PPQALQGMDCQQALEASKHLFTEPERFICTTD 241

Query: 200 IINSRVPLLRLWREEVTLEVVFF-SIISALLLFILFSY---YRQAKKNKENDTILLEANI 255
            I  +  +      E+        + I  ++   L+ +   YR   + K+++  L  +  
Sbjct: 242 EIIRQGKMFLHQEWELQDGRTLEQNYIPIVVDHKLYGHLWKYRDITQYKKSEVALRLSEE 301

Query: 256 CVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE 315
            ++ A+     GLW++N    + + S   + ++G          +   +LIH D+  + +
Sbjct: 302 RLKLAVDAVEEGLWDWNLVTGEVYRSARWFTMLGYTPMEIGNDIKFRDKLIHPDDIPLMQ 361

Query: 316 I-ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM-RTISGG-MNIIGIAMDLTEKYH 372
               S         +    +   SG   WI  R +++ R   G  + ++G  +D+T++  
Sbjct: 362 QRLISHLKGDTPFYEVEIRLLAKSGEWRWILDRGKLVSRDSQGRAIRMVGTHLDITQRKQ 421

Query: 373 LEKRYAEADQR---------------------------LSKAIECTSEALVLWDKNDRLV 405
            E+   +  Q                            + + ++     +   + +    
Sbjct: 422 AEQDLQQQYQHTLLLKQITEEIRQSLQWEKILKTTVTEVQRILQVDRALIFQINSDGSGK 481

Query: 406 MCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ------DMSKEIKL 459
           +        + +     +             R       +D  +        +  ++ ++
Sbjct: 482 VVQEAVMPGWSVTLDQDIYDPCLKDGYLNMYRDGRITAIADVYQGGLKPCYVEFLQQFQV 541

Query: 460 ADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE-RQ 518
             +  + I       G  I    D                  +  I    +     E RQ
Sbjct: 542 KANLVVPIRVRRNLWGLLIVHQCDRPRQWTELELDLLKHLADQMGIALTQSQLLAQETRQ 601

Query: 519 KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
              L++ N +  V K+ AE AN  KS FLA MSHE+RTP+NAI+G S ++          
Sbjct: 602 AQLLALQNEELNVAKQVAEKANMAKSNFLATMSHEIRTPMNAIIGMSGLLLDTTLKP--- 658

Query: 579 VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
            + ++Y + I  S   LL +IN+IL+ SKIE+ K+ +++Q  DL   + E + L+   A 
Sbjct: 659 -EQFDYVETIRNSSHTLLTIINDILDFSKIESGKLELEEQPFDLRLCVEEALDLLAPQAA 717

Query: 639 SKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGK-MMIRTSK------- 688
           SK I++  ++  +       D   I++IL+ ++SN++KFT      + I   +       
Sbjct: 718 SKGIELMYQLEPDTPTLVVGDITRIRQILWNLVSNAVKFTKIGEICITIGAKQKIYKQTD 777

Query: 689 -IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
                    + DTGIGI +  L ++ +PF  +     +  GG GLGLAIS  L+ + GG+
Sbjct: 778 PTRYEFQFAVQDTGIGIERDRLHRLFKPFSQVDASMTRRYGGTGLGLAISKRLSEIMGGK 837

Query: 748 LKIISQEGKGTIVTIC 763
           + + SQ  +G+I    
Sbjct: 838 MWVESQSHQGSIFYFT 853


>gi|332704490|ref|ZP_08424578.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332554639|gb|EGJ51683.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 842

 Score =  414 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 138/727 (18%), Positives = 272/727 (37%), Gaps = 82/727 (11%)

Query: 78  QEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPN 137
              M+        +  +   QN  ++  LA  +K+E +L  +L    ++    I    P+
Sbjct: 3   LIAMSKDELAEALQHAQE--QNARLQERLAEAEKSERLLKSILE---YIPGGLIYAEAPD 57

Query: 138 ELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGS 197
             + A S      IG+++  I          S  +   +     +  H     +   +  
Sbjct: 58  VSIRAVSRYGQQLIGRQLESIEGRTGPEIQESWKLLHPDGVTQAE--HEELPLVRAVAKG 115

Query: 198 ILIINSRVPLLRLWREEVTLEV-VFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
             +      L R   E++ + +           +    +     +K ++ +  L E+   
Sbjct: 116 EDVREEEWVLFRPDGEKIPILIHAGPVRDEQGTIIGGLASLIGMEKRRQIEERLRESEKR 175

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
              A+S  R G ++ N    + H S     I G+  +        I   +H +++     
Sbjct: 176 FRLAISAARMGAYSRNLQTGQDHWSPEFLAIYGLGPDEPLPFLDGIPAAVHPEDRPRVLA 235

Query: 317 ARSVTGKHV--KQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNII-GIAMDLTEKYHL 373
              V       ++      +  ++G   W+ +  +M   ++G  ++I G+ MD+TE+   
Sbjct: 236 EARVFFGRTVEQEFCNEHRIVRSNGEIRWVMILGKMEFDLAGKPHVIYGLGMDVTERKQA 295

Query: 374 EKRYA---------------------EADQRLSKAIECTSEALVLWDKNDRLVMCNANYQ 412
           E+                        E++QR     E     + + D N +    + ++ 
Sbjct: 296 EEALQQAKEKAEQQANELREALQRLSESEQRYRVMGETIPYGVWMCDPNGKATYVSPSFC 355

Query: 413 KAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCT 472
           K   +             +      P+++         +    E ++             
Sbjct: 356 KLLDMTLEEQNDFGWTHRLVPEDVDPMMDKWIGCCCTGKPWEHEHRI-----------VA 404

Query: 473 HDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE 532
            DGG  +V +    ++H                         +    TE  +     +  
Sbjct: 405 KDGGIRTVLSKGLPIRHEN---------------GKIACWVGVNLDITERKMMEEDLRQA 449

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           K+ AE AN+ KSEFLA MSHE+RTP+N I+G +E+   +        K  +Y Q +  S 
Sbjct: 450 KQAAEAANQAKSEFLASMSHEIRTPMNGIIGLTELALMQ----EPKAKIRDYLQMVKQSA 505

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
             LL++IN+IL++SKIE  ++ ++  + DL  +++     +   A+ K +     I   +
Sbjct: 506 NSLLDIINDILDLSKIEAGRVELEHADFDLRDMLDSLFETMRIGAERKGLSFSTAIDPGV 565

Query: 653 F--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC---------------VII 695
                 D+  +++I   ++ N+IK+T   G++ +R                      ++ 
Sbjct: 566 PDWIKGDEGRLRQIFVNLIGNAIKYT-EAGQVSVRVGVEDGRGAQDAGGRNTPERVCLVA 624

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           ++ DTG GIPK  L +I +PF+           G GLGLAI+  L  L GGR+ + S+ G
Sbjct: 625 SVKDTGGGIPKDKLGRIFEPFDT--GARSAKYDGTGLGLAITKRLVELMGGRITVQSELG 682

Query: 756 KGTIVTI 762
           +G+  + 
Sbjct: 683 RGSTFSF 689


>gi|17232665|ref|NP_489213.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17134311|dbj|BAB76872.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 965

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 117/693 (16%), Positives = 231/693 (33%), Gaps = 88/693 (12%)

Query: 108 SQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS 167
           SQ + E    +L       +   I+   P+ ++   +     ++G    E+I + +    
Sbjct: 52  SQVQLEVTNQKLQQAILNSANYTIISTTPDGIILTFNAAAQRWLGYTAEEVIGKKTPEMI 111

Query: 168 RSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLW--------REEVTLEV 219
             K   +  A   +    +     P     +          R W        R  V L V
Sbjct: 112 HDKNEVVKVA--QELSQELGVTIEPGFEAFVAKARLGQVEEREWTYIRKDGSRFPVLLSV 169

Query: 220 V-FFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
              +     +  F+           K  +  L E+     T       G++  +   +  
Sbjct: 170 TPLYDAEKNITGFLGIG--SDITARKAAEAALRESEYRYATLAQTAPVGIFRNDAFGRCI 227

Query: 279 HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS 338
             +     ++G P ++         + +H D++       +   +        +  RH +
Sbjct: 228 FANERACNLIGSPLKDILG--EGWIQSLHPDDRLRIVREWNQAVQQNLPFKAEYRFRHPN 285

Query: 339 GADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL 397
               W+  +A   R  +G     IG   D+ ++   E+        LS+A+E   E +  
Sbjct: 286 NVINWVIYQAIPERGSNGEVTGYIGTMTDINDRKRAEEELL----HLSQALESAVEGISQ 341

Query: 398 WDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEI 457
            D     +  N  Y K  G     ++       +       ++                 
Sbjct: 342 LDTQGHYIKVNPAYAKITGYKPEEMIGMEWALTVHPDDKEKMMAA------------YHQ 389

Query: 458 KLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILER 517
            L + +          DG        +    + Q +       +K   +     R+ +ER
Sbjct: 390 MLKNGKVEIEARAMRKDGSAFYKQVVMVKAYNQQQECIGHYCFMKDISD-----RREVER 444

Query: 518 QKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELG 577
                                    K EF++ +SHELRTPL +I G  +++   +    G
Sbjct: 445 ------------------------LKDEFVSVVSHELRTPLTSISGALDLLASGVV-PAG 479

Query: 578 SVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSA 637
           S            +   L+ +IN+IL++ +IE+ KI I  Q  +   ++ + + ++   A
Sbjct: 480 SEDAQRMLNIAANNTDRLVRLINDILDIERIESGKIQIAPQACNAADLMTQSVEVMEELA 539

Query: 638 QSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC----- 692
           +   I++    P      AD   I ++   ++SN+IKF+     + +    + +      
Sbjct: 540 EQAGIQLSMS-PLSAHLWADSDRIIQVFTNLISNAIKFSPTGATVWVTAKILEKGELEKS 598

Query: 693 --------------------VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGL 732
                               ++  + D G GIP   LE I + F  +     +  GG GL
Sbjct: 599 QTPIPLYPQTPIPLYPHTPIILFAVKDQGRGIPADKLESIFERFGQVDASDSRKKGGTGL 658

Query: 733 GLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GLAI  ++   HGG++   S  G+G+  +  +P
Sbjct: 659 GLAICRSILQHHGGQIWAESTSGEGSTFSFTLP 691



 Score =  111 bits (277), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 45/330 (13%), Positives = 97/330 (29%), Gaps = 43/330 (13%)

Query: 102 IKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSHYIGKKIGEI 158
           I  D+ ++K AE+ L +   +   L+++    I           ++ +  + IG  + +I
Sbjct: 185 IGSDITARKAAEAALRESEYRYATLAQTAPVGIFRNDAFGRCIFANERACNLIGSPLKDI 244

Query: 159 IPEL-----SRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
           + E                + ++A     P+         N+    +I   +P      E
Sbjct: 245 LGEGWIQSLHPDDRLRIVREWNQAVQQNLPFKAEYRFRHPNNVINWVIYQAIPERGSNGE 304

Query: 214 EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF 273
                                         K  +  LL     +  AL     G+   + 
Sbjct: 305 VTGYIGTM----------------TDINDRKRAEEELL----HLSQALESAVEGISQLDT 344

Query: 274 DNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFH 333
                 ++ +  +I G   E         A  +H D+K+    A     K+ K ++    
Sbjct: 345 QGHYIKVNPAYAKITGYKPEEMIG--MEWALTVHPDDKEKMMAAYHQMLKNGK-VEIEAR 401

Query: 334 MRHASGADIWIQ-VRAQMMRTISGGMNIIGIAMDLTEKYHLEK-----------RYAEAD 381
                G+  + Q V  +        +       D++++  +E+                 
Sbjct: 402 AMRKDGSAFYKQVVMVKAYNQQQECIGHYCFMKDISDRREVERLKDEFVSVVSHELRTPL 461

Query: 382 QRLSKAIECTSEALVLWDKNDRLVMCNANY 411
             +S A++  +  +V     D   M N   
Sbjct: 462 TSISGALDLLASGVVPAGSEDAQRMLNIAA 491


>gi|254415932|ref|ZP_05029689.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
 gi|196177359|gb|EDX72366.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
          Length = 1821

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 144/718 (20%), Positives = 265/718 (36%), Gaps = 65/718 (9%)

Query: 75   YAQQEKMTNQT-SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRF----LSES 129
            +        +         I+      +I  D+  +K+AE  L     + R      S  
Sbjct: 868  HRLASGEIREVEVYSSAIEIQDRTFLVSIIHDITERKQAERALHDSEERFRAIFEQASVG 927

Query: 130  FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQP------ 183
              L+   +  +   + +     G    E++    +  +     + +   L Q        
Sbjct: 928  IALVTPSSGELLRVNQRYCEITGYPESELVGRRVQDITHPDDREQNIEYLQQLMSGKTST 987

Query: 184  YHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKN 243
            Y      + ++     +  S   +     +                     +        
Sbjct: 988  YATEKRYIRNDGQYRWVYISISRVCDSEHKPNY----------------ALAVVEDISDR 1031

Query: 244  KENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIA 303
            K  +  L ++       L      +   N   +    +    ++ G              
Sbjct: 1032 KATEAELRDSEAKFRAFLESASEAIIVTNAQGEIIVFNAKAEDLFGYNRTEIFGRNIEYL 1091

Query: 304  --RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNII 361
                 H  +        +   K      Q  + +   G +  I+V    ++T +G   +I
Sbjct: 1092 MPPRYHSIHTHHRADYLTHPSKRTMGKSQDLYAKRQDGTEFPIEVGLSTIQTKNGTF-VI 1150

Query: 362  GIAMDLTEKYHLEK-----------RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNAN 410
                D+TE+   E            +  E + R ++ +E   E + + D        N  
Sbjct: 1151 AFLTDITERQQAEHEIKRLNQKLESQIRETETRYAQIVELAEEGIWVTDVQGNTTYINQA 1210

Query: 411  YQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEW 470
              +  G  +  ++       +     R                S      +    Q  E 
Sbjct: 1211 MARMLGYTEVEILGHAIADFLPPGDNRF------------TSASSIPLHPNQVHRQEVEL 1258

Query: 471  CTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQ 530
             T  G TI      + +  +Q  L  S   +               + + +L  +N +  
Sbjct: 1259 RTKSGNTIWAYMSTSPVLDDQGNLLWSCALVYDITERK--------QAEKQLRESNERIS 1310

Query: 531  VEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHY 590
            +       A + K EFLA MSHELRTPLNAILG +E +++E++G L + K ++    I  
Sbjct: 1311 LANAELARATRLKDEFLASMSHELRTPLNAILGLAEALQEEVYGSL-TPKQHKSLATIEQ 1369

Query: 591  SGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPS 650
            SG+HLL++IN+IL++SKIE+ K+S+      +  +    +  I   AQ KNI++E  I  
Sbjct: 1370 SGKHLLDLINDILDLSKIESGKMSLSVSLVSVDSLCESSLTFIKQQAQQKNIRLEYHIAP 1429

Query: 651  EL-FFNADKRIIKKILFPILSNSIKFTNNNGKMM--IRTSKIGQCVIITIADTGIGIPKS 707
             L     D+R I+++L  +LSN++KFT + GK+   + T   G+ + +++ DTGIGI   
Sbjct: 1430 GLSEIEVDERRIRQVLVNLLSNAVKFTPDGGKVSLQVTTDPDGEKLQLSVTDTGIGIAPE 1489

Query: 708  ALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             L+K+ +PF  L +   +   G GLGLA+   +  L GG + + S+ GKG+  T+ +P
Sbjct: 1490 NLDKLFKPFVQLDSSLSRRYAGTGLGLALVRRIVELQGGSIALESEVGKGSCFTVNLP 1547



 Score =  203 bits (517), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 64/492 (13%), Positives = 149/492 (30%), Gaps = 37/492 (7%)

Query: 54  MISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAI-EIIFQNNNIKFDLASQKKA 112
             S+   + +  + +  +    ++ +        +LTE   ++ +  + ++  +A ++  
Sbjct: 475 AASIALPLIVEGTCLGALNIYASEPDAFDPAEVRLLTELANDLAYGISALRTQVALRQNK 534

Query: 113 ESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEI-------IPELSRS 165
           +  L  +L     +  S          V   S       G+ + +        +  +   
Sbjct: 535 Q-RLDSILNALDDVVWSISATTDQ---VLYLSPATETVYGRLVQDFFDHPHLRLGVVHPD 590

Query: 166 RSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSII 225
              ++     +  L Q  Y +       +     + +            + L+       
Sbjct: 591 DY-AQVSPFHQQLLAQGTYSLEYRIQRPDGEIRWLYDRGRVTYDQQGHPLRLD------- 642

Query: 226 SALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMY 285
                             K+ +  L  +      AL     G+W++N        S    
Sbjct: 643 ---------GIASDITDRKQAEDALRVSEERWHLALRGNSDGIWDWNVKTNDVFFSPRWK 693

Query: 286 EIMGIPYENKTLSFRAIARLIHYDNKKICE-IARSVTGKHVKQLDQIFHMRHASGADIWI 344
           E++G   +         ++ +H D+ +    + +               +    G+  WI
Sbjct: 694 EMLGYEEDEIPNHLDEWSKRVHPDDLEWVMGLIQDHFDHKTSYYSSEHRLLCKDGSYKWI 753

Query: 345 QVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKN-D 402
             R Q +    G  + ++G   D++++   E    +++ R     E +    +L D    
Sbjct: 754 LDRGQALWDDQGKVVRMVGSHTDISDRKAAEAALRDSEARFRAMFERSKAIKLLIDSETG 813

Query: 403 RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADS 462
            +   N    K YG     L+      +      +   E + +  E         +LA  
Sbjct: 814 AIADANWAAVKFYGYSRSQLITKTITDLNCLPLPQVQAEMKRAKLEERTYFVFPHRLASG 873

Query: 463 RW----LQINEWCTHDGGT-ISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILER 517
                 +  +     D    +S+  DIT  K  +  L +S+ R +A     S    ++  
Sbjct: 874 EIREVEVYSSAIEIQDRTFLVSIIHDITERKQAERALHDSEERFRAIFEQASVGIALVTP 933

Query: 518 QKTELSIANAKY 529
              EL   N +Y
Sbjct: 934 SSGELLRVNQRY 945



 Score = 50.8 bits (120), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 49/360 (13%), Positives = 109/360 (30%), Gaps = 39/360 (10%)

Query: 62  FIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLA 121
            +   + ++      +Q+ +    S +    + +      I  + A            L 
Sbjct: 71  LLEAETAVRGYEITRRQDFLDRYESAIAQIPVTLEQLRQLIAQEHAQ--------AHRLQ 122

Query: 122 KTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQ 181
           + R L+ + + L Q N  +  +  + +    + I +++         +  +Q  + +  Q
Sbjct: 123 RIRELATARVSLLQRNLRLVDAKPETATESPEFIDQLVEGKQVMDQVNDEIQQFQITEQQ 182

Query: 182 QPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIIS-ALLLFILFSYYRQA 240
           +                         L   R+     +   +II     L   +  YR  
Sbjct: 183 EE------------------TQLKQTLDQQRQFTGSILALSAIIGIGGSLLAAYLSYRLE 224

Query: 241 KKNKENDTILLEANICVETALSRGRCG-LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSF 299
              +++D    E+       +     G +  FN + +      S    +G+      L  
Sbjct: 225 HHLQKSDRRWRESEARYRAVVENFPNGAVLLFNHELRYLLADGSGLASVGLSK--TLLEG 282

Query: 300 RAIARLIHYDNKKICE-IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM 358
             I   +        E + R V        +  F      G  I+I +    ++  +G +
Sbjct: 283 NTIQECLPPQTCTQLEPLYRQVLAGETVTQEMPF------GDRIFI-IHGLPLKNQTGEI 335

Query: 359 -NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL 417
              + +A D+TE    E+    A++ L    EC    ++  D+   L           G 
Sbjct: 336 IAGMVVAQDITELKQSEQALYHANRALRTLSECNQALVLATDEPTLLHNICQIIVDFGGY 395


>gi|298528781|ref|ZP_07016185.1| multi-sensor hybrid histidine kinase [Desulfonatronospira
            thiodismutans ASO3-1]
 gi|298512433|gb|EFI36335.1| multi-sensor hybrid histidine kinase [Desulfonatronospira
            thiodismutans ASO3-1]
          Length = 1625

 Score =  413 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 124/681 (18%), Positives = 246/681 (36%), Gaps = 75/681 (11%)

Query: 104  FDLASQKKAESMLGQLLAKTRFLSE---SFILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
             D+  +K AE  L +     R + E     + L      +           G+   E++ 
Sbjct: 520  TDITRRKLAEESLREQEFFYRSILESINDAVFLTDAQGDLTFVCPNAHVIFGRSRQELLE 579

Query: 161  ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
              +                           +           +       WR  +     
Sbjct: 580  MANIEHVL------------GSRLIKSGELVEDEQEISNRECAIKDSRGHWRYLLVNIKR 627

Query: 221  FFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHL 280
                +    L++     R   + K+ +    +        +     G+   +   +    
Sbjct: 628  LPEQLHEKGLYLY--CCRDVTEKKKTEDTFRQTLERYRLIVENANEGIRILDRQARLSFA 685

Query: 281  SRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGA 340
            +RSM  ++G   E   ++  +I   IH +++           K  K       + H +G+
Sbjct: 686  NRSMALMLGYSPE--KVTDHSIWDFIHPEDQDKFNRIWEN-RKSGKAEKYELRLIHRNGS 742

Query: 341  DIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDK 400
             +W  V +  +           +  D+TEK HLE+   +  + L+   E        WD 
Sbjct: 743  TVWTLVSSTPLFKDKEFNGSFALVADITEKKHLEEELRKQQEILTSMEEMARVGGWEWDI 802

Query: 401  NDRLVMCNANYQKAYGLPDHV------LVPGNARSIIQDAQTRPIIEYRTSDPERSQDMS 454
            + R +         +    +        +   +           +     +  E+     
Sbjct: 803  DARTMTWTRGAYLIHDFEVNHNPTLSSELISKSLECYYKEDRSRVSNAFQACAEKGVAYD 862

Query: 455  KEIKLADSR----WLQINEWCTHD-GGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
            +E     +R    W++   W  +D G  + V   I  +                      
Sbjct: 863  QEFPFVSARGRRLWVRTAAWPVYDSGRIVRVAGHIMDI---------------------- 900

Query: 510  TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
                      TEL  +    Q  +++A+ A + KSEFLA MSHE+RTP+N ++G ++++ 
Sbjct: 901  ----------TELKQSQLDLQEARDKAQEATRAKSEFLANMSHEIRTPMNGVIGMTDLLM 950

Query: 570  KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
                      +    A+ I  SG+ LL +IN+IL+ SKIE  ++ ++  + +L  ++ + 
Sbjct: 951  DTELRP----EQRSLAESIQSSGEALLALINDILDFSKIEAGRLELESVDFNLRYLLEDL 1006

Query: 630  IRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
              L+   A  K +++      ++      D   +++IL  ++ N+IKFT+  G++++R  
Sbjct: 1007 ASLMAVRADEKGLELICLPDPDVPAQVQGDPGRLRQILTNLVGNAIKFTHQ-GEVVVRVQ 1065

Query: 688  KIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
            +         ++ T+ DTGIGIP+  ++ +   F  +     +  GG GLGLAIS  L  
Sbjct: 1066 RSEVSADDVLLLFTVQDTGIGIPEDKIDLLFNKFSQVDASTTRKFGGTGLGLAISRQLAE 1125

Query: 743  LHGGRLKIISQEGKGTIVTIC 763
            + GG + + S+ G+G      
Sbjct: 1126 MMGGEVGVQSEYGRGCKFWFT 1146



 Score =  207 bits (527), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 71/446 (15%), Positives = 150/446 (33%), Gaps = 39/446 (8%)

Query: 105 DLASQKKAESMLGQLLAKTRFLSESFILL---AQPN-ELVFASSTKNSHYIGKKIGEI-- 158
           D+   K+    L +       L E    +     P+   +  ++   + + G    E+  
Sbjct: 268 DITRLKEQHDELRKREQMFTNLFEKHAAVKLMVDPDTGAIIDANHAAAEFYGWSREELKK 327

Query: 159 --IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
             I E++         ++  A    + +     +   +     +      +    R+   
Sbjct: 328 KYIQEINTLSPDELHKELERARSRDKFWF-EFQHRLADGSIRDVEVFSSKIESHGRQ--- 383

Query: 217 LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
                          +L+S  +     K+ +  LLE+      A+   + GLW+++    
Sbjct: 384 ---------------VLYSIIQDITDRKKAEKELLESRERFSLAMEATKDGLWDWDVSTG 428

Query: 277 KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKK-ICEIARSVTGKHVKQLDQIFHMR 335
           + + S     ++G          +    LIH + K+   +         V      + M+
Sbjct: 429 EVYFSPGYVSMLGYDSAEVPGHVQTWLDLIHPEEKEKAYQANLDCINNLVDSFAVEYRMQ 488

Query: 336 HASGADIWIQVRAQMM-RTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
             +G  +WI  R   + R  +G  + +IG   D+T +   E+   E +      +E  ++
Sbjct: 489 ARNGNWVWILGRGSAVKRDETGKALRMIGTHTDITRRKLAEESLREQEFFYRSILESIND 548

Query: 394 ALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDM 453
           A+ L D    L     N    +G     L+       +  ++     E    D +   + 
Sbjct: 549 AVFLTDAQGDLTFVCPNAHVIFGRSRQELLEMANIEHVLGSRLIKSGE-LVEDEQEISNR 607

Query: 454 SKEIKLADSRW--LQINEWCTHD-----GGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
              IK +   W  L +N     +     G  +    D+T  K  +   R++  R +  + 
Sbjct: 608 ECAIKDSRGHWRYLLVNIKRLPEQLHEKGLYLYCCRDVTEKKKTEDTFRQTLERYRLIVE 667

Query: 507 DLSTSRQILERQKTELSIANAKYQVE 532
           + +   +IL+RQ   LS AN    + 
Sbjct: 668 NANEGIRILDRQAR-LSFANRSMALM 692



 Score =  127 bits (319), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 46/462 (9%), Positives = 124/462 (26%), Gaps = 34/462 (7%)

Query: 74  RYAQQEKMTNQT-SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSE---S 129
           ++   +                      +I  D+  +KKAE  L +   +     E    
Sbjct: 359 QHRLADGSIRDVEVFSSKIESHGRQVLYSIIQDITDRKKAEKELLESRERFSLAMEATKD 418

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
            +     +      S      +G    E+   +           +      ++ Y     
Sbjct: 419 GLWDWDVSTGEVYFSPGYVSMLGYDSAEVPGHVQTWL------DLIHPEEKEKAYQANLD 472

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
            + +   S  +          W   +          +   L ++   +    + K  +  
Sbjct: 473 CINNLVDSFAVEYRMQARNGNWVWILGRGSAVKRDETGKALRMI-GTHTDITRRKLAEES 531

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYEN--KTLSFRAIARLIH 307
           L E      + L      ++  +       +  + + I G   +   +  +   +     
Sbjct: 532 LREQEFFYRSILESINDAVFLTDAQGDLTFVCPNAHVIFGRSRQELLEMANIEHVLGSRL 591

Query: 308 YDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI-IGIAMD 366
             + ++ E  + ++ +          ++ + G   ++ V  + +        + +    D
Sbjct: 592 IKSGELVEDEQEISNR-------ECAIKDSRGHWRYLLVNIKRLPEQLHEKGLYLYCCRD 644

Query: 367 LTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGN 426
           +TEK   E  + +  +R    +E  +E + + D+  RL   N +     G     +   +
Sbjct: 645 VTEKKKTEDTFRQTLERYRLIVENANEGIRILDRQARLSFANRSMALMLGYSPEKVTDHS 704

Query: 427 ARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITL 486
               I              + +  +    E++L              +G T+      T 
Sbjct: 705 IWDFIHPEDQDK-FNRIWENRKSGKAEKYELRL-----------IHRNGSTVWTLVSSTP 752

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQK-TELSIANA 527
           L  ++            T           +++  T +     
Sbjct: 753 LFKDKEFNGSFALVADITEKKHLEEELRKQQEILTSMEEMAR 794



 Score =  127 bits (318), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/314 (12%), Positives = 92/314 (29%), Gaps = 27/314 (8%)

Query: 258 ETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIP-YENKTLSFRAIARLIHYDNKKICEI 316
              L     G++    + K  +++ ++  + G    ++   S   IA  ++ +       
Sbjct: 24  RDLLENAPTGIFTSTPEGKLIYVNSALARMFGYDSPQDMVESVTDIASQLYANPADR-AA 82

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEK 375
                    + ++  + MR   G + W+   A+ +    G  +   G   D+TE+  +++
Sbjct: 83  FLRHLEDKKELVNHEYRMRRRDGTEFWVSRNARAVLDEDGRLVACQGFTTDITERKQVQE 142

Query: 376 RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQ 435
               ++++     E  ++ +V  D    ++  N   ++  GL    +V  ++        
Sbjct: 143 ALGASEEKHRLLFETMAQGVVYQDAEGVIISVNPAAERILGLTSEQIVRRSSMD------ 196

Query: 436 TRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLR 495
            +  +                  L   +           G    V  D   L      + 
Sbjct: 197 PQWKMIQEDGSEVPGSQHPAMTALKSGKTTGPVTR----GVYHPVSNDHIWLSITAVPMF 252

Query: 496 ESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAET--------------ANK 541
                    +         L+ Q  EL      +    E+                 AN 
Sbjct: 253 HPGDSKPCQVYTTFEDITRLKEQHDELRKREQMFTNLFEKHAAVKLMVDPDTGAIIDANH 312

Query: 542 TKSEFLAKMSHELR 555
             +EF      EL+
Sbjct: 313 AAAEFYGWSREELK 326



 Score =  111 bits (279), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 48/439 (10%), Positives = 112/439 (25%), Gaps = 60/439 (13%)

Query: 124 RFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQP 183
              + + I  + P   +   ++  +   G        +  +    S T   S+   +   
Sbjct: 27  LENAPTGIFTSTPEGKLIYVNSALARMFGY-------DSPQDMVESVTDIASQLYANPAD 79

Query: 184 YHVLSVNLPHNSGSI--LIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAK 241
                 +L      +       R      W       V+         L     +     
Sbjct: 80  RAAFLRHLEDKKELVNHEYRMRRRDGTEFWVSRNARAVLDEDGR----LVACQGFTTDIT 135

Query: 242 KNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR- 300
           + K+    L  +             G+   + +     ++ +   I+G+  E        
Sbjct: 136 ERKQVQEALGASEEKHRLLFETMAQGVVYQDAEGVIISVNPAAERILGLTSEQIVRRSSM 195

Query: 301 --AIARLIH-----YDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRT 353
                 +         ++     A             ++H        IW+ + A  M  
Sbjct: 196 DPQWKMIQEDGSEVPGSQHPAMTALKSGKTTGPVTRGVYHPVSND--HIWLSITAVPMFH 253

Query: 354 --ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKN-DRLVMCNAN 410
              S    +     D+T          + +Q  +   E  +   ++ D +   ++  N  
Sbjct: 254 PGDSKPCQVYTTFEDITRLKEQHDELRKREQMFTNLFEKHAAVKLMVDPDTGAIIDANHA 313

Query: 411 YQKAYGLPDHVLVPGNARSI--IQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQIN 468
             + YG     L     + I  +   +    +E                +  D  W +  
Sbjct: 314 AAEFYGWSREELKKKYIQEINTLSPDELHKELERA--------------RSRDKFWFEF- 358

Query: 469 EWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK 528
           +    DG    V    + ++ +  Q+  S                 + +  T+   A  +
Sbjct: 359 QHRLADGSIRDVEVFSSKIESHGRQVLYS-----------------IIQDITDRKKAEKE 401

Query: 529 YQVEKERAETANKTKSEFL 547
               +ER   A +   + L
Sbjct: 402 LLESRERFSLAMEATKDGL 420


>gi|17230367|ref|NP_486915.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17131969|dbj|BAB74574.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 1817

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 129/778 (16%), Positives = 263/778 (33%), Gaps = 102/778 (13%)

Query: 66   SSIIKVTTRYAQ--QEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKT 123
                       Q   + +   T + L +         ++  D+  +K AE +L +   + 
Sbjct: 632  GRWSGEINFVRQDGSQGICETTIVALQDDQGQSMATISVNRDITERKHAELLLRRSEERF 691

Query: 124  RF---LSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
            +     S +   +   +  +   S            E+I +        +  Q    ++ 
Sbjct: 692  QAFMNHSPTPAWITDIDGTIVYVSETYRRTFQLPTQELIGKNIVDIYPPELTQTFRETIQ 751

Query: 181  QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
                          +  ++      P       +  +     S      L    +     
Sbjct: 752  IVAR----------TRQVMETVESAPCSDGTGRDFLVYKFPISSKPDECLIGCIA--IDI 799

Query: 241  KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR 300
             + K+ +  L ++    +  +   +  +W++N    +   S    E++            
Sbjct: 800  TERKQAEAALRKSEERWQLVIEGNQDAIWDWNIITNETFRSARWAELIKEQNYQPIADHA 859

Query: 301  AIARLIHYDNKKICEIARS-VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM- 358
                 IH D+ +     +     + +      + +R    +  W+ V A       G   
Sbjct: 860  DCVSRIHPDDYERVMAVKQDCLSRKIPNYVVEYRLRCNDDSYRWVLVHATGQWDEQGNPV 919

Query: 359  NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL-WDKNDRLVMCNANYQKAYGL 417
             ++G   D+TE+   ++       R +  +E  ++ +    D  +          +A  +
Sbjct: 920  RMVGSIKDITERIEAQEALQRQLHR-TLLLEKITQKIRQSLDSKEIFETAATQIGQALAV 978

Query: 418  PDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGT 477
               ++    +          P++    +  +       E     ++ +           +
Sbjct: 979  DRCLIHSYIS----HHDPHIPLVAEYNNVLDYCSMQKWEFTTTGNQHILKMMSQDKAIAS 1034

Query: 478  ISVGTDITLLKHNQAQLR-------------------ESKRRLKATINDLSTSRQIL--- 515
             +V TD  L     +                                   +     L   
Sbjct: 1035 ANVYTDPLLQTAVPSCCEIGVKSMLAVRTSYQGEPSGAICLHQCGYFRQWTNEEIELLEA 1094

Query: 516  ------------------ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTP 557
                               RQ+ EL+I N   +  K  AE AN+ KSEFLA MSHE+RTP
Sbjct: 1095 VAAQLGIALAQAQLLEQETRQREELTIKNFALEQAKRAAEAANRAKSEFLAMMSHEIRTP 1154

Query: 558  LNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDK 617
            +NA++G + ++         + +  ++ + +  SG  LL++IN+IL+ SKIE+ K+ +++
Sbjct: 1155 MNAVIGMTGLLLDTEL----TSQQRDFVETVLTSGDALLSIINDILDFSKIESGKLELEE 1210

Query: 618  QNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN--ADKRIIKKILFPILSNSIKF 675
            Q  ++   + + I L+ + A  K+I++   I  ++      D   +++IL  +L+N+IKF
Sbjct: 1211 QPFEVRTCVEQVIDLLAAKAAQKDIELAYLIHPQVPMQIAGDLTRLRQILTNLLNNAIKF 1270

Query: 676  TNNNGKMMIRTSKIGQ---------CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
            T   G++++                 +I TI DTGIGI    ++ + QPF        + 
Sbjct: 1271 TPE-GEVVVSVRSQPSPNQKNKNCCEIIFTIKDTGIGIAPETMDLLFQPFVQADASMTRK 1329

Query: 727  IGGFGLGLAISDALTNLHGGRLKIISQ--------EG-------------KGTIVTIC 763
             GG GLGL IS  L  + GG L + S+         G              G+     
Sbjct: 1330 YGGTGLGLVISKRLGEMMGGYLWVESRGCVGGNPPPGWQTKNSISSASVATGSTFYFS 1387



 Score =  135 bits (339), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 57/443 (12%), Positives = 125/443 (28%), Gaps = 30/443 (6%)

Query: 105 DLASQKKAESMLGQLLAKTRFLSESFILLAQPN---ELVFASSTKNSHYIGKKIGEIIPE 161
           D+   K+ E  L     +    S + I+++        V   ++      G K  E++  
Sbjct: 426 DITDLKRVEETLRLRE-RALAASSNGIVISDAKLPHYPVIYVNSAFEQITGYKATEVVGR 484

Query: 162 LSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVF 221
             R             +  QQ       +      +  +I                    
Sbjct: 485 NCRFLLG---------NDTQQSAIEELRSALKAGKNCKVILRNYRKDGSLFWNQLSVSPI 535

Query: 222 FSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLS 281
           ++      L             ++ +  L                G+   N   +    +
Sbjct: 536 YNDNGQ--LSHFIGIQTDISDRQQAEASLR----RQALTFENIYDGVIITNLQGQILDWN 589

Query: 282 RSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGAD 341
            +   + G    +     ++I+ L   D       A         +     +     G+ 
Sbjct: 590 PAAERMFGYSKNHICG--QSISTLHKVDEDAALNSAIIAEITKQGRWSGEINFVRQDGSQ 647

Query: 342 IWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDK 400
              +     ++   G  M  I +  D+TE+ H E     +++R    +  +     + D 
Sbjct: 648 GICETTIVALQDDQGQSMATISVNRDITERKHAELLLRRSEERFQAFMNHSPTPAWITDI 707

Query: 401 NDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIE--YRTSDPERSQDMSKEIK 458
           +  +V  +  Y++ + LP   L+  N   I     T+   E     +   +  +  +   
Sbjct: 708 DGTIVYVSETYRRTFQLPTQELIGKNIVDIYPPELTQTFRETIQIVARTRQVMETVESAP 767

Query: 459 LADSRWLQINEWCTHDGG------TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
            +D        +               +  DIT  K  +A LR+S+ R +  I     + 
Sbjct: 768 CSDGTGRDFLVYKFPISSKPDECLIGCIAIDITERKQAEAALRKSEERWQLVIEGNQDAI 827

Query: 513 QILERQKTELSIANAKYQVEKER 535
                   E   +    ++ KE+
Sbjct: 828 WDWNIITNETFRSARWAELIKEQ 850



 Score =  119 bits (299), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/285 (11%), Positives = 98/285 (34%), Gaps = 21/285 (7%)

Query: 239 QAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF-HLSRSMYEIMGIPYENKTL 297
           + +K  + +  L  +   +   +   R   W F+   + F ++   +  ++      +  
Sbjct: 299 RIEKQTQVEIALRASETRLRELVETVRVIPWEFDLKTQHFTYVGPQVETLLAY-PVAQWY 357

Query: 298 SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG 357
                   +H  ++              +  +  + M  A G  +W++    +++     
Sbjct: 358 EENFWDNHLHTLDRDWAVRFCQEAANKGQNHELEYRMLAADGRVVWLRDVVNVVQVDGTP 417

Query: 358 MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWD---KNDRLVMCNANYQKA 414
           + + G   D+T+   +E+     ++ L+     +S  +V+ D    +  ++  N+ +++ 
Sbjct: 418 VMLRGFMFDITDLKRVEETLRLRERALA----ASSNGIVISDAKLPHYPVIYVNSAFEQI 473

Query: 415 YGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHD 474
            G     +V  N R ++ +   +  IE   S  +  ++    ++               D
Sbjct: 474 TGYKATEVVGRNCRFLLGNDTQQSAIEELRSALKAGKNCKVILR-----------NYRKD 522

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQK 519
           G        ++ + +           ++  I+D   +   L RQ 
Sbjct: 523 GSLFWNQLSVSPIYN-DNGQLSHFIGIQTDISDRQQAEASLRRQA 566


>gi|113969059|ref|YP_732852.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-4]
 gi|113883743|gb|ABI37795.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-4]
          Length = 1767

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 135/704 (19%), Positives = 268/704 (38%), Gaps = 74/704 (10%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVF- 141
              +L    E   Q      D+  +   E  +     + R         +   +  ++   
Sbjct: 607  LSILPADNEGRRQVAASIRDMTQKLAVEQKIRDSELRFRGLVTNIPGAVYRTRIGDVWVM 666

Query: 142  -ASSTKNSHYIGKKIGEIIPELSRSR---SRSKTVQMSEASLD----QQPYHVLSVNLPH 193
               S   +   G    + I    R+       +   +    +D    QQ    +   + H
Sbjct: 667  EYVSENIADITGYAASQFIENRQRTFESLILEEDRALCHQHIDRALAQQETFEVEYRIRH 726

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GS+  ++ +      + +E     ++F                   ++K     L  +
Sbjct: 727  RDGSVRWVHEKG--KASYTDE--GFPLWFDGSID-----------DITESKLALVELESS 771

Query: 254  NICVETALSRGRCGL----WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +        C +    W    D     LS + Y ++G+  ++    F  IA  I  +
Sbjct: 772  RQQLTNITESIPCTVYQLRWISPVDRTFTFLSGAAYHMLGLHRDDLLKDFNIIAERIFDE 831

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A +   +   Q  + F  RH +G+  W++  A       G +   G  MD+TE
Sbjct: 832  ERSEVVRALAGKSEDKLQWVREFRYRHPNGSTRWMEAGASGHICDDGAIIWNGYVMDITE 891

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       + ++  +V  D    ++ CN  Y +  G     L   +   
Sbjct: 892  RKAMEEELAVSEAHFKALFDGSTIGIVNIDAKGVILDCNDQYCEDMGQSRESLCGMSIFE 951

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWC---THDGGTISVGTDITL 486
            ++             S  ++    ++  +LA+ R             +G  + +  +++ 
Sbjct: 952  VL-------------SLQDKETAKAQFKELAEGRVDHYRGERSFIRPNGEPLWMTVNVSA 998

Query: 487  LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
            L  +Q +   +   +                  TEL + + +  V KE A+ A+K K +F
Sbjct: 999  LFDSQKRFESAVVSMVDM---------------TELKLLSDELLVAKEEADAASKAKGDF 1043

Query: 547  LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
            LA MSHE+RTP+NAI+G S++  +    +    K   Y + I  + + LL++IN+IL+ S
Sbjct: 1044 LANMSHEIRTPMNAIIGMSQLCLQTELDK----KQKNYVEKIERASKSLLSIINDILDFS 1099

Query: 607  KIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKI 664
            KIE  K+ I+     L  ++ +   +    A  K +++   +   +      D   + ++
Sbjct: 1100 KIEAGKLDIESVPFQLDTMLEDLSDMFSEKAAHKQLELLFAVAPNVPRHLFGDSLRLGQV 1159

Query: 665  LFPILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPL 719
            L  +++N+IKFT   G++++  + + Q      +  ++ D+GIG+      K+ + F   
Sbjct: 1160 LINLMNNAIKFT-ERGEVLLSLNLVEQQNDDVVLRFSVRDSGIGLTAEQQAKLFKSFSQA 1218

Query: 720  HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
                 +  GG GLGLAI   L  L GG + + SQ G G+     
Sbjct: 1219 DTSTTRKYGGTGLGLAICKQLVELMGGTIGVESQFGHGSTFYFT 1262



 Score =  132 bits (332), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 53/423 (12%), Positives = 123/423 (29%), Gaps = 41/423 (9%)

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
           L      +     +  D+      +             +   +L+     L+  S+T+  
Sbjct: 487 LVSDTGELMSVEMLFTDVTE----QFSAAAWSNAVLEAAPEAMLIVDQMGLIVFSNTRCQ 542

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
              G +   ++  L       + ++ + A    Q           N+  +  + +     
Sbjct: 543 ILFGYEASAMLG-LQVESLLPEALRSNHARDRLQFLREGRDRPMANAKHVRALKADGGEF 601

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE-------TAL 261
                E+ L ++         +    +  R   +    +  + ++ +           A+
Sbjct: 602 VA---EIALSILPADNEGRRQVA---ASIRDMTQKLAVEQKIRDSELRFRGLVTNIPGAV 655

Query: 262 SRGRCG-LWNFNFDNKKFHLSRSMYEIMGIPYENK-TLSFRAIARLIHYDNKKICEIARS 319
            R R G +W         ++S ++ +I G           R    LI  +++ +C     
Sbjct: 656 YRTRIGDVWVME------YVSENIADITGYAASQFIENRQRTFESLILEEDRALCHQHID 709

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNII-GIAMDLTEKYHLEKRYA 378
                 +  +  + +RH  G+  W+  + +   T  G      G   D+TE         
Sbjct: 710 RALAQQETFEVEYRIRHRDGSVRWVHEKGKASYTDEGFPLWFDGSIDDITESKLALVELE 769

Query: 379 EADQRLSKAIECT----SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR--SIIQ 432
            + Q+L+   E       +   +   +      +       GL    L+         I 
Sbjct: 770 SSRQQLTNITESIPCTVYQLRWISPVDRTFTFLSGAAYHMLGLHRDDLLKDFNIIAERIF 829

Query: 433 DAQTRPIIEYRT--SDPERSQDMSKEIKLADS--RWLQ--INEWCTHDGGTIS--VGTDI 484
           D +   ++      S+ +         +  +   RW++   +     DG  I      DI
Sbjct: 830 DEERSEVVRALAGKSEDKLQWVREFRYRHPNGSTRWMEAGASGHICDDGAIIWNGYVMDI 889

Query: 485 TLL 487
           T  
Sbjct: 890 TER 892


>gi|114048796|ref|YP_739346.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-7]
 gi|113890238|gb|ABI44289.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-7]
          Length = 1767

 Score =  412 bits (1059), Expect = e-112,   Method: Composition-based stats.
 Identities = 135/704 (19%), Positives = 268/704 (38%), Gaps = 74/704 (10%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVF- 141
              +L    E   Q      D+  +   E  +     + R         +   +  ++   
Sbjct: 607  LSILPADNEGRRQVAASIRDMTQKLAVEQKIRDSELRFRGLVTNIPGAVYRTRIGDVWVM 666

Query: 142  -ASSTKNSHYIGKKIGEIIPELSRSR---SRSKTVQMSEASLD----QQPYHVLSVNLPH 193
               S   +   G    + I    R+       +   +    +D    QQ    +   + H
Sbjct: 667  EYVSENIADITGYAASQFIENRQRTFESLILEEDRALCHQHIDRALAQQETFEVEYRIRH 726

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GS+  ++ +      + +E     ++F                   ++K     L  +
Sbjct: 727  RDGSVRWVHEKG--KASYTDE--GFPLWFDGSID-----------DITESKLALVELESS 771

Query: 254  NICVETALSRGRCGL----WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +        C +    W    D     LS + Y ++G+  ++    F  IA  I  +
Sbjct: 772  RQQLTNITESIPCTVYQLRWISPVDRTFTFLSGAAYHMLGLHRDDLLKDFNIIAERIFDE 831

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A +   +   Q  + F  RH +G+  W++  A       G +   G  MD+TE
Sbjct: 832  ERSEVVRALAGKSEDKLQWVREFRYRHPNGSTRWMEAGASGHICDDGAIIWNGYVMDITE 891

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       + ++  +V  D    ++ CN  Y +  G     L   +   
Sbjct: 892  RKAMEEELAVSEAHFKALFDGSTIGIVNIDAKGVILDCNDQYCEDMGQSRESLCGMSIFE 951

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWC---THDGGTISVGTDITL 486
            ++             S  ++    ++  +LA+ R             +G  + +  +++ 
Sbjct: 952  VL-------------SLQDKETAKAQFKELAEGRVDHYRGERSFIRPNGEPLWMTVNVSA 998

Query: 487  LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
            L  +Q +   +   +                  TEL + + +  V KE A+ A+K K +F
Sbjct: 999  LFDSQKRFESAVVSMVDM---------------TELKLLSDELLVAKEEADAASKAKGDF 1043

Query: 547  LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
            LA MSHE+RTP+NAI+G S++  +    +    K   Y + I  + + LL++IN+IL+ S
Sbjct: 1044 LANMSHEIRTPMNAIIGMSQLCLQTELDK----KQKNYVEKIERASKSLLSIINDILDFS 1099

Query: 607  KIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKI 664
            KIE  K+ I+     L  ++ +   +    A  K +++   +   +      D   + ++
Sbjct: 1100 KIEAGKLDIESVPFQLDTMLEDLSDMFSEKAAHKQLELLFAVAPNVPRHLFGDSLRLGQV 1159

Query: 665  LFPILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPL 719
            L  +++N+IKFT   G++++  + + Q      +  ++ D+GIG+      K+ + F   
Sbjct: 1160 LINLMNNAIKFT-ERGEVLLSLNLVEQQNDDVVLRFSVRDSGIGLTAEQQAKLFKSFSQA 1218

Query: 720  HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
                 +  GG GLGLAI   L  L GG + + SQ G G+     
Sbjct: 1219 DTSTTRKYGGTGLGLAICKQLVELMGGTIGVESQFGHGSTFYFT 1262



 Score =  132 bits (331), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 53/423 (12%), Positives = 123/423 (29%), Gaps = 41/423 (9%)

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
           L      +     +  D+      +             +   +L+     L+  S+T+  
Sbjct: 487 LVSDTGELMSVEMLFTDVTE----QFSAAAWSNAVLEAAPEAMLIVDQMGLIVFSNTRCQ 542

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
              G +   ++  L       + ++ + A    Q           N+  +  + +     
Sbjct: 543 ILFGYEASAMLG-LQVESLLPEALRSNHARDRLQFLREGRDRPMANAKHVRALKADGGEF 601

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE-------TAL 261
                E+ L ++         +    +  R   +    +  + ++ +           A+
Sbjct: 602 VA---EIALSILPADNEGRRQVA---ASIRDMTQKLAVEQKIRDSELRFRGLVTNIPGAV 655

Query: 262 SRGRCG-LWNFNFDNKKFHLSRSMYEIMGIPYENK-TLSFRAIARLIHYDNKKICEIARS 319
            R R G +W         ++S ++ +I G           R    LI  +++ +C     
Sbjct: 656 YRTRIGDVWVME------YVSENIADITGYAASQFIENRQRTFESLILEEDRALCHQHID 709

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNII-GIAMDLTEKYHLEKRYA 378
                 +  +  + +RH  G+  W+  + +   T  G      G   D+TE         
Sbjct: 710 RALAQQETFEVEYRIRHRDGSVRWVHEKGKASYTDEGFPLWFDGSIDDITESKLALVELE 769

Query: 379 EADQRLSKAIECT----SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR--SIIQ 432
            + Q+L+   E       +   +   +      +       GL    L+         I 
Sbjct: 770 SSRQQLTNITESIPCTVYQLRWISPVDRTFTFLSGAAYHMLGLHRDDLLKDFNIIAERIF 829

Query: 433 DAQTRPIIEYRT--SDPERSQDMSKEIKLADS--RWLQ--INEWCTHDGGTIS--VGTDI 484
           D +   ++      S+ +         +  +   RW++   +     DG  I      DI
Sbjct: 830 DEERSEVVRALAGKSEDKLQWVREFRYRHPNGSTRWMEAGASGHICDDGAIIWNGYVMDI 889

Query: 485 TLL 487
           T  
Sbjct: 890 TER 892


>gi|75907252|ref|YP_321548.1| multi-sensor hybrid histidine kinase [Anabaena variabilis ATCC 29413]
 gi|75700977|gb|ABA20653.1| multi-sensor hybrid histidine kinase [Anabaena variabilis ATCC 29413]
          Length = 1820

 Score =  412 bits (1059), Expect = e-112,   Method: Composition-based stats.
 Identities = 133/778 (17%), Positives = 268/778 (34%), Gaps = 102/778 (13%)

Query: 66   SSIIKVTTRYAQ--QEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKT 123
                       Q   + +   T + L +         ++  D+  +K AE +L +   + 
Sbjct: 635  GRWSGEINFVRQDGSQGICETTIVALQDDQGQTVATISVNRDITERKHAELLLRRSEERF 694

Query: 124  RF---LSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
            +     S +   +   +  +   S            E+I          + +Q    ++ 
Sbjct: 695  QAFMNHSPTPAWITDIDGTIVYLSETYRRTFQLPTQELIGTNIFDIYPPELIQTFRETIQ 754

Query: 181  QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
                               ++ +   +           V  F I S     ++       
Sbjct: 755  IVARTHQ------------VMETVESVPCSDGTVRDFLVYKFPISSKPDECLIGGIAIDI 802

Query: 241  KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR 300
             + K+ +  L ++    +  +   +  +W++N    +   S    E++            
Sbjct: 803  TERKQAEAALRKSEERWQLVIEGNQDAIWDWNIITNETFRSARWAELIKEQNYQPIADHA 862

Query: 301  AIARLIHYDNKKICEIARS-VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM- 358
                 IH D+ +     R     + +      + +R    +  W+ V A       G   
Sbjct: 863  DCISRIHPDDYERVMAVRQDCLSRKIPNYVVEYRLRCNDDSYKWVLVHATGQWDERGNPV 922

Query: 359  NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL-WDKNDRLVMCNANYQKAYGL 417
             ++G   D+TE+   ++       R +  +E  ++ +    D  +          +A  +
Sbjct: 923  RMVGSIKDITERIEAQEALQRQLHR-TLLLEKITQKIRQSLDSKEIFETAATQIGQALAV 981

Query: 418  PDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGT 477
               ++    +          P++    +  +       E     +R +           +
Sbjct: 982  DRCLIHSYIS----HHDPHIPLVAEYNNVLDYCSMQKWEFTTTGNRHILQMMSQDKAIAS 1037

Query: 478  ISVGTD--------------------ITLLKHNQAQLRESKRRLKATINDLSTSRQILE- 516
             +V TD                    +      +        + K          ++LE 
Sbjct: 1038 ANVYTDPLLQTAVPSCCEIGVKSMLAVRTSYQGEPNGAICLHQCKYFRQWTPEEIELLEA 1097

Query: 517  -------------------RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTP 557
                               RQ+ EL+I N   +  K  AE AN+ KSEFLA MSHE+RTP
Sbjct: 1098 VAAQLGIALAQAQLLEQETRQREELTIKNFALEQAKRAAEAANRAKSEFLAMMSHEIRTP 1157

Query: 558  LNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDK 617
            +NA++G + ++         + +  ++ + +  SG  LL++IN+IL+ SKIE+ K+ +++
Sbjct: 1158 MNAVIGMTGLLLDTEL----TSQQRDFVETVLTSGDALLSIINDILDFSKIESGKLELEE 1213

Query: 618  QNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN--ADKRIIKKILFPILSNSIKF 675
            Q  ++   + + I L+ + A  K+I++   I  ++      D   +++IL  +L+N+IKF
Sbjct: 1214 QPFEVRTCVEQVIDLLAAKAAQKDIELAYLIHPQVPMQIAGDLTRLRQILTNLLNNAIKF 1273

Query: 676  TNNNGKMMIRTSKIGQ---------CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
            T   G++++                 +I TI DTGIGI    ++ + QPF        + 
Sbjct: 1274 TPE-GEVVVSVRSQPSPNQKTKNCCEIIFTIKDTGIGIAPETMDLLFQPFVQADASMTRK 1332

Query: 727  IGGFGLGLAISDALTNLHGGRLKIISQ--------EG-------------KGTIVTIC 763
             GG GLGL IS  L  + GG L + S+         G              G+     
Sbjct: 1333 YGGTGLGLVISKRLGEMMGGYLWVESRGCVGGNPPPGWQRKNSISSASVATGSTFYFS 1390



 Score =  153 bits (386), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/460 (11%), Positives = 131/460 (28%), Gaps = 34/460 (7%)

Query: 94  EIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGK 153
             +     I+ D++ +++AE+ L +       + +  I +      +   +       G 
Sbjct: 543 GQLSHFIGIQTDISDRQQAEASLRRQALTFENIYDGVI-ITNLQGQILDWNPAAERMFGY 601

Query: 154 KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
               I  +      + +      +++               SG I  +           +
Sbjct: 602 SKDHICGQSISILHKVEEDAALNSAI-----IAEITKQGRWSGEINFVRQDGS------Q 650

Query: 214 EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF 273
            +    +              S  R   + K  + +L  +    +  ++      W  + 
Sbjct: 651 GICETTIVALQDDQGQTVATISVNRDITERKHAELLLRRSEERFQAFMNHSPTPAWITDI 710

Query: 274 DNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFH 333
           D    +LS +      +P +    +   I  +   +  +       +  +  + ++ +  
Sbjct: 711 DGTIVYLSETYRRTFQLPTQELIGTN--IFDIYPPELIQTFRETIQIVARTHQVMETVES 768

Query: 334 MRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
           +  + G      V    + +      I GIA+D+TE+   E    ++++R    IE   +
Sbjct: 769 VPCSDGTVRDFLVYKFPISSKPDECLIGGIAIDITERKQAEAALRKSEERWQLVIEGNQD 828

Query: 394 ALVLWDKNDRLVMCNANYQKAY---GLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS 450
           A+  W+        +A + +               +  S I       ++  R     R 
Sbjct: 829 AIWDWNIITNETFRSARWAELIKEQNYQPIADHA-DCISRIHPDDYERVMAVRQDCLSRK 887

Query: 451 QD-MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
                 E +L             +D     V    T     +             I +  
Sbjct: 888 IPNYVVEYRL-----------RCNDDSYKWVLVHATGQWDERGNPVR-MVGSIKDITERI 935

Query: 510 TSRQILERQKTE---LSIANAKYQVEKERAETANKTKSEF 546
            +++ L+RQ      L     K +   +  E      ++ 
Sbjct: 936 EAQEALQRQLHRTLLLEKITQKIRQSLDSKEIFETAATQI 975



 Score =  125 bits (315), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 66/490 (13%), Positives = 143/490 (29%), Gaps = 63/490 (12%)

Query: 52  IPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKK 111
           +P + +V  +F A +  + +   +AQ  K++N     +         N  +   +  Q +
Sbjct: 260 LPTVVLVAGIFNAGAVTLLIY--FAQATKLSNHQIGRI---------NQELADRIEKQTQ 308

Query: 112 AESMLGQLLAKTRFLSESFILL---AQ-PNELVFASSTKNSHYIGKKIGEIIPELSRSRS 167
            E  L     + R L E+  ++        +       +    +   I +   E      
Sbjct: 309 VEIALRASENRLRELLETVRVIPWEVDLKTQHFTYVGPQAETLLAYPIAQWYEENFWDNH 368

Query: 168 RSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISA 227
                +                     +  +           +W  +V + VV       
Sbjct: 369 LHPHDRDW------AVRFCQEAANKGQNHELEYRMLAADGRVVWLRDV-VNVVEVDGTP- 420

Query: 228 LLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN---FDNKKFHLSRSM 284
               +L  +       K  +  L         AL+    G+   +    +    +++ + 
Sbjct: 421 ---VMLRGFMFDITDLKRVEETLRLRER----ALAASSNGIVISDAKLPNYPVIYVNSAF 473

Query: 285 YEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWI 344
            +I G              +      +   E  RS   K  K    I       G+  W 
Sbjct: 474 EQITGYKATEIVGRNCRFLQGNDTT-QPAIEELRS-ALKAGKNCKVILRNYRKDGSLFWN 531

Query: 345 QVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDR 403
           Q+    +   +G   + IGI  D++++   E          +   E   + +++ +   +
Sbjct: 532 QLSVSPIYNDNGQLSHFIGIQTDISDRQQAEASLRRQ----ALTFENIYDGVIITNLQGQ 587

Query: 404 LVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSR 463
           ++  N   ++ +G     +  G + SI+   +    +                      R
Sbjct: 588 ILDWNPAAERMFGYSKDHI-CGQSISILHKVEEDAALNSAIIAE----------ITKQGR 636

Query: 464 WLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE-- 521
           W     +   DG      T I  L+               T+  +S +R I ER+  E  
Sbjct: 637 WSGEINFVRQDGSQGICETTIVALQD----------DQGQTVATISVNRDITERKHAELL 686

Query: 522 LSIANAKYQV 531
           L  +  ++Q 
Sbjct: 687 LRRSEERFQA 696


>gi|110597007|ref|ZP_01385296.1| PAS:Response regulator receiver:GAF:ATP-binding region,
            ATPase-like:Histidine kinase A-like [Chlorobium
            ferrooxidans DSM 13031]
 gi|110341198|gb|EAT59663.1| PAS:Response regulator receiver:GAF:ATP-binding region,
            ATPase-like:Histidine kinase A-like [Chlorobium
            ferrooxidans DSM 13031]
          Length = 1407

 Score =  411 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 127/689 (18%), Positives = 258/689 (37%), Gaps = 52/689 (7%)

Query: 117  GQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKK-IGEIIPELSRSRSRSKTVQMS 175
             +LL ++ +     I      +     +  +S  +    +G    E +   SR    +  
Sbjct: 436  KKLLQQSGWEEGIKIF-----KRYRDWNRFDSDVLVFSSLGRFPGEFNAVLSRG-LSESM 489

Query: 176  EASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFS 235
            +   + +P+ V + +    SG I      +  +  + + V   V    I   ++   L+S
Sbjct: 490  QTDWEGRPWRVTAKSFKEVSGRITGKIIIMQDISAYNDRVYRLVSIAVISVIVIFTFLYS 549

Query: 236  YYRQAKKN-----KENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGI 290
            +            +  +  L+ +      A++    G+W++N  +   +LS    +++G 
Sbjct: 550  FLVVVLSRTDRSVRRREQELILSREQYMLAVNGSNDGIWDWNIRDNSLYLSPRWKKMIGY 609

Query: 291  PYENKTLSFRAIARLIHYDNKKICEIARSV-TGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
                    +      +H D+    +          V      F  RH +G  +W+  + +
Sbjct: 610  EDHELPNIYATFEERVHPDDLPEYKNFLERYLKGEVPVFSVEFRFRHRNGEYLWLLAKGE 669

Query: 350  MMRTISG-GMNIIGIAMDLTEKYHLEKRYAEAD------------------QRLSKAIEC 390
             +R   G    + G   D++    +E+                        + L  +I+ 
Sbjct: 670  ALRDKDGLPYRMAGSHSDISGSKKIEEELKRRSAFQLVLMDLAIGFINKPIEDLDNSIKS 729

Query: 391  TSEALVLWDKNDRLVMCNANYQ-KAYGLPDHVLVPGNARSII----QDAQTRPIIEYRTS 445
                +  + + DR+ + + +++ ++         PG    I           P +     
Sbjct: 730  ALALVGEFARVDRVYLFSYDFENRSMSNTHEWCAPGINAEIQNLQNLPTAAMPELVASHR 789

Query: 446  DPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATI 505
               R   +    ++ +    +           I++  +              +       
Sbjct: 790  Q-GRVVHIPDVKEMPEESAFRALLEPQGIQSLITIPLNYGEQCFGFVGFDAVRSLKIWAD 848

Query: 506  NDLSTSR--QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILG 563
            +DLS  R    L                 +  +E+AN+ KSEFLA MSHE+RTP+N ++G
Sbjct: 849  DDLSLLRVLAELFTNAEVRHRHETALVEARYASESANRAKSEFLANMSHEIRTPMNGVIG 908

Query: 564  FSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLI 623
             + ++         S +   YAQ +  S   LL +IN+IL+ SKIE  K  ++  + DL 
Sbjct: 909  MTGLLLDTSL----SDEQRGYAQAVMESADFLLGLINDILDFSKIEAGKFELEMLDFDLR 964

Query: 624  PIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGK 681
             ++++   ++   A+ K ++       E+      D   + ++L  +  N+IKFT+  G+
Sbjct: 965  NVLDDVSSIMAVRARDKELEFICAASPEVTPFLRGDPGRLYQVLNNLAGNAIKFTHQ-GE 1023

Query: 682  MMIRT-----SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAI 736
            + +       S     +  ++ DTGIGIP+  +  +   F  +     +  GG GLGLAI
Sbjct: 1024 VAVSVALVSGSAQEDLLRFSVRDTGIGIPEQKIAILFSSFTQVDASTTRKFGGTGLGLAI 1083

Query: 737  SDALTNLHGGRLKIISQEGKGTIVTICMP 765
            S  L  L GG + + S+E +G+     +P
Sbjct: 1084 SRQLVELMGGEIGVSSRENEGSEFWFTIP 1112


>gi|254465258|ref|ZP_05078669.1| multi-sensor hybrid histidine kinase [Rhodobacterales bacterium
           Y4I]
 gi|206686166|gb|EDZ46648.1| multi-sensor hybrid histidine kinase [Rhodobacterales bacterium
           Y4I]
          Length = 985

 Score =  411 bits (1056), Expect = e-112,   Method: Composition-based stats.
 Identities = 127/646 (19%), Positives = 243/646 (37%), Gaps = 72/646 (11%)

Query: 157 EIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
           +      +    +  +   +  L      V S  L                L   R  + 
Sbjct: 218 DGTGAAGQQFLGTAEIPAGDPVLMDINLPVGSWQLAARPAGGWQAQP--GNLWQLRLALL 275

Query: 217 LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
                    + L   +  +      + +  +  L   +  +E A+   R G+W  +  NK
Sbjct: 276 AAGTLIVFPTFLAGRLSAARQTVIGQLRRREAELEAVSRRLEIAVKTSRVGIWECDAGNK 335

Query: 277 KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRH 336
           +      M+E+ G+P E   L+  A    +H  ++     +     +        F +  
Sbjct: 336 RVSWDSRMHELYGVPREQGPLAGSAWIAKLHPQDRDRVVKSLEAAERSKSNFASEFRILL 395

Query: 337 ASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK---------- 386
             G+   I+  A       G   +IG+  +++E   L +    A+Q LS+          
Sbjct: 396 DDGSVKHIRALASPFTDTQGRSWMIGVNWNVSEDVRLREELIHANQALSERNTELKEGKR 455

Query: 387 ---------------------AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG 425
                                  +  S++++L D + +++  N  + +A G      +  
Sbjct: 456 ALEDAHAELQKQQAELHRLSLVAKHASDSIILTDASRKILWVNDAFTRATGYSAGEAIGR 515

Query: 426 NARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINE--WCTHDGGTISVGTD 483
               ++    T   +    +            +  D      NE    T  G  +   T+
Sbjct: 516 TPSDLLDGPDTDLSVVREMN------------RHKDGGIRYHNEVLNYTKSGEEVWFDTN 563

Query: 484 ITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTK 543
           I  +                  +        +ER  T       +    K  AE A++ K
Sbjct: 564 IVPVTGA---------------DGEVDLIIGIERDITRSKQRERELAEAKLAAEHADRAK 608

Query: 544 SEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL 603
           SEFLA MSHE+RTP+N I+G ++++ +            +  + I  S Q LL +IN+IL
Sbjct: 609 SEFLANMSHEIRTPMNGIIGMADLLAEAELTADD----QQNVETIRSSAQALLKIINDIL 664

Query: 604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRII 661
           ++S++E  K +I +++ +L   I     L    A  K + ++    + L    + D   +
Sbjct: 665 DLSRLEAGKFAISREDFNLRDCIGGAADLFRPKALEKGLSMQVSYANGLPDRLHGDDGRL 724

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQ---CVIITIADTGIGIPKSALEKIGQPFEP 718
           ++IL  ++ N++KFT + GK+ +R S+ G+    +++ + D+GIGI ++  + I   F  
Sbjct: 725 RQILVNLIGNAVKFTPD-GKIAVRVSQAGEDPCRLVVEVEDSGIGISETQAKHIFDRFTQ 783

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
                 ++ GG GLGL IS  L    GG + + SQ GKG+   + +
Sbjct: 784 ADAATTKAFGGTGLGLTISSMLAKRMGGGITVQSQPGKGSCFRLEL 829



 Score = 58.8 bits (141), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 28/255 (10%), Positives = 68/255 (26%), Gaps = 25/255 (9%)

Query: 21  KITVSSKQAFKRAYTSIISHLFSFFSSFN--------QTIPMISMVFLVFIATSSIIKV- 71
           K+    +    ++  +      +F S F         + I  ++  F      S +I V 
Sbjct: 364 KLHPQDRDRVVKSLEAAERSKSNFASEFRILLDDGSVKHIRALASPFTDTQGRSWMIGVN 423

Query: 72  --TTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSES 129
              +   +  +     +  L+E    + +      D  ++ + +      L+     +  
Sbjct: 424 WNVSEDVRLREELIHANQALSERNTELKEGKRALEDAHAELQKQQAELHRLSLVAKHASD 483

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
            I+L   +  +   +   +   G   GE I              +S      +       
Sbjct: 484 SIILTDASRKILWVNDAFTRATGYSAGEAIGRTPSDLLDGPDTDLSVVREMNRHKDGGIR 543

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
                               +W +   + V            ++    R   ++K+ +  
Sbjct: 544 YHNEVLNYTKSGEE------VWFDTNIVPVTGADGEVD----LIIGIERDITRSKQRERE 593

Query: 250 LLEANICVETALSRG 264
           L EA    + A    
Sbjct: 594 LAEA----KLAAEHA 604


>gi|294495114|ref|YP_003541607.1| PAS/PAC sensor signal transduction histidine kinase
            [Methanohalophilus mahii DSM 5219]
 gi|292666113|gb|ADE35962.1| PAS/PAC sensor signal transduction histidine kinase
            [Methanohalophilus mahii DSM 5219]
          Length = 1034

 Score =  410 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 142/648 (21%), Positives = 256/648 (39%), Gaps = 61/648 (9%)

Query: 129  SFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMS-----EASLDQQP 183
              I+ A         S  +   +G+   E++ +          +        +     + 
Sbjct: 431  DVIIEADVEGRYTYISPSHQRVLGR-GKELLGKNCMKDLHPDDIDFVASIFKKIVETGEQ 489

Query: 184  YHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKN 243
             H     L  + G I + +     +    ++  L                    R   + 
Sbjct: 490  QHAEYRYLHPDKGYIWLGSVATSYVDENGQKRVLINT-----------------RDVTER 532

Query: 244  KENDTILLEANICVETALSRGRCGLWNFNFDNKK----FHLSRSMYEIMGIPYENKTLSF 299
            KEN+  + +     +T     +  ++     +         +R+     G          
Sbjct: 533  KENEEEIKKLTEEYQTVFQGTQDSMFLIEVTDDNEFRYMRNNRAHQVSTGFTSAYFRGKT 592

Query: 300  RAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMN 359
                      ++                +     +   +G  +W Q     +        
Sbjct: 593  PQELAGKKTGDQ--LSANYKRCIDSNDTVSYEETLEFPAGTRMW-QTALTPIFQHGEVRY 649

Query: 360  IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPD 419
            I+G + D+T +   E    ++ Q+    +E  +E +   D+N  +     N +   G   
Sbjct: 650  IVGSSQDITGRIKAENELRQSKQKYQSLVENLNEIVYTLDQNATVTYVTPNIENISGYKP 709

Query: 420  HVLVPGNARSIIQDAQ---TRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCT-HDG 475
              ++  N    +                S  +   +     K  D+ W++ N      D 
Sbjct: 710  EEVIGKNFVEFVHPDDIRGRMEQFRKVLSGIDEPSEYRFLTKSGDTVWVRTNAKPIIKDD 769

Query: 476  GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKER 535
              + +   +  +                           +++ + +L  A  +      +
Sbjct: 770  KIVGIQGLLMDIT-------------------------DVKKAEKQLEDAVLRANEMAIQ 804

Query: 536  AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
            AE ANKTKS+FLA MSHELRTPLN+++GFS+++ KEI GEL      +Y  +I   G+HL
Sbjct: 805  AEYANKTKSQFLANMSHELRTPLNSVIGFSDILLKEIKGELN-DSQKKYISNISNGGRHL 863

Query: 596  LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN 655
            L++IN+IL++SKIE  K+ +  ++ +L  + +E   +I   AQ K+I +E   P+++  N
Sbjct: 864  LDLINDILDLSKIEAGKMELACEDLNLDSVFSEIESVISPQAQKKSIDLEISKPADIEIN 923

Query: 656  ADKRIIKKILFPILSNSIKFTNNNGKMMIRT-SKIGQCVIITIADTGIGIPKSALEKIGQ 714
            ADK  IK+I+F +LSN+IKFT+ NGK+ +         V IT+ DTGIGIP+  L+KI  
Sbjct: 924  ADKSKIKQIIFNLLSNAIKFTDENGKVSMSAGEVDRDQVEITVKDTGIGIPEDKLDKIFD 983

Query: 715  PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
            PF    +   +  GG GLGL +      +HGG + + S+ GKG++ T+
Sbjct: 984  PFMQADSSTSRKYGGTGLGLPLVKEYVEMHGGEILVESEVGKGSVFTL 1031



 Score = 77.7 bits (190), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 40/370 (10%), Positives = 99/370 (26%), Gaps = 53/370 (14%)

Query: 121 AKTRFLSESFILLAQPNE-----LVFASSTKNSHY--------IGKKIGEIIPELSRSRS 167
            K  F      ++   N           +              + K + E++PE      
Sbjct: 10  EKDSFAYARHKIILDENGKPVNYRFLDVNPTFEDMTDLKKENILNKTVTEVLPE-IVEDD 68

Query: 168 RSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISA 227
                     +L  +  +    +L       + + S          E    V  FS++S 
Sbjct: 69  FDWIALFGHVALTGEDINFTHYSLALGQWYQIYVQS---------SEKGYFVTLFSVLSQ 119

Query: 228 LLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEI 287
                         + K  +     +               ++        +++++  ++
Sbjct: 120 N-------------EAKFYEFAERSSEPIYR----------YDLIPRPGYTYVNKATTQM 156

Query: 288 MGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD--QIFHMRHASGADIWIQ 345
            G   E      +   +++H ++K++              +D        H  G  +W +
Sbjct: 157 DGYTPEEHYRDPQLAIKIVHPEDKQLFLDYFE----GKIPIDKRIQLRWVHKKGQTVWFE 212

Query: 346 VRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRL 404
              + +   +G  + + GI  D+T+    ++R       L          +   D N  +
Sbjct: 213 YVNKPVYDSNGNLIAVEGIGRDITDMKIAQEREQHIKDVLLSIRNVNKMIVKEHDPNRVI 272

Query: 405 VMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRW 464
                N  +  G     +   +    +  A +         +  + Q           + 
Sbjct: 273 QKACNNLTETLGYYSAWIALVDDEKNVISAASSFSDFASVFERLKGQLKEGIFPQCMQQV 332

Query: 465 LQINEWCTHD 474
           L+ +E    D
Sbjct: 333 LEKDEILIMD 342


>gi|148263292|ref|YP_001229998.1| PAS/PAC sensor signal transduction histidine kinase [Geobacter
           uraniireducens Rf4]
 gi|146396792|gb|ABQ25425.1| PAS/PAC sensor signal transduction histidine kinase [Geobacter
           uraniireducens Rf4]
          Length = 637

 Score =  410 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 121/663 (18%), Positives = 247/663 (37%), Gaps = 64/663 (9%)

Query: 108 SQKKAESMLGQLLAK-TRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSR 166
            +K+ E      L +     S S I + +P+  V   ++     IG    E I +     
Sbjct: 32  ERKQMEEAESYALLRVMFDQSSSLISVLKPDGTVLDINSSAFDVIGGTKSEAIGKPFWET 91

Query: 167 SRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIIS 226
                    +  L Q               S    +       ++ +     V       
Sbjct: 92  LAWVHSPELQERLRQAIKSAAQ----GEFVSFEATHPTADGKLIYVDFSLKPVKDDDGN- 146

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF--NFDNKKFHLSRSM 284
              + +L    R   K +E +  L E  +             W F  +  ++  + S S 
Sbjct: 147 ---VVLLLPEGRDITKRREAEEALREVAVKYRIVADNTY--NWEFWLSPADRFIYTSPSC 201

Query: 285 YEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWI 344
             I G   E        +  +IH D++ +    R    +     +    +    G   W+
Sbjct: 202 RRISGHGAEEFNADPGLLRSIIHPDDRHLWTDHRHDITQTKALGELELRIVRPDGDIRWV 261

Query: 345 QVRAQMMRTISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDR 403
                 +   +G      G   D+TE+   E++    + RL+  +E + +A+V    +  
Sbjct: 262 HHVCIPVFDDNGNHLGTRGSFSDITERKQAEEK----NLRLAVMVESSDDAIVGKTLDGI 317

Query: 404 LVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSR 463
           +   N   +K +G  +  ++ G   +++  A+    +            M + ++  +  
Sbjct: 318 ITSWNRGAEKIFGYSEDEVL-GKPITMLIPAENVDEVLQ----------MDERLRHGEHI 366

Query: 464 WLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELS 523
                     DG  I +    + ++                      +   + R  TE  
Sbjct: 367 EHFETVRRRKDGQLIHMSLSYSPIRDA---------------QGRVVAVSTIGRDITERK 411

Query: 524 IANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYE 583
                              K E ++ +SHE+RTPL A+LG++E +      E+ + +  E
Sbjct: 412 EMEQ--------------MKDEMISAVSHEMRTPLTAMLGYTEFMLD---NEVPADQQRE 454

Query: 584 YAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK 643
           Y +   +  + L  +I N L++ ++ + K ++  +   L P++ E + L    ++  +I 
Sbjct: 455 YLRITLHESEKLNELIGNFLDLQRLRSRKETVTWRPLPLQPLLEETVALFTRVSERHHIT 514

Query: 644 IEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGI 702
           +    PS+L     D + ++++   ++SN++K++   G + +   +   CV+IT+ D GI
Sbjct: 515 L--DCPSDLPRICGDNKQLRQVFNNLVSNAVKYSPKGGAVRVAARREKDCVVITVRDEGI 572

Query: 703 GIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           GI   A+E+I + F  ++N   +  GG GLGLA+   +   HGG + + S  GKG+   +
Sbjct: 573 GISPQAVERIFERFYRVNNTACRVFGGTGLGLALVREIVTAHGGEVWVESTLGKGSTFFV 632

Query: 763 CMP 765
            +P
Sbjct: 633 SLP 635



 Score = 95.0 bits (235), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/286 (14%), Positives = 84/286 (29%), Gaps = 27/286 (9%)

Query: 103 KFDLASQKKAESMLGQLLAKTRFLSESFI---LLAQPNELVFASSTKNSHYIGKKIGEII 159
             D+  +++AE  L ++  K R ++++         P +    +S       G    E  
Sbjct: 154 GRDITKRREAEEALREVAVKYRIVADNTYNWEFWLSPADRFIYTSPSCRRISGHGAEEFN 213

Query: 160 --PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTL 217
             P L RS        +                L      + I+     +    R    +
Sbjct: 214 ADPGLLRSIIHPDDRHLWTDHRHDITQTKALGEL-----ELRIVRPDGDI----RWVHHV 264

Query: 218 EVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKK 277
            +  F      L       +    + K+ +    E N+ +   +      +     D   
Sbjct: 265 CIPVFDDNGNHLGTR--GSFSDITERKQAE----EKNLRLAVMVESSDDAIVGKTLDGII 318

Query: 278 FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ--IFHMR 335
              +R   +I G   +        I  LI  +N            +H + ++       R
Sbjct: 319 TSWNRGAEKIFGYSEDEVLGKP--ITMLIPAENVDEVLQMDERL-RHGEHIEHFETVR-R 374

Query: 336 HASGADIWIQVRAQMMRTISGGMNIIGIA-MDLTEKYHLEKRYAEA 380
              G  I + +    +R   G +  +     D+TE+  +E+   E 
Sbjct: 375 RKDGQLIHMSLSYSPIRDAQGRVVAVSTIGRDITERKEMEQMKDEM 420


>gi|192360517|ref|YP_001982372.1| putative sensory box histidine kinase/response regulator
           [Cellvibrio japonicus Ueda107]
 gi|190686682|gb|ACE84360.1| putative sensory box histidine kinase/response regulator
           [Cellvibrio japonicus Ueda107]
          Length = 1232

 Score =  409 bits (1052), Expect = e-112,   Method: Composition-based stats.
 Identities = 128/722 (17%), Positives = 263/722 (36%), Gaps = 55/722 (7%)

Query: 54  MISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQ-KKA 112
            I+ +    +  +  +     +  +    +    ++  A  +      +  +L  + ++ 
Sbjct: 221 AIAGMHYTGMGAARFMGEPGGHLVESSENHGLLAIIISATTLALSMLALAGNLVLRYRQL 280

Query: 113 ESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRS 169
            + L    ++ R +   +   I+       + A +       G    EI     +     
Sbjct: 281 YNQLLNSESRLRAIVDTAVDGIITIDSQGKILAMNNAAEQLFGWTPAEIEQRNIKMLMPE 340

Query: 170 KTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALL 229
                          H   ++    +G+  II +   ++ L ++   + V      + L 
Sbjct: 341 PYHSE----------HDSYLHNYAKTGNARIIGTGREVVALHKDGRQIPVRLAVGKAELP 390

Query: 230 L-FILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDN--KKFHLSRSMYE 286
              +   +       K  +  L        T +S      +  +         +S ++  
Sbjct: 391 GQTLFVGFVSDISVRKSMERELRTREQQYRTLISNIPGIAFRSHLVAPWNMIFISDAVQR 450

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           + G P  +       +  L+H D+        +      +     + + H  G++ W+  
Sbjct: 451 VTGWPASDFMSGHVTMGDLLHPDDVARINAQVTDALSRKRSYTCEYRVIHRDGSEHWVSE 510

Query: 347 RAQMMRTISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLV 405
            A  +   +G    I G+ MD+TE     +R  E +  +      +  A+  +D +  ++
Sbjct: 511 TASGVYDETGTPIWIDGVIMDITESK---RRAHEFEGVVEAIGRAS--AVAEFDMDGTII 565

Query: 406 MCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWL 465
             N N+ K  G   + L+  + R +    +       +              +  +  ++
Sbjct: 566 GVNENFLKLTGYHKNELLGRHHRILCMPEEAASEDYQQFWQDLNRG----IFRSGEFCYI 621

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
             NE        I V    T +     +  +                  +    +E    
Sbjct: 622 DCNENP------IWVQAIYTPIFDVDGKPWKIF---------------TIASDLSERKAM 660

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
                  KERAE A+  K  FLA MSHE+RTP+NAI+GF+E++       +      ++ 
Sbjct: 661 EQDLVAAKERAEQASIAKGMFLANMSHEIRTPMNAIIGFTELLLDSALDPV----QLKHM 716

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           Q +  S + LL ++N+IL+ +K+E   + +D     L  +  + +  +   A  K + + 
Sbjct: 717 QTVRQSARSLLGLLNDILDTAKLERGALELDMHVFSLKQLCQQIMAELQIQADKKGLGLH 776

Query: 646 KKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIG 703
                        D+  I+++L  +L N+IKFT   G++ +    +G+ V + + DTGIG
Sbjct: 777 LDYVHTTPDQVLGDELRIRQVLVNLLGNAIKFTLT-GEVRLSVDVLGEGVRMQVQDTGIG 835

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           I    +E I  PF        +  GG GLG  I+  LT L GG++ + S EG+G+   + 
Sbjct: 836 IAVERIEHIFTPFTQADASMARRFGGTGLGTTIARQLTELMGGKISVTSVEGQGSCFVVW 895

Query: 764 MP 765
           +P
Sbjct: 896 LP 897


>gi|126656724|ref|ZP_01727938.1| Multi-sensor Hybrid Histidine Kinase [Cyanothece sp. CCY0110]
 gi|126621944|gb|EAZ92652.1| Multi-sensor Hybrid Histidine Kinase [Cyanothece sp. CCY0110]
          Length = 1302

 Score =  409 bits (1051), Expect = e-112,   Method: Composition-based stats.
 Identities = 139/675 (20%), Positives = 262/675 (38%), Gaps = 57/675 (8%)

Query: 105  DLASQKKAESMLGQLLAKTRFLSES-------FILLAQPNEL-----VFASSTKNSHYIG 152
            D++ +K+AE  L     + R L ES         +L  P+          ++       G
Sbjct: 525  DISDRKQAEEALRHSEERYRTLFESMSEGFCVIKMLFDPDNQPIDYCFLETNPAFEQQTG 584

Query: 153  KKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
              + + + + +R               D +P+   +      +G  +       ++  W 
Sbjct: 585  --LSQAVGKTARQLLP-----------DLEPHWFETYGKVALTGESIRFEHGSDVMARWF 631

Query: 213  EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
            +     +         +L      + +  + K+ +  L E  +   T         W  N
Sbjct: 632  DVSAFRIGLPEEGKVAIL------FEEISERKQTERKLQENALRFHTLADNISQFAWMAN 685

Query: 273  FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
                 F  ++  ++  G   E          ++ H D+ K      +      +  + +F
Sbjct: 686  EQGWIFWYNQRWFDYTGTNLEEMQG--WGWQKVHHPDHVKRVTEKINQCFATGEIWEDMF 743

Query: 333  HMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
             +R  +G   W   RA  +R   G +    G   D+TE    E    ++++R     E  
Sbjct: 744  PLRSKTGEYRWFLSRAIPIRDEQGKVLRWFGTNTDITELREAENALRQSEERYRCLTESI 803

Query: 392  SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ 451
             + +   ++   L+  N  + +  GL           +++       + E  T   +R  
Sbjct: 804  PQLVWTANREGELLDVNQRWIEFTGLSLEQARADGWEAVVHPEDLPVLREQWTEAVQRGT 863

Query: 452  DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
                E ++              DG             +   ++    +      +     
Sbjct: 864  PYQAEGRM-----------RRMDGTYRWFLHQAIPQGNEPGKMI---KWYGTATDIDVQK 909

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            +  LER         A+ Q  +E AE AN+ K EFLA +SHELR+PLN ILG+S++++  
Sbjct: 910  QLELERD-----RLLAQEQAAREVAERANRIKDEFLAVLSHELRSPLNPILGWSQLLQ-- 962

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
               +L   +  E    I  + +    +I+++L+++KI   K+S+   + +L   I   I 
Sbjct: 963  -VRKLDEAQTAEALHTIERNAKLQTQLIDDLLDVAKILQGKLSLTMTSVNLAKTIEAAIE 1021

Query: 632  LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
             +  +A+SK+I +E ++P+    + D+  +++I++ +LSN IKFT + G++ I   ++G 
Sbjct: 1022 TVKQTAKSKSIALESQLPNIGQVSGDEARLQQIVWNLLSNGIKFTPSGGQVKIHLKRVGS 1081

Query: 692  CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
               I + DTG GI    L  I + F        +  GG GLGLAI   L   HGG ++  
Sbjct: 1082 YAEILVKDTGKGISPDFLPHIFESFRQEDASITRKFGGLGLGLAIVSQLVEAHGGTIRAE 1141

Query: 752  SQ-EGKGTIVTICMP 765
            S  EG G   T+ +P
Sbjct: 1142 SPGEGLGATFTVQLP 1156



 Score =  188 bits (477), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 56/462 (12%), Positives = 136/462 (29%), Gaps = 46/462 (9%)

Query: 81  MTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELV 140
               T   L  A+    +N  +K +L   ++++      +         F  +      +
Sbjct: 107 KHRTTPDDLCLAMRTAIENAELKQEL---QRSQETFRTSVENMLDCFGIFSAMRDDLGKI 163

Query: 141 F-----ASSTKNSH--------YIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVL 187
                   +              IG+ + EI+P     R      +        +P    
Sbjct: 164 VDFRIDYLNEAACQNNQMPKAMQIGRGLCEILP---AHRQSGLFDEYCRVVETGKPLIKD 220

Query: 188 SVNLPHNSGSILIINSRV--------PLLRLWREEVTLEVVFFSIISALLLFILFSYYRQ 239
           S+      G   +I +            +  WR+      +   +   +           
Sbjct: 221 SLIYDDTYGDRRLIRAFDIRASKLNDGFVASWRDVTAHRQLELELNQTIT---------H 271

Query: 240 AKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSF 299
             ++++    L ++   +  A+     G W++N    + + S ++  + G+   +   ++
Sbjct: 272 INQHQQTTLALQQSQERLNLAMKAASMGSWDWNIQTGEVNWSSNLENLFGMSPGSFDGTY 331

Query: 300 RAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM- 358
             +  +IH ++    E A      + ++ +  F      G+  W     ++     G   
Sbjct: 332 ETVRAMIHPEDLPKVEQALQRALYNREEYNIEFRFIKPDGSLRWALGLGRVFYDDEGNPI 391

Query: 359 NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLP 418
            + G+ MD++ +  +E     ++ +L    +     + + D        N  +    G  
Sbjct: 392 MMTGVDMDISHRKQIETALRASETKLRGMTDNAPVMIWVTDSTGSCTYLNQRWYDFTGQR 451

Query: 419 DHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADS----RWLQINEWC--- 471
           +   +       +    +           E+ +    E +L        W          
Sbjct: 452 EATALGFGWLDAVHPEDSEAARGIFLKANEKHESFRLEYRLRHHSGQYHWAIDAAHPWFG 511

Query: 472 --THDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
                 G I    DI+  K  +  LR S+ R +     +S  
Sbjct: 512 ENGKFKGYIGAVIDISDRKQAEEALRHSEERYRTLFESMSEG 553



 Score =  140 bits (352), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 60/439 (13%), Positives = 138/439 (31%), Gaps = 33/439 (7%)

Query: 82  TNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFL---SESFILLAQPNE 138
              +   +T   ++  + N     +   ++    L Q   +       +           
Sbjct: 248 FVASWRDVTAHRQLELELNQTITHINQHQQTTLALQQSQERLNLAMKAASMGSWDWNIQT 307

Query: 139 LVFASSTKNSHYIGKKIGEIIP--ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSG 196
                S+   +  G   G      E  R+    + +   E +L +  Y+    N+     
Sbjct: 308 GEVNWSSNLENLFGMSPGSFDGTYETVRAMIHPEDLPKVEQALQRALYNREEYNIE---- 363

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
                   +      R  + L  VF+      +  ++          K+ +T L  +   
Sbjct: 364 -----FRFIKPDGSLRWALGLGRVFYDDEGNPI--MMTGVDMDISHRKQIETALRASETK 416

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           +          +W  +      +L++  Y+  G   E   L F      +H ++ +    
Sbjct: 417 LRGMTDNAPVMIWVTDSTGSCTYLNQRWYDFTG-QREATALGFG-WLDAVHPEDSEAARG 474

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMN-IIGIAMDLTEKYHLEK 375
                 +  +     + +RH SG   W    A      +G     IG  +D++++   E+
Sbjct: 475 IFLKANEKHESFRLEYRLRHHSGQYHWAIDAAHPWFGENGKFKGYIGAVIDISDRKQAEE 534

Query: 376 RYAEADQRLSKAIECTSEALVL----WDKNDR-----LVMCNANYQKAYGLPDHVLVPGN 426
               +++R     E  SE   +    +D +++      +  N  +++  GL     V   
Sbjct: 535 ALRHSEERYRTLFESMSEGFCVIKMLFDPDNQPIDYCFLETNPAFEQQTGLS--QAVGKT 592

Query: 427 ARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCT---HDGGTISVGTD 483
           AR ++ D +      Y            +      +RW  ++ +      +G    +  +
Sbjct: 593 ARQLLPDLEPHWFETYGKVALTGESIRFEHGSDVMARWFDVSAFRIGLPEEGKVAILFEE 652

Query: 484 ITLLKHNQAQLRESKRRLK 502
           I+  K  + +L+E+  R  
Sbjct: 653 ISERKQTERKLQENALRFH 671



 Score =  136 bits (343), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/298 (12%), Positives = 89/298 (29%), Gaps = 20/298 (6%)

Query: 102 IKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSHYIGKKIGEI 158
           +  +++ +K+ E  L +   +   L+++      +A     +F  + +   Y G  + E+
Sbjct: 649 LFEEISERKQTERKLQENALRFHTLADNISQFAWMANEQGWIFWYNQRWFDYTGTNLEEM 708

Query: 159 IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
                +       V+     ++Q                 +           +R  ++  
Sbjct: 709 QGWGWQKVHHPDHVKRVTEKINQCFA-------TGEIWEDMF--PLRSKTGEYRWFLSRA 759

Query: 219 VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
           +        +L    F       + +E +  L ++              +W  N + +  
Sbjct: 760 IPIRDEQGKVL--RWFGTNTDITELREAENALRQSEERYRCLTESIPQLVWTANREGELL 817

Query: 279 HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS 338
            +++   E  G+  E           ++H ++  +     +   +          MR   
Sbjct: 818 DVNQRWIEFTGLSLEQARADG--WEAVVHPEDLPVLREQWTEAVQRGTPYQAEGRMRRMD 875

Query: 339 GADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLE---KRYAEADQRLSKAIECTS 392
           G   W   +A       G M    G A D+  +  LE    R    +Q   +  E  +
Sbjct: 876 GTYRWFLHQAIPQGNEPGKMIKWYGTATDIDVQKQLELERDRLLAQEQAAREVAERAN 933


>gi|172060290|ref|YP_001807942.1| multi-sensor hybrid histidine kinase [Burkholderia ambifaria
           MC40-6]
 gi|171992807|gb|ACB63726.1| multi-sensor hybrid histidine kinase [Burkholderia ambifaria
           MC40-6]
          Length = 989

 Score =  409 bits (1051), Expect = e-111,   Method: Composition-based stats.
 Identities = 134/666 (20%), Positives = 246/666 (36%), Gaps = 48/666 (7%)

Query: 112 AESMLGQLLAKTRF---LSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSR 168
           AE  L +   +           +L    +  V   +       G    E           
Sbjct: 129 AERRLRESEQRYAITLSSIGDGVLSTDVDGFVTFVNLAGEALTGWSRSEATGRRLGEVFS 188

Query: 169 SKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISAL 228
                      D     + +V    + G +                              
Sbjct: 189 LHDENTHAPIED----PMAAVLQTGSDGGLPARAILRARGGSDLPVECTGTPMTDERGVR 244

Query: 229 LLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK-----KFHLSRS 283
              ++       K+  +   IL E N  +E A+     G+W  +             S +
Sbjct: 245 QGIVIVFRDVTQKRRAQEAEILRETNARLEMAMYGSNVGVWEIDMPEGDHKRGFARYS-N 303

Query: 284 MYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ-LDQIFHMRHASGADI 342
           +YE +G       L + A   ++H D++   + A +   +      +    +RH  G D 
Sbjct: 304 IYEWLGFDTPQARLDYEAYMSVLHPDHRDSTDRAVASFLESGDGLFELENRLRHRDGTDR 363

Query: 343 WIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKN 401
           W+ VR    R   G     +G  +D+TE    E+    +++R     E  +  +   D +
Sbjct: 364 WVLVRGTARRDAMGKPVRFVGSLVDITELKMTEQALRASEERFRGTFENAAVGVAHCDLD 423

Query: 402 DRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLAD 461
            R +  N    +  G P   L       +I    +   IE      E       E     
Sbjct: 424 GRFLRVNHRSGEIVGWPRDALQHRRLHDLIHADFSVASIERFRLLTEGKLKHYSE----- 478

Query: 462 SRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
                       DG  + V   + L                   +  +    ++ +  +E
Sbjct: 479 -----EVPLVRFDGERVWVTLSVALQHDA---------------SGQTAHVIVIIQDISE 518

Query: 522 LSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKY 581
                   +V K+ AE A++ K +FLA +SHELRTPLN ILG+++++++++  +    + 
Sbjct: 519 RKALEETVRVAKDAAEAASRAKDQFLANISHELRTPLNGILGYAQILQRDVRLDT---RQ 575

Query: 582 YEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKN 641
                 I  SGQHLL +IN+IL+ +++   K+ +      L   +     ++   AQ K 
Sbjct: 576 LASVGVIEQSGQHLLTLINDILDFARLGAGKLELQVGEVPLRGFLETIAEIVAVRAQQKR 635

Query: 642 IKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK-IGQCVIITIA 698
           + +      +L      D+R ++++L  +L+N+++FT + G++ +  S+     +   + 
Sbjct: 636 LVLNYVAAPDLPAVVRVDERRLRQVLLNLLANAVQFT-DRGEVTLSVSRGAAGRLRFEVR 694

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           DTGIG+    LE I QPFE     + +  GG GLGLAIS  L  + GG +++ S  G+G+
Sbjct: 695 DTGIGVSADRLEAIFQPFEQA-GDHTRRSGGAGLGLAISQQLVRMMGGEIEVTSSAGEGS 753

Query: 759 IVTICM 764
           +    +
Sbjct: 754 VFGFEL 759



 Score = 51.5 bits (122), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 42/159 (26%), Gaps = 10/159 (6%)

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           K+  E+R  E++QR +  +    + ++  D +  +   N   +   G             
Sbjct: 126 KHGAERRLRESEQRYAITLSSIGDGVLSTDVDGFVTFVNLAGEALTGWSRSEATGRRLGE 185

Query: 430 I--IQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLL 487
           +  + D  T   IE   +   ++          D             G  + V    T +
Sbjct: 186 VFSLHDENTHAPIEDPMAAVLQTGS--------DGGLPARAILRARGGSDLPVECTGTPM 237

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIAN 526
              +   +      +            + R+        
Sbjct: 238 TDERGVRQGIVIVFRDVTQKRRAQEAEILRETNARLEMA 276


>gi|298491734|ref|YP_003721911.1| multi-sensor hybrid histidine kinase ['Nostoc azollae' 0708]
 gi|298233652|gb|ADI64788.1| multi-sensor hybrid histidine kinase ['Nostoc azollae' 0708]
          Length = 1002

 Score =  408 bits (1050), Expect = e-111,   Method: Composition-based stats.
 Identities = 117/527 (22%), Positives = 222/527 (42%), Gaps = 26/527 (4%)

Query: 242 KNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRA 301
           + +     L ++   +          +W    +    + ++   +  G   E   L   +
Sbjct: 344 ERQRWQLALQQSEYQLRLMTETIPQQVWTAQPNGLVDYYNQRWCDFTGKTQEQ--LKTES 401

Query: 302 IARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NI 360
             ++IH ++    E   +   +     +    M   SG   WI  +A+ +R   G +   
Sbjct: 402 WEQIIHPEDLPKVEELWAKAVQTGSDYEVETRMLSGSGEYHWILGQARPLRNQQGQIVKW 461

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
            G   D+T+     +   E++       +   + +     +  L  CN  +    G+   
Sbjct: 462 YGTNTDITDHIQAREALRESELNFRTLADTMPQMIWTAKGDGWLEYCNQRWLDYTGMTLE 521

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV 480
                  + ++     +  I+  +      Q+   E +L              DG     
Sbjct: 522 ETQGWGWQPVLHPDDAQICIDIWSESVRTGQNYQIEYRL----------RRARDGQYRWH 571

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
                 L++ + Q+ +         +          R +  L  A  + Q   E AETAN
Sbjct: 572 LGRAFPLRNQKGQIIKWFGSCTDIDDHK--------RSEEALRNALQEKQAAYEAAETAN 623

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
           + K EFLA +SHELRTPLN ILG+S+++K    G+L   K  E  + I  + +  +++I+
Sbjct: 624 RVKDEFLAILSHELRTPLNPILGWSQLLK---TGKLDKDKTDEALKSIERNAKLQVDLID 680

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKR 659
           ++L++S+I   K++++    +L  II+  +  +  +A  K I ++  I   +     D  
Sbjct: 681 DLLDVSRILRGKLTLNVTTVNLADIISAALETMSLAASVKQIAVQTLIEPNIGKVRGDPA 740

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
            +++I++ +LSN+IKFT   G+++++  +IG    I ++D G GI +  L  I + F   
Sbjct: 741 RLQQIVWNLLSNAIKFTPQGGEVVVQLEQIGSMAHIIVSDQGKGINRKFLPHIFEHFRQE 800

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ-EGKGTIVTICMP 765
                +  GG GLGLAI   L  LHGG ++  S  EG+GT + + +P
Sbjct: 801 DGSTTRKFGGLGLGLAIVRHLVELHGGTVEADSPGEGQGTTLKVILP 847



 Score =  134 bits (338), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 44/313 (14%), Positives = 101/313 (32%), Gaps = 18/313 (5%)

Query: 93  IEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSH 149
           +++I + +++      +++ +  L Q   + R ++E+    +  AQPN LV   + +   
Sbjct: 329 LQLIERASHLAGVAIERQRWQLALQQSEYQLRLMTETIPQQVWTAQPNGLVDYYNQRWCD 388

Query: 150 YIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLR 209
           + GK   ++  E        + +   E    +                  +    +    
Sbjct: 389 FTGKTQEQLKTESWEQIIHPEDLPKVEELWAKAVQ---------TGSDYEVETRMLSGSG 439

Query: 210 LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLW 269
            +   +       +    +     +        + +    L E+ +   T        +W
Sbjct: 440 EYHWILGQARPLRNQQGQI--VKWYGTNTDITDHIQAREALRESELNFRTLADTMPQMIW 497

Query: 270 NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD 329
               D    + ++   +  G+  E           ++H D+ +IC    S + +  +   
Sbjct: 498 TAKGDGWLEYCNQRWLDYTGMTLEETQG--WGWQPVLHPDDAQICIDIWSESVRTGQNYQ 555

Query: 330 QIFHMRHA-SGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
             + +R A  G   W   RA  +R   G  +   G   D+ +    E+    A Q    A
Sbjct: 556 IEYRLRRARDGQYRWHLGRAFPLRNQKGQIIKWFGSCTDIDDHKRSEEALRNALQEKQAA 615

Query: 388 IECTSEALVLWDK 400
            E    A  + D+
Sbjct: 616 YEAAETANRVKDE 628


>gi|117921856|ref|YP_871048.1| multi-sensor hybrid histidine kinase [Shewanella sp. ANA-3]
 gi|117614188|gb|ABK49642.1| multi-sensor hybrid histidine kinase [Shewanella sp. ANA-3]
          Length = 1767

 Score =  408 bits (1050), Expect = e-111,   Method: Composition-based stats.
 Identities = 138/701 (19%), Positives = 270/701 (38%), Gaps = 68/701 (9%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVF- 141
              +L    E   Q      D+  +   E  +     + R         +   +  ++   
Sbjct: 607  LSILPADHEGRRQVAASIRDMTQKLAVEQKIRDSELRFRGLVTNIPGAVYRTRIGDVWVM 666

Query: 142  -ASSTKNSHYIGKKIGEIIPELSRSRS-------RSKTVQMSEASLDQQPYHVLSVNLPH 193
               S   +   G    + I    R+ +       R    Q  + +L QQ    +   + H
Sbjct: 667  EYVSDNIADITGFAASQFIENRQRTFASLILEEDRELCHQHIDRALAQQETFEVEYRIRH 726

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GSI  ++ +      + EE     ++F                   ++K     L  +
Sbjct: 727  RDGSIRWVHEKG--KASYTEE--GFPLWFDGSID-----------DITESKLAMVELEAS 771

Query: 254  NICVETALSRGRCGL----WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
             + +        C +    W    D+    LS + + ++G+  E+    F  IA  I  +
Sbjct: 772  RLQLTNITESIPCTVYQLRWVSPADHTFTFLSGAAFHMLGLHREDLLKDFNIIAERIFDE 831

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A +   +   Q  + F  RH +G+  W++  A       G +   G  MD+TE
Sbjct: 832  ERPEVVRALAGKSEDKLQWVREFRYRHPNGSIRWMEAGASGHYNDDGAIIWNGYVMDITE 891

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       + ++  +V  D    ++ CN  Y +  G     L  G    
Sbjct: 892  RKAIEEELAVSEAHFKALFDGSTIGIVNVDAKGVILDCNDQYCEDMGQTRESL-CGVPIF 950

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
             +   Q +   + +  +    +      + +         +   +G  + +  +++ L  
Sbjct: 951  DVLSLQDKETAKAQFRELAEGKVDHYRGERS---------FIRPNGEPLWMTVNVSALFD 1001

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
            +Q Q   +   +                  TEL + + +  V KE A+ A+K K +FLA 
Sbjct: 1002 SQKQFESAVVSMVDM---------------TELKLLSDELLVAKEEADAASKAKGDFLAN 1046

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            MSHE+RTP+NAI+G S++  +    +    K   Y + I  + + LL++IN+IL+ SKIE
Sbjct: 1047 MSHEIRTPMNAIIGMSQLCLQTALDK----KQKNYVEKIERASKSLLSIINDILDFSKIE 1102

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFP 667
              K+ I+     L  ++ +   +    A  K +++   +   +      D   + ++L  
Sbjct: 1103 AGKLDIESVPFQLDTMLEDLSDMFSEKAAHKQLELLFAVAPNVPRHLFGDSLRLGQVLIN 1162

Query: 668  ILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
            +++N+IKFT   G++++  + + Q      +  ++ D+GIG+      K+ + F      
Sbjct: 1163 LMNNAIKFT-ERGEVLLSLNLVEQQNDDVVLRFSVRDSGIGLTADQQAKLFKSFSQADTS 1221

Query: 723  YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
              +  GG GLGLAI   L  L GG + + SQ G G+     
Sbjct: 1222 TTRKYGGTGLGLAICKQLVELMGGTIGVESQFGHGSTFYFT 1262


>gi|117926233|ref|YP_866850.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117609989|gb|ABK45444.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 1202

 Score =  408 bits (1049), Expect = e-111,   Method: Composition-based stats.
 Identities = 111/717 (15%), Positives = 260/717 (36%), Gaps = 77/717 (10%)

Query: 79  EKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQL------------LAKTRFL 126
           ++    T       +    Q   +  D AS ++   ++ +L              K    
Sbjct: 95  QEQLLSTLRQTANHLLEADQKPTLGEDEASLEQLSDLMSRLALERSEFRRHLERQKFALD 154

Query: 127 SESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQ-----MSEASLDQ 181
             + + +     ++  ++ +     G    EI+ +     +           M       
Sbjct: 155 QHAIVSITDTKGVILYANDRFCQISGYTQDEILGQAHNLVNSGYHDSGFFEVMWRTIARG 214

Query: 182 QPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAK 241
           + ++    N   +     +  + VP L    + +                   +      
Sbjct: 215 EVWNGEVCNKAKDGRLYWVSATIVPFLDERGKPIQY----------------IAIRTDIT 258

Query: 242 KNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRA 301
           + K  +  + +    +++       G++  +       L+     ++G   +   L+ R+
Sbjct: 259 RQKALEEKIEDNRRFLQSISDNIGEGVFALDVQGFCTFLNPEAERLLGWTQDE--LAGRS 316

Query: 302 IARLIHYDNKKICEIARSVTGKHVKQLD-QIFH-----MRHASGADIWIQVRAQMMRTIS 355
               +HY + +   +  +    H        +        H  G    + +    +R   
Sbjct: 317 FHDTVHYQDAEGMPMNEADCPVHDAVDRGVDYRSDEDVFIHRDGGIFPVNISVVPVREDG 376

Query: 356 GGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAY 415
                +G+  ++TE   ++++  ++++RL  A++ ++     WD        +  +    
Sbjct: 377 VVTGAVGVFQNITESKQIQRQLKQSEERLQIALDASNTGFWDWDPLQDRAYFSDQWLSMV 436

Query: 416 GLPDHVLVPG-NARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHD 474
           G     ++        +   +  P +E         Q  + E++                
Sbjct: 437 GYQQGDILNNSTGWLDLLHGEDLPHVERELEAHLNGQRKNFEVEFR---------MRHKQ 487

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           G  + + +   +++ ++ +                     + +  ++      + +    
Sbjct: 488 GHWVWILSSGRVIERDEEKRALRM--------------AGIHKDISDRKRVEDELKKAML 533

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
            AE+AN++KSEFLA MSHE+RTP+N ++G  E++           +   + +    S + 
Sbjct: 534 DAESANRSKSEFLANMSHEIRTPMNGVVGMMELLSNTELTP----EQQSHMRTARNSAES 589

Query: 595 LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF- 653
           LL +IN+IL+ SKIE  K+ +++   DL  ++ +   L+     S+ +++    P++L  
Sbjct: 590 LLTIINDILDFSKIEAGKLELEEIAFDLAELVEDVTALLAQRVDSEKLELLHNAPADLPM 649

Query: 654 -FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT---SKIGQCVII--TIADTGIGIPKS 707
               D   ++++L  ++ N++KFT   G++ +R     +    V +   + DTGIGI ++
Sbjct: 650 QVAGDPTRLRQVLVNLVGNAVKFTPE-GEVEVRMTVERQDADTVTVLTEVRDTGIGIDEA 708

Query: 708 ALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
              ++ + F        +  GG GLGLAIS  L  L GG +   S  G+G+     +
Sbjct: 709 VRPRLFRMFTQADGSTTRRFGGTGLGLAISKQLVELMGGEVGFSSVMGQGSTFWFRI 765


>gi|24372448|ref|NP_716490.1| sensory box histidine kinase/response regulator [Shewanella
            oneidensis MR-1]
 gi|24346431|gb|AAN53935.1|AE015531_1 sensory box histidine kinase/response regulator [Shewanella
            oneidensis MR-1]
          Length = 1765

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 137/701 (19%), Positives = 266/701 (37%), Gaps = 68/701 (9%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNEL--V 140
              +L    +   Q      D+  +   E  +     + R         +   +  E+  +
Sbjct: 607  LSILPSDFDGRRQVAASIRDMTQKIMVEQKIRDSELRFRGLVTNIPGAVYRTRIGEVWVI 666

Query: 141  FASSTKNSHYIGKKIGEIIPELSR----SRSRSKTV---QMSEASLDQQPYHVLSVNLPH 193
               S   +   G    + I    R               Q  E +L QQ    +   + H
Sbjct: 667  EYVSDNIAEITGYAASQFIENRQRTFTSLILEDDRALCNQHIERALAQQETFEVEYRIRH 726

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GSI  ++ +      + EE     ++F                   ++K     +  +
Sbjct: 727  RDGSIRWVHEKG--KASYSEE--GLPLWFDGSID-----------DVTESKLAIDEIEAS 771

Query: 254  NICVETALSRGRCGLW--NFNFDNKK--FHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +        C ++   +     +    LS +   ++G+  E     F  IA  I  +
Sbjct: 772  RQQLTNITESIPCTVYQLRWVSPTDRSFTFLSGAALAMLGLHREELLRDFNIIAERIFDE 831

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A +       +  + F  RH +G   W++  A       G +   G  MD+TE
Sbjct: 832  ERPEVISALAGKSDDQLRWIREFRYRHPNGGIRWMEAGASGHYADDGSIIWNGYVMDVTE 891

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       +  +  +V  D    ++ CN  + +  GL    L       
Sbjct: 892  RKSIEEELAVSEAHFKALFDGATIGIVNVDIKGLILDCNYQFCEDMGLSRDELRS-TPIF 950

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
             +  AQ + + + +  +    +      + +         +    G  + +  +++ L  
Sbjct: 951  DVLSAQDKDVAKAQFKELVEGKIDHYRGERS---------FVRPSGEPLWMTVNVSTLLD 1001

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
            +Q Q   +   +                  TEL + + +  V K+ A+ A+K K +FLA 
Sbjct: 1002 SQNQFESAVVSMVDM---------------TELKLLSDELLVAKDEADAASKAKGDFLAN 1046

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            MSHE+RTP+NAI+G S++  +    +    K   Y + I  + Q LL++IN+IL+ SKIE
Sbjct: 1047 MSHEIRTPMNAIIGMSQLCLQTQLDK----KQKNYLEKIERASQSLLSIINDILDFSKIE 1102

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFP 667
              K+ I+  +  L  ++ +   +    A  K I++   +   +      D   + ++L  
Sbjct: 1103 AGKLDIENVSFQLDTMLEDLSDMFSERAAQKQIELLFAVAPNVPRHLLGDPLRLGQVLIN 1162

Query: 668  ILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
            +++N+IKFT   G++++  S + Q      +  ++ D+GIG+ +    K+ + F      
Sbjct: 1163 LMNNAIKFT-ERGEVLLSLSLVEQQNDDVVLRFSVRDSGIGLTQEQQSKLFKSFTQADTS 1221

Query: 723  YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
              +  GG GLGLAIS  L  L GG + + SQ G G+     
Sbjct: 1222 TTRKYGGTGLGLAISKQLVELMGGSIGVESQLGHGSTFFFT 1262



 Score = 60.4 bits (145), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 50/458 (10%), Positives = 147/458 (32%), Gaps = 34/458 (7%)

Query: 61  VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL 120
           + IA S ++ +  +         +  L  + +  +  QN             ++      
Sbjct: 210 LGIAPSRLVVLDDQGRLIFHSDKEKVLAASSSGWLDKQNIKNIAFATLLNDGQAGQASF- 268

Query: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
                              V+ +S      +  ++  ++P+     S    +  +  +L 
Sbjct: 269 -------------VDDKGTVYLASVAEVAKLKWRVVVMVPKHELFASLLDDIASAILNLS 315

Query: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
                +L             + +    +  + +    E+       + ++ +  ++ + A
Sbjct: 316 LLTLLLLLTCYIAAKRLTRPLEALESGILAFGQGKAQELTIPKGAVSEIVTLSETFNQMA 375

Query: 241 KKNKENDTILLEAN-ICVETALSRGRCGLW--NFNFDNKKFHLSRSMYEIMGIPYENKTL 297
               E +  +L++        +       +  + + D +   +S  + +++GIP E    
Sbjct: 376 ALLAEREQAILDSRGNRFARLIDGMSDKSFYCSLDPDGQLAQVSEGVTKVLGIPPELLKR 435

Query: 298 SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG 357
            ++ +      + K       ++ G++V        +  A G    + V  Q + + +G 
Sbjct: 436 KYQRLFSANPLNEKNWEYTDLALKGQNVPPHQIE--LVDAKGQARRLDVFMQPLVSDTGE 493

Query: 358 MNIIGI-AMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYG 416
           +  + +   D+TE++             +  +E   EA+++ D+N ++V  N+  Q+ +G
Sbjct: 494 LMSVEMLFTDVTEQFSAA-------AWSNAVLEAAPEAMLIVDQNGQIVFSNSRCQQLFG 546

Query: 417 LPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGG 476
                ++     +++ +         R       +D                     DGG
Sbjct: 547 YDAKAMLALQIETLLPEELRHLHTGERLDFLREGRDRPMASAR-------HVRALKSDGG 599

Query: 477 TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
                  +++L  +    R+    ++     +   ++I
Sbjct: 600 EFVAEIALSILPSDFDGRRQVAASIRDMTQKIMVEQKI 637


>gi|71908619|ref|YP_286206.1| PAS [Dechloromonas aromatica RCB]
 gi|71848240|gb|AAZ47736.1| PAS protein [Dechloromonas aromatica RCB]
          Length = 1560

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 131/658 (19%), Positives = 244/658 (37%), Gaps = 42/658 (6%)

Query: 117  GQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSE 176
             ++L + + L+            V   S  ++   G    E   E+      S       
Sbjct: 581  EEMLLQAQRLARLGHFTFDAATDVLRGSPTHNELFG---IEAGLEIDTDTWLSLIHPEDR 637

Query: 177  ASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSY 236
              +       +            +I      +R       +E+      +   +  LF  
Sbjct: 638  QRMADYSRDHVFRGRQPFDTEYRVIRRNDGEVRWLHGAGQIEIT-----ANGRVARLFGT 692

Query: 237  YRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT 296
             +   + K  +  L      ++ A +    G W  +  + K   S  +Y I G+  +   
Sbjct: 693  SQDITERKHFERRLSRNEKALKEAQAIANLGSWTLDILSDKLTWSDEVYRIFGVAKDQ-P 751

Query: 297  LSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG 356
            L        IH D++   +   +         +    +        W++ RA +     G
Sbjct: 752  LKLGDFLARIHPDDRDRVQADWNAAL-QGSPYNSEHRI-TVDQQVRWVRERAHIRIDDEG 809

Query: 357  GMNI-IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAY 415
                 +G   D+TE++  E++  +    LS AIE T  ++V+ +   ++   N  + +  
Sbjct: 810  RAAFAVGTVQDVTERHEAEEQLRK----LSLAIEQTPHSIVITNTAAKIEYVNEAFVRNT 865

Query: 416  GLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDG 475
            G      +  N  S++    T               ++          W         DG
Sbjct: 866  GYSRSEAIGSNP-SVLHSGMTPGESYNELWQTLGRGEV----------WHGEFMNRRKDG 914

Query: 476  GT---ISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE 532
                  ++ + +             K  +       S      +  +  ++    +    
Sbjct: 915  SIYEEFAIISPVRQPDGKVTHYLAIKEDITEKKRIQSELNSYRQHLEQLVAERTEELNHA 974

Query: 533  KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
            K+ AE+A++ K+ FLA MSHE+RTP+NAI+G + + ++         +  +    +  + 
Sbjct: 975  KDEAESASRAKTAFLANMSHEIRTPMNAIIGLTHLAQRSTSDP----EQNKRLGKVADAA 1030

Query: 593  QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
             HL+++IN++L++SKIE  K+ ++  +  L  +      L+   A +K + +   I   L
Sbjct: 1031 HHLMSIINDVLDISKIEANKLKLENTDFSLAQLCTAACELVTQRADAKRLPVTCIIDPAL 1090

Query: 653  F--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS---KIGQCVIIT--IADTGIGIP 705
                  D   I++IL   LSN+IKFT   GK+ IR     K G  ++I   ++DTGIGI 
Sbjct: 1091 PPVLCGDPLRIQQILLNFLSNAIKFT-ERGKIDIRVQALQKSGDGILIRCAVSDTGIGIA 1149

Query: 706  KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
              A  K+  PFE       +  GG GLGLAIS  L     G + + S+ G+G+     
Sbjct: 1150 SDAQRKLFVPFEQGDASTTRRYGGTGLGLAISRRLAEAMHGEIGVDSKLGQGSTFWFT 1207



 Score =  116 bits (290), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/240 (14%), Positives = 73/240 (30%), Gaps = 11/240 (4%)

Query: 189 VNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDT 248
             +     S+ +  S    L          +V       +L  +      +    +  + 
Sbjct: 203 ETMSSPLRSVNVEMSVTGALEAMNRFHLRHMVVLDNNGKILGVVSQRRLFEQLALERLEN 262

Query: 249 ILLE---------ANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSF 299
            L +             ++ AL     G W +  D  +  +S  +  ++G   ++   + 
Sbjct: 263 ALHQMQQERDRLRLEAHLQLALDVAGAGSWEYQHDTDRHIVSDGVQALLGCTQDDTPRTL 322

Query: 300 RAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVR-AQMMRTISGGM 358
                 IH D++ +   A S            + +RH  G  IW++ R     R   G  
Sbjct: 323 NEWMERIHPDDRHLLATAASADHGKTPSQVVEYRIRHQDGHWIWVENRSCVTERNADGSP 382

Query: 359 NII-GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL 417
            +  GI  D+TE+    ++    ++ L          +   D+   L        +  G 
Sbjct: 383 MVTAGILNDITERELARQQITRQNRALRMMTAVAQILVRYTDEQQMLAEICTVAVEVGGY 442



 Score = 41.5 bits (96), Expect = 0.63,   Method: Composition-based stats.
 Identities = 21/164 (12%), Positives = 44/164 (26%), Gaps = 13/164 (7%)

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP--GN 426
            +   E+     +  L  A++        +  +    + +   Q   G            
Sbjct: 265 HQMQQERDRLRLEAHLQLALDVAGAGSWEYQHDTDRHIVSDGVQALLGCTQDDTPRTLNE 324

Query: 427 ARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITL 486
               I       +    ++D  ++     E ++              DG  I V     +
Sbjct: 325 WMERIHPDDRHLLATAASADHGKTPSQVVEYRI-----------RHQDGHWIWVENRSCV 373

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQ 530
            + N          +   I +   +RQ + RQ   L +  A  Q
Sbjct: 374 TERNADGSPMVTAGILNDITERELARQQITRQNRALRMMTAVAQ 417


>gi|255034075|ref|YP_003084696.1| PAS/PAC sensor hybrid histidine kinase [Dyadobacter fermentans DSM
           18053]
 gi|254946831|gb|ACT91531.1| PAS/PAC sensor hybrid histidine kinase [Dyadobacter fermentans DSM
           18053]
          Length = 1287

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 127/673 (18%), Positives = 250/673 (37%), Gaps = 57/673 (8%)

Query: 104 FDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELS 163
            D+   + +   L + LA     +  +I++      +   +     + G    E+  +  
Sbjct: 367 HDITELRNSRERLKE-LAIVASNTTDYIVITDHKGFITWVNKAYETHTGYNRKEVEGKNP 425

Query: 164 RSRSRSKT------VQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTL 217
               +          ++     +++      +    N     +     P+   +      
Sbjct: 426 LLLLQGPETDHETLDRIWADCKNKKVVREEVLCYTKNGEKYWVDLKITPVFDDYGN---- 481

Query: 218 EVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKK 277
                            +  R     KE+D  +      ++   S    G W       +
Sbjct: 482 ------------CSNFIAVERNITARKESDQEMKRIKDILQQTNSVAVVGGWELYARTGE 529

Query: 278 FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
            + S +  EI  +  +    +  AI       +++    A      +    D    +  A
Sbjct: 530 LYWSSTTREIHEVDPDYVPSTETAIGFYKEGASREAIARAVEKGLSYGTPWDNELQIVTA 589

Query: 338 SGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL 397
            G + W++   +        + I G   D+T +   E     ++ +     + TS+A++L
Sbjct: 590 KGNERWVRTIGKAEMVDGVCVRIYGAFQDITHRKQAEVEILNSEAKFRSLYDSTSDAVIL 649

Query: 398 WDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEI 457
           +D     + CN    K +G+    ++       +      P +E   +D  R      E 
Sbjct: 650 FDHTG-YLDCNDAALKMFGIDSVDMLMKMPMGDLSGLN-EPGMEAARNDGCRHVREVYEN 707

Query: 458 KLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILER 517
              +  W       + +     V  ++                      +     Q + R
Sbjct: 708 GTHNFEWKYKRFGESKESFIAEVLLNL-------------------MKVNGKEIIQAVIR 748

Query: 518 QKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELG 577
             T    A  +    +E AE A+K KSEFLA MSHE+RTPLN ++GF++++ K       
Sbjct: 749 DITIRKRAELELLEAREHAEAASKLKSEFLANMSHEIRTPLNGVVGFTDLLMKTNLD--- 805

Query: 578 SVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSA 637
                +Y   +  S   L+++IN+IL+ SKIE  K+ +  +  DL+ I      ++   A
Sbjct: 806 -ETQQQYMSMVFQSANSLMDIINDILDFSKIEAGKLELTPEKTDLLEICGRVADMVTYQA 864

Query: 638 QSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ---- 691
           Q K++++   IP+++      D   +++IL  +LSN++KFT   G++ ++   + +    
Sbjct: 865 QQKHLEMLLNIPADIPRFVWCDSVRLRQILVNLLSNAVKFTIK-GEIELKIELLNKVSGL 923

Query: 692 --CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
                 ++ DTGIGI      +I + F    +   +  GG GLGL IS++L  L   RL+
Sbjct: 924 DYTFRFSVRDTGIGIDPQNQRRIFEAFSQEDSSTTKRFGGTGLGLTISNSLLGLMESRLQ 983

Query: 750 IISQEGKGTIVTI 762
           + S+  KG+    
Sbjct: 984 LTSELEKGSTFFF 996



 Score =  118 bits (295), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 62/412 (15%), Positives = 120/412 (29%), Gaps = 39/412 (9%)

Query: 117 GQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSE 176
            +L       +  ++            +     +      EII   S S    + +    
Sbjct: 139 TELYQSFLNSNSIYVTGIDLEGNYKYVNDHFCEFFRLDRSEIIGRSSISGVVPEDIPKCL 198

Query: 177 ASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSY 236
              +Q   +  +   P+                 W                +       Y
Sbjct: 199 EVGEQCFINPGT---PNPVVLRKYSAGEGVKTTQWEFT-----GIADENGVVTEIFCLGY 250

Query: 237 YRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT 296
                +        L+    +   +S  +  L+  + D    ++S S   + G   E   
Sbjct: 251 --DITQQ-------LKVQEDLSVLVSNMQDVLFTISPDGVFTYVSPSWTSMYGHTVEETV 301

Query: 297 LSFRAIARLIHYDNKKICEIARSVTGKHVKQLD--QIFHMRHASGADIWIQVRAQMMRTI 354
              R+    IH ++  IC  A  +T +    +       +RH  G+  W    A +    
Sbjct: 302 G--RSFTEFIHPEDFHICFEALRITAETGVPVPGGVEHRIRHRDGSWSWSNTSANI---D 356

Query: 355 SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKA 414
               NII  + D+TE  +  +R  E    L+     T++ +V+ D    +   N  Y+  
Sbjct: 357 PVSKNIILTSHDITELRNSRERLKE----LAIVASNTTDYIVITDHKGFITWVNKAYETH 412

Query: 415 YGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHD 474
            G     +   N   ++Q  +T      R     +++ + +E  L            T +
Sbjct: 413 TGYNRKEVEGKNPLLLLQGPETDHETLDRIWADCKNKKVVREEVLC----------YTKN 462

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIAN 526
           G    V   IT +  +           +        S Q ++R K  L   N
Sbjct: 463 GEKYWVDLKITPVFDDYGNCSNFIAVERNITAR-KESDQEMKRIKDILQQTN 513



 Score = 65.4 bits (158), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 40/354 (11%), Positives = 92/354 (25%), Gaps = 31/354 (8%)

Query: 158 IIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTL 217
           ++        +       + +L+       +  L  N   +  I          +E  T 
Sbjct: 30  LLIWKHSDPQQHWADAKLQQALEPGFRPGPAAPLLENRSLLFHIEKSRAHFPHHQEPRTG 89

Query: 218 EVVFFSIISALLLFILFSYYRQA-----------KKNKENDTI--LLEANICVETALSRG 264
            V        +L   + S    +           +++  +D I  L+      ++ L+  
Sbjct: 90  LVRLLRGDMQVLRLNVASICAHSEECGWLVLTGFRRDSLSDEIPGLITNTELYQSFLNSN 149

Query: 265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKI-CEIARSVTGK 323
              +   + +    +++    E   +               +  ++     E+       
Sbjct: 150 SIYVTGIDLEGNYKYVNDHFCEFFRLDRSEIIGRSS--ISGVVPEDIPKCLEVGEQCFIN 207

Query: 324 HVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQ 382
                  +     A       Q     +   +G    I  +  D+T++  +++       
Sbjct: 208 PGTPNPVVLRKYSAGEGVKTTQWEFTGIADENGVVTEIFCLGYDITQQLKVQE------- 260

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
            LS  +    + L     +      + ++   YG      V  +    I         E 
Sbjct: 261 DLSVLVSNMQDVLFTISPDGVFTYVSPSWTSMYGHTVEETVGRSFTEFIHPEDFHICFEA 320

Query: 443 RTSDPERSQD----MSKEIKLADSRWLQINEWCTHD---GGTISVGTDITLLKH 489
                E        +   I+  D  W   N     D      I    DIT L++
Sbjct: 321 LRITAETGVPVPGGVEHRIRHRDGSWSWSNTSANIDPVSKNIILTSHDITELRN 374



 Score = 48.1 bits (113), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/205 (10%), Positives = 57/205 (27%), Gaps = 16/205 (7%)

Query: 243 NKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRS-MYEIM--GIPYENKTLSF 299
            KE   +L +     +        GL  +   + + H + + + + +  G          
Sbjct: 5   RKELLKLLQKDEAIFDFIQDAATDGLLIWKHSDPQQHWADAKLQQALEPGFRPGPAAPLL 64

Query: 300 RAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMN 359
              + L H       E +R+    H +    +  +    G    +++    +   S    
Sbjct: 65  ENRSLLFH------IEKSRAHFPHHQEPRTGLVRLLR--GDMQVLRLNVASICAHSEECG 116

Query: 360 II---GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYG 416
            +   G   D               +     +   S  +   D        N ++ + + 
Sbjct: 117 WLVLTGFRRD--SLSDEIPGLITNTELYQSFLNSNSIYVTGIDLEGNYKYVNDHFCEFFR 174

Query: 417 LPDHVLVPGNARSIIQDAQTRPIIE 441
           L    ++  ++ S +        +E
Sbjct: 175 LDRSEIIGRSSISGVVPEDIPKCLE 199


>gi|220907213|ref|YP_002482524.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219863824|gb|ACL44163.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 1965

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 125/690 (18%), Positives = 256/690 (37%), Gaps = 40/690 (5%)

Query: 102  IKFDLASQKKAE---SMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
            I+ D++ +K++E        +L      S   + L   +     ++   +   G  + E 
Sbjct: 1138 IQIDISQRKQSELERERSEAILNAFLTASPIALTLLDRDLRFIYANEALAAVNGLPLSEH 1197

Query: 159  IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
            +                   L Q       V     SG +           L+R+ +   
Sbjct: 1198 LGRTLEEVV-PTMAPQFGPMLRQIIATQTPVLNLEFSGEVQP--------GLYRQTIANH 1248

Query: 219  VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
                     +L   +        + K  +  L ++   +  AL     GL++ N    + 
Sbjct: 1249 FPVCLPDGEVLGVGVT--VTDISELKRVEAELRQSEERLSLALKAANQGLYDLNLQTGQA 1306

Query: 279  HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKH-VKQLDQIFHMRHA 337
             +S     ++G   E    +   +   +H D+    +        +   +    F  R  
Sbjct: 1307 IVSPEYARMLGYEPEELEETTARLRDRLHPDDLATVDRVYQEYVANLHTEYRVEFRQRTI 1366

Query: 338  SGADIWIQVRAQMM-RTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
            +G  +WI    +++     G    ++G   D++++   E+   +  +RL+   + T E L
Sbjct: 1367 TGGWVWILSIGKIVNWDQDGNPLRMLGTHTDISDRKQAEQALQQHSERLNLLYQTTRELL 1426

Query: 396  VL---WDKNDRLVMCNANYQKAYGL--------PDHVLVPGNARSIIQDAQTRPIIEYRT 444
                  D  ++L    +   + +               +     S +   Q         
Sbjct: 1427 SAKQPLDLMNQLFERLSAQMQLHYYYHFKLCMREGRQQLRLMNYSGLSVEQAEEFAWIEL 1486

Query: 445  SDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKAT 504
                      +  ++  ++         H    + V   +        QL  +      T
Sbjct: 1487 GQSMCGLVAQERRQIVLNQTDIAAHANAHKICLMGVSAYVGHPLIVNGQLLGTLSFASLT 1546

Query: 505  INDLSTSRQILERQKT-------ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTP 557
                + +   L +  +       E +   A  + + E    AN+ K EFLA +SHELR+P
Sbjct: 1547 RTQFTPAEVNLLQAISEQVAIALERAELVASLEQQTEDLARANRVKDEFLAVLSHELRSP 1606

Query: 558  LNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDK 617
            LN ILG++++++ + F      K  +    I  + +    +I ++L++S+I   K+ ++ 
Sbjct: 1607 LNPILGWTKLLQSQSFSP---DKAAKALATIERNAKLQAQLIEDLLDVSRILQGKMVLNV 1663

Query: 618  QNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFT 676
             + +L  +I   +  +  +A++K I++E  +  E+     D   +++I++ +L+N++KFT
Sbjct: 1664 TSVNLGSVIEAALETVRLAAEAKAIQLETLMEPEIDPILGDPARLQQIVWNLLTNAVKFT 1723

Query: 677  NNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAI 736
               G++ +R  ++     + + DTG GI  + L  +   F        +  GG GLGLAI
Sbjct: 1724 PQGGQVTVRLQRVDTFAQLQVQDTGKGISPAFLPHVFDYFRQEDGTTTRKFGGLGLGLAI 1783

Query: 737  SDALTNLHGGRLKIISQ-EGKGTIVTICMP 765
               LT  HGG +   S  EG G   TI +P
Sbjct: 1784 VRHLTEQHGGTVAADSPGEGLGATFTIRLP 1813



 Score =  205 bits (521), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 66/451 (14%), Positives = 143/451 (31%), Gaps = 29/451 (6%)

Query: 105  DLASQKKAESMLGQLLAKTRFLSES---FILLAQPNELVFASSTKNSHYIGKKIGEIIP- 160
            D+  +K+ E+ L     + R L+E+    +       L    +     Y G    E +  
Sbjct: 887  DITQRKQVEAALQASEERYRHLAEAMPQIVWTTDAQGLATYFNPNWYGYTGLTAAESMGL 946

Query: 161  ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
            E   +       ++ +  L                              ++R  +   + 
Sbjct: 947  ESPNALHPEDRDRVLQQWLQAVEAGTSYEIE----------IRLRRWDGVYRWFLCRGLP 996

Query: 221  FFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHL 280
                   ++              K     L ++   +  AL   + G+W +     +   
Sbjct: 997  VRDPRGEII--SWVGTNTDIDDQKHIQAALHQSEERLSLALRSAQAGMWQWLKAENRMIW 1054

Query: 281  SRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGA 340
            S   + ++G      + S +A  +++H D++ I E A   +      L   + +    G+
Sbjct: 1055 SDETFRMLGYEPGQCSASHQAWVQVVHPDDRAIAEQAVQRSLAENCPLYSEYRVCLPDGS 1114

Query: 341  DIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWD 399
              W+    Q+    +G     IGI +D++++   E     ++  L+  +  +  AL L D
Sbjct: 1115 IRWLADIGQVTYDEAGDQTGTIGIQIDISQRKQSELERERSEAILNAFLTASPIALTLLD 1174

Query: 400  KNDRLVMCNANYQKAYGLPDHVLVPGNARSII--QDAQTRPIIEYRTSDPERSQDMSKEI 457
            ++ R +  N       GLP    +      ++     Q  P++    +      ++    
Sbjct: 1175 RDLRFIYANEALAAVNGLPLSEHLGRTLEEVVPTMAPQFGPMLRQIIATQTPVLNLEFSG 1234

Query: 458  KLADSRWLQINEW----CTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQ 513
            ++    + Q        C  DG  + VG  +T +   +    E ++  +     L  + Q
Sbjct: 1235 EVQPGLYRQTIANHFPVCLPDGEVLGVGVTVTDISELKRVEAELRQSEERLSLALKAANQ 1294

Query: 514  ILERQKTELSIA------NAKYQVEKERAET 538
             L     +   A            E E  E 
Sbjct: 1295 GLYDLNLQTGQAIVSPEYARMLGYEPEELEE 1325



 Score =  151 bits (381), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 60/465 (12%), Positives = 129/465 (27%), Gaps = 61/465 (13%)

Query: 106 LASQKKAESMLGQLL---AKTRFLSESFILLAQP-NELVFASSTKNSHYIGKKIGEIIPE 161
           +  +K+ ES L +      +        + +     +    ++ + + ++G    ++   
Sbjct: 463 ITPRKQIESQLQESQRFNQQIAEAMPGVVFVHDLVEQRNVYTNRQITDFLGYTSEQV--- 519

Query: 162 LSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVF 221
                + +    +    L+Q   +  +     +   + I          WR   +  V  
Sbjct: 520 -QAMGANAIATLIHPDDLEQILSYFAAFQHAADDVVLGIEYRAHHANGEWRWMYSQSV-V 577

Query: 222 FSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLS 281
           F+     +   L          K ++  L E+      A    + G W  + +     + 
Sbjct: 578 FNRTVDGIPRQLLGVAIDITDRKRSEQALQESEAWTRLAAQVAQLGGWRLHLETNLVEID 637

Query: 282 RSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTG--KHVKQLDQIFHMRHASG 339
           + M +I G P     L    +   IH  +++    A +     + +   +  + +    G
Sbjct: 638 QRMGQIWGEPENTVLLPLPIVLERIHPADRERVTHAVTAALDPQSLGVYETEYRIVWKDG 697

Query: 340 ADIWIQVRAQMMRTISGGMN----IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
           ++ W+  + Q      G         G A+D+T++   E   A  +QR     E  S A+
Sbjct: 698 SERWVLAKGQARFEGEGTARRTVDFFGTALDITDRKQAEAALAAQEQRYRYIFESVSVAI 757

Query: 396 VLWDKND----------------------------------RLVMCNANYQKAYGLPDHV 421
              D +                                   R+   N    + +G  D  
Sbjct: 758 WEEDFSAVKAAINQLQGSGIEDFAQYLAEHPEFVRQMASSVRIHDVNQAALQMFGAKDKA 817

Query: 422 LVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVG 481
            +  +   I         I    +  E     + E               T  G  + V 
Sbjct: 818 ELLSSLNQIFVPETEAAFIGELLAIAEGKTYFAAE-----------TVVQTLQGERLRVW 866

Query: 482 TDIT-LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
             IT                       +  + Q  E +   L+ A
Sbjct: 867 FTITFPSASQPYDHVLVSLLDITQRKQVEAALQASEERYRHLAEA 911



 Score =  128 bits (321), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 73/513 (14%), Positives = 160/513 (31%), Gaps = 58/513 (11%)

Query: 59  FLVFIATSSIIKVTTRYAQQEK------MTNQTSLMLTEAIEIIFQNNNIKFDLASQKKA 112
           FLV +A  S   +    +Q +       M NQ    +     ++            +++A
Sbjct: 278 FLVALAIESYASIPFFDSQGQLLGILGVMDNQPIANVHLVESLLTLFAMRIGAEVERQQA 337

Query: 113 ESMLGQLLAK--------TRFLSESFIL----LAQPNE-LVFASSTKNSHYIGKKIGEII 159
           E +      +                +        P    +  ++   S   G     +I
Sbjct: 338 EELQQAAAQRLQIYSDVVGNAQVGMVVWQLEDWQDPGSFRLLLANPAASAATGFDFEPVI 397

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
                               +  P+ + +  + H    +    S       + E+     
Sbjct: 398 G---------------RTMAESFPHLLQTPLVQHYLDVVHTGRSLDLGEVSYSEDGIATG 442

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKK-F 278
           ++      L    L   +      K+ ++ L E+    +         ++  +   ++  
Sbjct: 443 IYSLKAFPLPGHCLGLAFENITPRKQIESQLQESQRFNQQIAEAMPGVVFVHDLVEQRNV 502

Query: 279 HLSRSMYEIMGIPYEN-KTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD--QIFHMR 335
           + +R + + +G   E  + +   AIA LIH D+ +      +        +     +   
Sbjct: 503 YTNRQITDFLGYTSEQVQAMGANAIATLIHPDDLEQILSYFAAFQHAADDVVLGIEYRAH 562

Query: 336 HASGADIWIQVRAQMM-RTISGGMN-IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
           HA+G   W+  ++ +  RT+ G    ++G+A+D+T++   E+   E++     A +    
Sbjct: 563 HANGEWRWMYSQSVVFNRTVDGIPRQLLGVAIDITDRKRSEQALQESEAWTRLAAQVAQL 622

Query: 394 ALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR--SIIQDAQTRPIIEYRTSDPE--- 448
                     LV  +    + +G P++ ++         I  A    +    T+  +   
Sbjct: 623 GGWRLHLETNLVEIDQRMGQIWGEPENTVLLPLPIVLERIHPADRERVTHAVTAALDPQS 682

Query: 449 -RSQDMSKEIKLADS--RWLQINEWCTHDGG--------TISVGTDITLLKHNQAQLRES 497
               +    I   D   RW+        +G               DIT  K  +A L   
Sbjct: 683 LGVYETEYRIVWKDGSERWVLAKGQARFEGEGTARRTVDFFGTALDITDRKQAEAALAAQ 742

Query: 498 KRRLKATINDLSTSRQILERQKTELSIANAKYQ 530
           ++R +      S S  I E   + +  A  + Q
Sbjct: 743 EQRYRYIFE--SVSVAIWEEDFSAVKAAINQLQ 773



 Score =  108 bits (269), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 48/462 (10%), Positives = 124/462 (26%), Gaps = 53/462 (11%)

Query: 102  IKFDLASQKKAESMLGQLLAKTRFLSESFI---LLAQPNELVFASSTKNSHYIGKKIGEI 158
            +  D+  +K++E  L +  A TR  ++              +     +     G+     
Sbjct: 592  VAIDITDRKRSEQALQESEAWTRLAAQVAQLGGWRLHLETNLVEIDQRMGQIWGEP---- 647

Query: 159  IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIIN-SRVPLLRLWREEVTL 217
              E +        ++    +  ++  H ++  L   S  +       V      R  +  
Sbjct: 648  --ENTVLLPLPIVLERIHPADRERVTHAVTAALDPQSLGVYETEYRIVWKDGSERWVLAK 705

Query: 218  EVVFFSIIS-ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDN- 275
                F     A      F         K+ +  L                 +W  +F   
Sbjct: 706  GQARFEGEGTARRTVDFFGTALDITDRKQAEAALAAQEQRYRYIFESVSVAIWEEDFSAV 765

Query: 276  ---------------------------------KKFHLSRSMYEIMGIPYENKTLSFRAI 302
                                             +   ++++  ++ G   + + LS  ++
Sbjct: 766  KAAINQLQGSGIEDFAQYLAEHPEFVRQMASSVRIHDVNQAALQMFGAKDKAELLS--SL 823

Query: 303  ARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIG 362
             ++   + +           +          ++   G  + +              +++ 
Sbjct: 824  NQIFVPETEAAFIGELLAIAEGKTYFAAETVVQTLQGERLRVWFTITFPSASQPYDHVLV 883

Query: 363  IAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVL 422
              +D+T++  +E     +++R     E   + +   D        N N+    GL     
Sbjct: 884  SLLDITQRKQVEAALQASEERYRHLAEAMPQIVWTTDAQGLATYFNPNWYGYTGLTAAES 943

Query: 423  VPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLA--DS--RWLQINEWCTHD--GG 476
            +   + + +       +++      E       EI+L   D   RW         D  G 
Sbjct: 944  MGLESPNALHPEDRDRVLQQWLQAVEAGTSYEIEIRLRRWDGVYRWFLCRGLPVRDPRGE 1003

Query: 477  TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
             IS     T +   +       +  +     L +++  + + 
Sbjct: 1004 IISWVGTNTDIDDQKHIQAALHQSEERLSLALRSAQAGMWQW 1045


>gi|148253661|ref|YP_001238246.1| hypothetical protein BBta_2154 [Bradyrhizobium sp. BTAi1]
 gi|146405834|gb|ABQ34340.1| hypothetical protein BBta_2154 [Bradyrhizobium sp. BTAi1]
          Length = 786

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 141/585 (24%), Positives = 257/585 (43%), Gaps = 42/585 (7%)

Query: 207 LLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKK---------NKENDTILLEANICV 257
           LL   +++  + ++  +  + +++ +L S   +  +          ++ND  L +    +
Sbjct: 51  LLTDLQKDRIVSLLMLAFGAVVVMIVLTSMLIRKSRHAIALANALARQNDQ-LAQTTRLL 109

Query: 258 ETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIA 317
             A   GR G W  +   +    S  ++EI G+   ++   F  +  +IH ++      A
Sbjct: 110 GDAQRIGRLGHWVTDPSGEFAVWSDELFEIAGLEPVDQVA-FAKMLDIIHPEDVGAYVRA 168

Query: 318 RSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMN-IIGIAMDLTEKYHLEKR 376
           R  +        Q       +G   W+++ A       G      GI  D+TE+   E  
Sbjct: 169 RDRSRATGCAFIQELRFVTPNGQVRWVRIEANASDEADGVFRERFGIVQDITERKLAEIN 228

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA-- 434
             +A   L  AIE  +   VL+DK+DR VM N  +++ +     ++ PG + + +     
Sbjct: 229 ADQARLLLMDAIESLTNGFVLFDKDDRFVMSNTMFREMFPAWTVLMKPGISFTELMRRAY 288

Query: 435 ---------QTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDIT 485
                            R +          E +  + RW+Q  +    DGGT+ + TDIT
Sbjct: 289 EHGLIRSKGDRFEEWLARKTAWHLGGSRMIEHRELNGRWIQSVDHRISDGGTVCLVTDIT 348

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
             K  QA+L +        +  +   R  LE+Q  EL    A+ +  ++ AE AN+ KS+
Sbjct: 349 AFKTVQAELEQ-------KLAYVEAIRSDLEQQTQELEARGAELRAARDAAEAANRAKSD 401

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FLA MSHE+RTPL+ ++G  ++++    G   S +   Y      S   LL +IN+IL+ 
Sbjct: 402 FLAIMSHEIRTPLSGMVGMVDLLR----GTSLSEEQKRYTALAKESADLLLEVINDILDF 457

Query: 606 SKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKK 663
           SK+E  ++  +  + D+  ++   +  +G  A+ + + ++  +   L      D   I++
Sbjct: 458 SKLEAGRLQSECIDFDVPNLVESAVSFMGEKARRRGLDLKVSLAPGLPQYLEGDPTRIRQ 517

Query: 664 ILFPILSNSIKFTNNNGKMMIRT--SKIGQCV---IITIADTGIGIPKSALEKIGQPFEP 718
           ++  ++ N+IKFT   G + +R    ++   V    I + DTGIG+    L +I  PF  
Sbjct: 518 VMLNLVGNAIKFT-EQGSIEVRASHRQLDGGVVDLRIEVIDTGIGMSPEILAQIFDPFVQ 576

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
                 +  GG GLGLAI   L  + GG + + S+ G+G+     
Sbjct: 577 ADTSISRKYGGSGLGLAICRQLCTIMGGSIGVDSELGRGSRFWFE 621


>gi|256424548|ref|YP_003125201.1| multi-sensor hybrid histidine kinase [Chitinophaga pinensis DSM
           2588]
 gi|256039456|gb|ACU63000.1| multi-sensor hybrid histidine kinase [Chitinophaga pinensis DSM
           2588]
          Length = 1203

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 139/679 (20%), Positives = 251/679 (36%), Gaps = 51/679 (7%)

Query: 102 IKFDLASQKKAESMLGQLLAKTRF---LSESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
           +  D+ S+   E  L +     R     S   +     +  +   +  ++  +G  I E+
Sbjct: 272 MGRDITSETLKEQALIESETNARTFFENSLGMMCRHDLDGHITYVNKASADSVGYSIEEL 331

Query: 159 IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
           +          +     +  L           L H          +   +R+W   +   
Sbjct: 332 LQMNLYQLIPQQYHADLDQYLINIRIKGKITGLMH-------TQHKKGHIRIW---LFNN 381

Query: 219 VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
           V+            +        +  E +T L      +E      R G W  +   ++ 
Sbjct: 382 VLINDGKG---SAYVIGNAADITERHELETDLKRTKELLERTNQVARIGGWEVDLGTQQL 438

Query: 279 HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS 338
           H S    EI  +  E+  L+          DN+ + +        +         +    
Sbjct: 439 HWSTVTCEIHEV-PEDFNLTPDNAMSFYTGDNRILLDAVVEQAITNGSPWQIELQITTWR 497

Query: 339 GADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA-LVL 397
           G  +W++              + G   D+ EK   +    ++ Q L   +E  SE  ++ 
Sbjct: 498 GRKLWVRSIGHAEFEDGVCKRLYGTFQDIDEKKKADLAIQQSRQLLEDVLESASEVSIIA 557

Query: 398 WDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEI 457
            D    + + N   ++  G     +    + +I+   +         S          E+
Sbjct: 558 TDHEGIITLFNKGAERLLGYKAGEVTGKESWTILHAEEEIMNRSIELSALSGQHIEGFEV 617

Query: 458 KLA----DSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQ 513
                  +    +   +   DG  I +   +T ++ N          +            
Sbjct: 618 FTYVPELEGSERREWTYIRKDGSQIIISMVVTPIRDNAVITGYLGIAV------------ 665

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
                 TE   A    +  K +AE A+K KSEFLA MSHE+RTPLN ++GF++++ K   
Sbjct: 666 ----DITERKKAERDLKEAKIQAEYASKAKSEFLANMSHEIRTPLNGVIGFTDLVLKTAL 721

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
               +    +Y   ++ S   LL++IN+IL+ SKIE  KI +D    D+    ++   ++
Sbjct: 722 ----NETQQQYVAIVNQSANSLLSIINDILDFSKIEAGKIELDISKCDIYEFSSQASDIL 777

Query: 634 GSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG- 690
              AQ K +++   +  EL     AD   +K+IL  +LSN++KFT   G++ +    I  
Sbjct: 778 SFQAQQKGLEMLLNVSPELPRFMWADIVRLKQILLNLLSNAVKFT-EKGEIELEIKPIAY 836

Query: 691 -----QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
                  +   + DTGIGI K+  EKI + F        +  GG GLGL+IS+ L  L G
Sbjct: 837 PSVGMTTIRFEVRDTGIGIRKNKQEKIFEAFLQEDISTTKRYGGTGLGLSISNKLLALMG 896

Query: 746 GRLKIISQEGKGTIVTICM 764
            +L++ S  GKG+     +
Sbjct: 897 SKLQLESTTGKGSTFFFDL 915



 Score = 97.7 bits (242), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 43/408 (10%), Positives = 115/408 (28%), Gaps = 34/408 (8%)

Query: 65  TSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR 124
             + I + T  A+          +L E I    Q N  + ++               +  
Sbjct: 127 LGAFIVLHTEPARLTSNEQTALSILAEKISDTIQTNRRRQEM-----------HYFTRLF 175

Query: 125 FLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPY 184
            LSE  + +   +  ++  +   +  +G    ++    +                     
Sbjct: 176 DLSEGLVCITDFSGRLWQFNKAFTTVLGWPEADLQTMSALDLVHPDDTAS---------T 226

Query: 185 HVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNK 244
                 +   + +I   +        +R         +          +F+  R      
Sbjct: 227 GKELAKMGEGASTISFTHRVRTAEGDYRLIQ------WVATPEPHTGNIFAMGRDITSET 280

Query: 245 ENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT-LSFRAIA 303
             +  L+E+     T        +   + D    +++++  + +G   E    ++   + 
Sbjct: 281 LKEQALIESETNARTFFENSLGMMCRHDLDGHITYVNKASADSVGYSIEELLQMNLYQLI 340

Query: 304 RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGI 363
              ++ +     I   + GK    +      +H  G          ++    G   +IG 
Sbjct: 341 PQQYHADLDQYLINIRIKGKITGLMHT----QHKKGHIRIWLFNNVLINDGKGSAYVIGN 396

Query: 364 AMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLV 423
           A D+TE++ LE       + L +  +         D   + +  +    + + +P+   +
Sbjct: 397 AADITERHELETDLKRTKELLERTNQVARIGGWEVDLGTQQLHWSTVTCEIHEVPEDFNL 456

Query: 424 PGNARSIIQDAQTRPIIEYRTSDPERSQDM---SKEIKLADSRWLQIN 468
             +          R +++        +        +I     R L + 
Sbjct: 457 TPDNAMSFYTGDNRILLDAVVEQAITNGSPWQIELQITTWRGRKLWVR 504



 Score = 85.8 bits (211), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/271 (14%), Positives = 79/271 (29%), Gaps = 19/271 (7%)

Query: 225 ISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSM 284
            +  +L    S   Q  + ++                      +   +F  + +  +++ 
Sbjct: 146 TALSILAEKISDTIQTNRRRQ-------EMHYFTRLFDLSEGLVCITDFSGRLWQFNKAF 198

Query: 285 YEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWI 344
             ++G P     L   +   L+H D+        +  G+    +     +R A G    I
Sbjct: 199 TTVLGWP--EADLQTMSALDLVHPDDTASTGKELAKMGEGASTISFTHRVRTAEGDYRLI 256

Query: 345 QVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRL 404
           Q  A           +     D+T +   E+   E++       E +   +   D +  +
Sbjct: 257 QWVATPEPHTGNIFAM---GRDITSETLKEQALIESETNARTFFENSLGMMCRHDLDGHI 313

Query: 405 VMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS---QDMSKEIKLAD 461
              N     + G     L+  N   +I       + +Y  +   +      M  + K   
Sbjct: 314 TYVNKASADSVGYSIEELLQMNLYQLIPQQYHADLDQYLINIRIKGKITGLMHTQHKKGH 373

Query: 462 SRWLQINEWCTHDGG----TISVGTDITLLK 488
            R    N    +DG      I    DIT   
Sbjct: 374 IRIWLFNNVLINDGKGSAYVIGNAADITERH 404


>gi|220909146|ref|YP_002484457.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219865757|gb|ACL46096.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 1068

 Score =  405 bits (1042), Expect = e-110,   Method: Composition-based stats.
 Identities = 137/684 (20%), Positives = 251/684 (36%), Gaps = 65/684 (9%)

Query: 100 NNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEII 159
             I  D+  +K+AE  L +    + +  +  + ++     +  ++       G    E++
Sbjct: 282 TGIALDITQRKQAEKTLQRYQLLSEYSRDIVLYIS-RKGQILEANQAAVKAYGYSRNELL 340

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
                             ++   P            G +     +      +  EV+ + 
Sbjct: 341 NLQLADLR----------AIQTLPLLWQQFEQASEGGILFETIHQRKDGSQFPVEVSAQS 390

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
                   +L  I     R     + ++  L ++      A+  GR G W    D     
Sbjct: 391 AVIDGEMGVLSVI-----RDISDRRRSEIALRKSEEWARLAIQIGRVGGWRLYLDQNLVE 445

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ--LDQIFHMRHA 337
           +   + EI G   +   +        IH D+++  + A             +  + +   
Sbjct: 446 MDERLREIWGESKDAVMVPIAKAMERIHPDDRERVKQAVYAAIDPASPGTYEIEYRIVWE 505

Query: 338 SGADIWIQVRAQMMRTISGGMN----IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
            G++ W+  + Q       G        G  +D+TE    E       +RL  A+     
Sbjct: 506 DGSERWVLAKGQAQFEGEAGSRQAVDFFGTLLDITEHKQAETALRTTAERLGLALTAAKL 565

Query: 394 ALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD---PERS 450
               W+    +V  +      +G+P    +  +    +     R     +          
Sbjct: 566 GDWSWNAATDIVTFSEQAAAMFGIPPGPYMTWSQIQNLLHVDDRARARLQVEQAIAEHSD 625

Query: 451 QDMSKEIKLADSR--WLQINEWCTHDG-----GTISVGTDITLLKHNQAQLRESKRRLKA 503
            D+   +     R  W+       +D      G + V  DIT  K  +A+  E   R +A
Sbjct: 626 YDIEYRVVDRQGRERWIAAKGRAQYDSSGQVLGMLGVVQDITHRKQAEAEREELLARERA 685

Query: 504 TINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILG 563
                                              AN+ K EFLA +SHELR+PLN ILG
Sbjct: 686 AREAAE----------------------------QANRIKDEFLAVLSHELRSPLNPILG 717

Query: 564 FSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLI 623
           +S   K  + G+L   K  +    I  + +    +I ++L++S+I   K+S+   + DL 
Sbjct: 718 WS---KLLLNGKLNLAKTQQALTTIERNARLQSELIEDLLDVSRILQGKLSLSVSSVDLA 774

Query: 624 PIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKM 682
             I   I  +  +A++K+I+IE ++  ++     D   ++++++ ++SN +KFT   G++
Sbjct: 775 STIQAAIETVRLAAEAKSIQIETRLAPDVGLVAGDSTRLQQVVWNLVSNGVKFTPAGGRV 834

Query: 683 MIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
            +R  ++ Q   ITI+DTG GI    L  +   F        +  GG GLGLAI   L  
Sbjct: 835 AVRLEQLEQQAQITISDTGKGIAPDFLPHVFDYFRQEDGATTRKFGGLGLGLAIVRHLVE 894

Query: 743 LHGGRLKIISQ-EGKGTIVTICMP 765
           LHGG ++  S  EG G   T+ +P
Sbjct: 895 LHGGTIQAHSPGEGLGATFTVRLP 918



 Score =  173 bits (439), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 51/447 (11%), Positives = 121/447 (27%), Gaps = 37/447 (8%)

Query: 106 LASQKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKIGE----- 157
           +  +K+A+    Q     +     ++           V   S +     G          
Sbjct: 33  ITDRKQADLARQQQEQHFKIALQTAKLGSWEHDLTTGVLTCSAQCKANFGLPPDAEFTHD 92

Query: 158 -IIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
            +   L           +  A   +  Y V       +     +I     +       + 
Sbjct: 93  TLFAALHPDDRPRVEAAIQRAIAQRTDYEVEERCYHPDGSLHWLIVRGRLVYDANDTPIR 152

Query: 217 LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
           +                          K+ +  L ++   +  A      G+WN++    
Sbjct: 153 M----------------VGVTLDITPQKQTEKTLRQSEERLRIAQQAANAGVWNWDIPTN 196

Query: 277 KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRH 336
           +   S   Y + G+       S++     +   ++     A          L+  F + H
Sbjct: 197 QVTWSAEYYRLYGLDPARTAPSYQNWLNSVVEQDRDRVHQAAQAALSDRIDLNVEFRILH 256

Query: 337 ASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
            +  + W+    Q +   +G    + GIA+D+T++   EK             E + + +
Sbjct: 257 PTEGERWLTAIGQTLFDDTGQPKRMTGIALDITQRKQAEKTLQR----YQLLSEYSRDIV 312

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           +   +  +++  N    KAYG   + L+      +        + +      E       
Sbjct: 313 LYISRKGQILEANQAAVKAYGYSRNELLNLQLADLRAIQTLPLLWQQFEQASEGGILFET 372

Query: 456 EIKLADSRWL--QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQ 513
             +  D      +++       G + V + I  +   +      ++  +     +   R 
Sbjct: 373 IHQRKDGSQFPVEVSAQSAVIDGEMGVLSVIRDISDRRRSEIALRKSEEWARLAIQIGRV 432

Query: 514 ILERQKTELSIANAKYQVEKERAETAN 540
              R        +       ER     
Sbjct: 433 GGWRLY-----LDQNLVEMDERLREIW 454


>gi|17229920|ref|NP_486468.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17131520|dbj|BAB74127.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 1627

 Score =  405 bits (1042), Expect = e-110,   Method: Composition-based stats.
 Identities = 101/576 (17%), Positives = 217/576 (37%), Gaps = 79/576 (13%)

Query: 230  LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMG 289
            +       R  +  +  +  L E+   +   L     G+W++N    +   S     + G
Sbjct: 806  VAYGIVALRNRRDRQIAEAALRESQERLSLTLEAVNLGIWDWNITTNQIIWSEGHARLFG 865

Query: 290  IPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
            I       ++ A    I+ +++       +   +        F +    G   WI+   +
Sbjct: 866  IESGKFDGTYEAFQACIYPEDRGGLAEVINSARQQKTDYSHEFRIISPDGNIHWIEGTGK 925

Query: 350  MMRTISGG-MNIIGIAMDLT---------------------------------------E 369
            +     G  + ++GI  D+T                                       E
Sbjct: 926  LYYNEMGEAVRMLGIVRDITSRKQIEATLQKINNELELRVAERTAELVNVNRQLQSELDE 985

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+    +  RL++ ++   +A++  + N ++ + N   +K +G     ++ G    
Sbjct: 986  RQRIEEALRISQVRLARILDIADDAIISINGNQQITLFNQGAEKIFGYSAEEII-GQRLD 1044

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
             +   +         +D  ++  ++   ++ + R +     C  DG        I+  + 
Sbjct: 1045 TLIPQRFTQTHRQHVADFGQAPSLA--RRMGERREIFG---CRQDGTEFPAEASISKFQL 1099

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
            ++                       + R  TE                     K EF++ 
Sbjct: 1100 DKEVFYTV-----------------ILRDVTERKQIER--------------MKDEFVSV 1128

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            +SHELRTPL +I G   ++   +     S +     +    S + L+ +IN+IL++ +IE
Sbjct: 1129 VSHELRTPLTSIHGSLGMLASGLLS-ADSEQGKRLLEIATDSTERLVRLINDILDIERIE 1187

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPIL 669
            + ++ +++++ DL  +I   + ++   A    +K+       +    D   I + L  +L
Sbjct: 1188 SGRVKMERESCDLSDLIESAVSIMQPLANKAGVKLSVS-SPSIQLWVDPDRIVQTLTNLL 1246

Query: 670  SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
            SN+IKF+     + +     G  +++T+ D G GIP   L+ I + F+ + +   ++  G
Sbjct: 1247 SNAIKFSTAEKTVWLVAQHYGDELLLTVKDNGRGIPADKLDSIFERFQQVDSSDSRNHDG 1306

Query: 730  FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             GLGLAI  ++   HGGR+   S  G+G+     +P
Sbjct: 1307 TGLGLAICQSIIQQHGGRIWAESVLGEGSNFYFTLP 1342



 Score = 62.7 bits (151), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/184 (12%), Positives = 56/184 (30%), Gaps = 12/184 (6%)

Query: 73   TRYAQQEKMTNQTSLMLT-EAIEIIFQNNNIKFDLASQKKAESML---GQLLAKTRFLSE 128
               A  +K+ N+  L +     E++  N  ++ +L  +++ E  L      LA+   +++
Sbjct: 949  QIEATLQKINNELELRVAERTAELVNVNRQLQSELDERQRIEEALRISQVRLARILDIAD 1008

Query: 129  SFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLS 188
              I+    N+ +   +       G    EII +   +    +  Q     +         
Sbjct: 1009 DAIISINGNQQITLFNQGAEKIFGYSAEEIIGQRLDTLIPQRFTQTHRQHVADFGQAPSL 1068

Query: 189  VNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDT 248
                     I                    +  F +   +   ++    R   + K+ + 
Sbjct: 1069 ARRMGERREIFGCRQDGTEFPA-----EASISKFQLDKEVFYTVIL---RDVTERKQIER 1120

Query: 249  ILLE 252
            +  E
Sbjct: 1121 MKDE 1124



 Score = 54.2 bits (129), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 33/350 (9%), Positives = 85/350 (24%), Gaps = 44/350 (12%)

Query: 64   ATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKT 123
            A  ++          +    +    LT  +         + D   ++ AE+ L +   + 
Sbjct: 777  AFGALNIYAAEANAFDSDEVKLLEELTADVAYGIVALRNRRD---RQIAEAALRESQERL 833

Query: 124  RFLSESF---ILLAQPNELVFASSTKNSHYIG-------KKIGEIIPELSRSRSRSKTVQ 173
                E+    I            S  ++   G                +           
Sbjct: 834  SLTLEAVNLGIWDWNITTNQIIWSEGHARLFGIESGKFDGTYEAFQACIYPEDRGGLAEV 893

Query: 174  MSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFIL 233
            ++ A   +  Y      +  +     I  +         E V +  +   I S   +   
Sbjct: 894  INSARQQKTDYSHEFRIISPDGNIHWIEGTGKLYYNEMGEAVRMLGIVRDITSRKQIEAT 953

Query: 234  F-----------------------SYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
                                        +  + +  +  L  + + +   L      + +
Sbjct: 954  LQKINNELELRVAERTAELVNVNRQLQSELDERQRIEEALRISQVRLARILDIADDAIIS 1013

Query: 271  FNFDNKKFHLSRSMYEIMGIPYENKTLS-----FRAIARLIHYDNKKICEIARSVTGKHV 325
             N + +    ++   +I G   E                  H  +      A S+  +  
Sbjct: 1014 INGNQQITLFNQGAEKIFGYSAEEIIGQRLDTLIPQRFTQTHRQHVADFGQAPSLARRMG 1073

Query: 326  KQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEK 375
            ++ +         G +   +      +        + I  D+TE+  +E+
Sbjct: 1074 ERREIFG--CRQDGTEFPAEASISKFQLDKEVFYTV-ILRDVTERKQIER 1120



 Score = 47.3 bits (111), Expect = 0.010,   Method: Composition-based stats.
 Identities = 23/203 (11%), Positives = 56/203 (27%), Gaps = 11/203 (5%)

Query: 302 IARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNI 360
           +  L+  + ++        +    KQ    F +    G   W+   A  +R    G +  
Sbjct: 569 VYSLVVPECQQAFRQLNE-SVCQGKQGTLEFEIITCRGNRRWMATHAVPVRNEKDGNLVQ 627

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
           + I  D+T+    E      ++ L    +C    +   D+++ L                
Sbjct: 628 LSITRDVTQYKQAELEIKRINRTLQTLSDCNQLVIRTQDESELLQKVCQILVDVGNYRLA 687

Query: 421 VLVPGNARSI--IQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTI 478
            +      +   I         E        +   +   +      ++        G T 
Sbjct: 688 WVAFAENDAEKSIHPVAQAGYEEGYLQSLNLTWADTVRGQGPTGTAIRT-------GKTA 740

Query: 479 SVGTDITLLKHNQAQLRESKRRL 501
            +   +T  +    + + + R  
Sbjct: 741 IIQNILTDPRFEIWRCQANNRGY 763


>gi|182411917|ref|YP_001816983.1| multi-sensor hybrid histidine kinase [Opitutus terrae PB90-1]
 gi|177839131|gb|ACB73383.1| multi-sensor hybrid histidine kinase [Opitutus terrae PB90-1]
          Length = 1313

 Score =  405 bits (1041), Expect = e-110,   Method: Composition-based stats.
 Identities = 107/546 (19%), Positives = 226/546 (41%), Gaps = 47/546 (8%)

Query: 236  YYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENK 295
             + + ++ +  +  L  ++  +  AL   + G++ +N      + S  ++ ++G  +   
Sbjct: 507  LHAENEERRRIEARLKVSDERLRLALDSTQIGIFEWNVAAGHVYYSSGLWAMLGYEHSRM 566

Query: 296  TLSFRAIARLIHYDNKKICEIARSVTGKHVKQL-DQIFHMRHASGADIWIQVRAQMM--R 352
            + +  A   LIH D+              V    +  F ++   G   W+  R++ +   
Sbjct: 567  SATVAAWQSLIHPDDLPTYRRRVDSQLNGVASFIEPEFRVKSHGGEWRWVYTRSKTVAAS 626

Query: 353  TISGGMNIIGIAMDLTEKYHLEKRYAEAD---QRLSKAIECTSEALVLWDKNDRLVMCNA 409
            T      IIG   D+T +   E+   E+    ++LS     T   +++      +   N 
Sbjct: 627  TSGRPTRIIGTVQDITARREAEQALRESQAETRKLSLVAAKTDNPVLIISPAGSIEWVNE 686

Query: 410  NYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINE 469
            ++ +        +V  +    +             ++ +       +  +A  R      
Sbjct: 687  SFSRVMEYSLDEVVGRSPIDFV-----------AAAETDARTLQEIDAAIAQGRAHS--- 732

Query: 470  WCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKY 529
                       G  +T  K  +      + +          +  ++E   T         
Sbjct: 733  -----------GDVVTHSKRGRKYHLRVELQPVRNDAGQLQNFIVIETDITARVDTELAL 781

Query: 530  QVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIH 589
            +  K  A+ A++ KS+FLA MSHE+RTP+N ++G + ++ +         +  ++   I 
Sbjct: 782  RRAKTEADEASRAKSDFLASMSHEIRTPMNGVIGMTSLLMETDLSP----EQRDFVNTIR 837

Query: 590  YSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP 649
             SG+ LL +IN+IL+ SKIE+ K+ ++    +L   + E + L    A +K++++   I 
Sbjct: 838  TSGEALLTIINDILDFSKIESGKMDLEHLPFELATCLEESLDLFALQASAKHLELAYHIA 897

Query: 650  SELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCV---------IITIA 698
             ++      D   +++I+  +++N++KFT+  G + I   +    V            + 
Sbjct: 898  PDVPEWIIGDITRLRQIVVNLVNNAVKFTSA-GSIAIEVRRRPPTVPANLKRFPLEFVVR 956

Query: 699  DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
            DTGIGIP   L+++ + F  + +   +  GG GLGLAI   L+ L GG +++ S+ G+G+
Sbjct: 957  DTGIGIPAERLDRLFKAFSQVDSSTTRKYGGTGLGLAICQRLSILMGGGIRVESKVGEGS 1016

Query: 759  IVTICM 764
                 +
Sbjct: 1017 SFIFTI 1022



 Score = 79.3 bits (194), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 47/365 (12%), Positives = 100/365 (27%), Gaps = 32/365 (8%)

Query: 49  NQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLAS 108
            + +P +++   + IA    + V      +                    N  +  +   
Sbjct: 465 RRYLPELALGAGIGIALLLGLSVHLARGARAGQH-----------AAELSNKKLHAENEE 513

Query: 109 QKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSR- 164
           +++ E+ L     + R     ++  I            S+     +G +   +   ++  
Sbjct: 514 RRRIEARLKVSDERLRLALDSTQIGIFEWNVAAGHVYYSSGLWAMLGYEHSRMSATVAAW 573

Query: 165 -SRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFS 223
            S      +      +D Q   V S   P                  WR   T      +
Sbjct: 574 QSLIHPDDLPTYRRRVDSQLNGVASFIEPEF--------RVKSHGGEWRWVYTRSKTVAA 625

Query: 224 IISALLLFILFSYYRQAKKNKENDTILLEAN---ICVETALSRGRCGLWNFNFDNKKFHL 280
             S      +    +     +E +  L E+      +    ++    +   +       +
Sbjct: 626 STSGRP-TRIIGTVQDITARREAEQALRESQAETRKLSLVAAKTDNPVLIISPAGSIEWV 684

Query: 281 SRSMYEIMGIPYENKTL-SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASG 339
           + S   +M    +     S          D + + EI  ++        D +       G
Sbjct: 685 NESFSRVMEYSLDEVVGRSPIDFVAAAETDARTLQEIDAAIAQGRAHSGDVV--THSKRG 742

Query: 340 ADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
               ++V  Q +R  +G   N I I  D+T +   E     A     +A    S+ L   
Sbjct: 743 RKYHLRVELQPVRNDAGQLQNFIVIETDITARVDTELALRRAKTEADEASRAKSDFLASM 802

Query: 399 DKNDR 403
               R
Sbjct: 803 SHEIR 807


>gi|75906463|ref|YP_320759.1| multi-component transcriptional regulator [Anabaena variabilis ATCC
            29413]
 gi|75700188|gb|ABA19864.1| multi-component transcriptional regulator, winged helix family
            [Anabaena variabilis ATCC 29413]
          Length = 1629

 Score =  405 bits (1041), Expect = e-110,   Method: Composition-based stats.
 Identities = 99/576 (17%), Positives = 218/576 (37%), Gaps = 79/576 (13%)

Query: 230  LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMG 289
            +       R  +  +  +  L E+   +   L     G+W++N    +   S     + G
Sbjct: 808  VAYGIVALRNRRDRQIAEAALRESQERLALTLEAVNLGIWDWNITTNQIIWSEGHARLFG 867

Query: 290  IPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
            I  E    ++ A    I+ +++       +   +        F +    G   WI+   +
Sbjct: 868  IESEKFDGTYEAFQACIYPEDRGGLAEVINSARQQKTDYSHEFRIISPDGNIHWIEGTGK 927

Query: 350  MMRTISGG-MNIIGIAMDLT---------------------------------------E 369
            +     G  + ++GI  D+T                                       E
Sbjct: 928  LYYNEMGEAVRMLGIVRDITSRKQIEATLQKVNNELELRVAERTAELVNVNRQLQSELDE 987

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+    +  RL++ ++   +A++  + N ++ + N   +K +G     ++ G    
Sbjct: 988  RQRVEEALRISQVRLARILDIADDAIISINGNQQITLFNQGAEKIFGYSAEAII-GQRLD 1046

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
             +   +         +D  ++ +++   ++ + R +        DG        I+  + 
Sbjct: 1047 TLIPQRFTQAHRQHVADFGQAPNLA--RRMGERREIFG---RRQDGTEFPAEASISKFQL 1101

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
            ++                       + R  TE                     K EF++ 
Sbjct: 1102 DKEVFYTV-----------------ILRDITERKQIER--------------MKDEFVSV 1130

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            +SHELRTPL +I G   ++   +     S +     +    S + L+ +IN+IL++ +IE
Sbjct: 1131 VSHELRTPLTSIHGSLGMLASGLL-PADSEQGRRLLEIATDSTERLVRLINDILDIERIE 1189

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPIL 669
            + ++ +++++ +L  +I   + ++   A    +K+       +    D   I + L  +L
Sbjct: 1190 SGRVKMERESCNLTDLIESAVSIMRPLANKAGVKLSVS-HPSIQLWVDPDRIVQTLTNLL 1248

Query: 670  SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
            SN+IKF+     + +   + G  +++T+ D G GIP   L+ I + F+ + +   ++  G
Sbjct: 1249 SNAIKFSTAEKTVWLVAQQYGDELLVTVKDNGRGIPADKLDSIFERFQQVDSSDSRNHDG 1308

Query: 730  FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             GLGLAI  ++   HGGR+   S   +G+     +P
Sbjct: 1309 TGLGLAICQSIVQQHGGRIWAESVLSEGSNFYFTLP 1344



 Score = 62.3 bits (150), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/184 (11%), Positives = 55/184 (29%), Gaps = 12/184 (6%)

Query: 73   TRYAQQEKMTNQTSLMLT-EAIEIIFQNNNIKFDLASQKKAESML---GQLLAKTRFLSE 128
               A  +K+ N+  L +     E++  N  ++ +L  +++ E  L      LA+   +++
Sbjct: 951  QIEATLQKVNNELELRVAERTAELVNVNRQLQSELDERQRVEEALRISQVRLARILDIAD 1010

Query: 129  SFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLS 188
              I+    N+ +   +       G     II +   +    +  Q     +         
Sbjct: 1011 DAIISINGNQQITLFNQGAEKIFGYSAEAIIGQRLDTLIPQRFTQAHRQHVADFGQAPNL 1070

Query: 189  VNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDT 248
                     I                    +  F +   +   ++    R   + K+ + 
Sbjct: 1071 ARRMGERREIFGRRQDGTEFPA-----EASISKFQLDKEVFYTVIL---RDITERKQIER 1122

Query: 249  ILLE 252
            +  E
Sbjct: 1123 MKDE 1126



 Score = 59.2 bits (142), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/235 (10%), Positives = 67/235 (28%), Gaps = 8/235 (3%)

Query: 146  KNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRV 205
              +  I     +        R  S    +       + Y+          G +  I SR 
Sbjct: 891  GLAEVINSARQQKTDYSHEFRIISPDGNIHWIEGTGKLYYNEMGEAVRMLGIVRDITSRK 950

Query: 206  PLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGR 265
             +    ++      +  +  +A L+ +      +  + +  +  L  + + +   L    
Sbjct: 951  QIEATLQKVNNELELRVAERTAELVNVNRQLQSELDERQRVEEALRISQVRLARILDIAD 1010

Query: 266  CGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLS-----FRAIARLIHYDNKKICEIARSV 320
              + + N + +    ++   +I G   E                  H  +      A ++
Sbjct: 1011 DAIISINGNQQITLFNQGAEKIFGYSAEAIIGQRLDTLIPQRFTQAHRQHVADFGQAPNL 1070

Query: 321  TGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEK 375
              +  ++ +         G +   +      +        + I  D+TE+  +E+
Sbjct: 1071 ARRMGERREIFGR--RQDGTEFPAEASISKFQLDKEVFYTV-ILRDITERKQIER 1122



 Score = 48.4 bits (114), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/100 (15%), Positives = 35/100 (35%), Gaps = 2/100 (2%)

Query: 302 IARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNI 360
           +  L+  + +++       +    +Q    F +    G   W+   A  +R    G +  
Sbjct: 571 VYSLVVPEYQQVFRQLNE-SVCQGEQGTLEFEIITCRGNRRWMATHAVPVRNETDGNLVQ 629

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDK 400
           + I  D+T+    E      ++ L    +C    +   D+
Sbjct: 630 LSITRDVTQYKQAELEIKRINRTLQTLSDCNQLVIRTQDE 669


>gi|158334364|ref|YP_001515536.1| serine/threonine protein kinase and signal transduction histidine
            kinase (STHK) with GAF and PAS/PAC sensor [Acaryochloris
            marina MBIC11017]
 gi|158304605|gb|ABW26222.1| serine/threonine protein kinase and signal transduction histidine
            kinase (STHK) with GAF and PAS/PAC sensor [Acaryochloris
            marina MBIC11017]
          Length = 2817

 Score =  404 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 134/695 (19%), Positives = 279/695 (40%), Gaps = 49/695 (7%)

Query: 95   IIFQNNNIKFDLASQKKAESMLGQLLAK----TRFLSESFILLAQPNELVFASSTKNSHY 150
             +     + FD++ +K  E  L    A+        +   + +      +   +      
Sbjct: 1856 QLQHLEGVIFDISDRKHTELALQLSEARANAAFDQAALGIVEVNNQTGKISRVNNYMCDL 1915

Query: 151  IGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRL 210
            +G    E++ +     +    +  S          +    + + +     +     +  +
Sbjct: 1916 LGYSRLELLQKTVADITHPDDLSESYQ----LMQLLQRGKIGNFTTEERYLRQDGGI--I 1969

Query: 211  WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
            W       V   +  +   L ++    +     K  +  L ++              ++ 
Sbjct: 1970 WSSTTVTLVEMGNGEAQYSLGMI----QDISDRKAAELALKDSQAQFRRMTENVPGMIYR 2025

Query: 271  F----NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK 326
            +    +  N+  ++S  + EI  I  E        +   +H D+    +       + ++
Sbjct: 2026 YVFHPDGQNELTYISSQVREIFEIEPEVALQDASKLWERVHPDDLAFVQSEIQGFHETLQ 2085

Query: 327  QLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
                   +        WIQ+ A++ R  +G     G+A+D++++   E     ++QR  +
Sbjct: 2086 STPIECRLLLPQKGLCWIQLIARIERLDNGDTVWDGVALDISDRKAAEANLRFSEQRFRR 2145

Query: 387  AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
            AIE     ++L  ++  ++  N  + +  G     +    A +     +    +      
Sbjct: 2146 AIEDAPFPIMLHAEDGEVLQINTTWTELTGYTHPEIPSTAAWAERAYGKDAARVLKEVMA 2205

Query: 447  -----PERSQDMSKEIKLADS---RWLQINE--WCTHDGGTISVGTDITLLKHNQAQLRE 496
                   R ++    I+  +    RW   +       DG  I +   +     +  Q R+
Sbjct: 2206 KKYTLTSRWEEGEFTIQTKNGDQCRWQFSSAPLGVLPDGRRIVISMAV-----DVTQRRQ 2260

Query: 497  SKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
            ++  L+     L+     LE++   +       Q+ KE+A++AN+ KSEFLA MSHELRT
Sbjct: 2261 TEDELEQANQQLAEYSHTLEQR---VEERTQALQIAKEQADSANQAKSEFLANMSHELRT 2317

Query: 557  PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
            PLN ILG+++++ +         K  +  + IH  G HLL++I++IL+++KIE  K+ + 
Sbjct: 2318 PLNGILGYAQILNRS---TTLIDKERDGIKVIHQCGSHLLSLIDDILDLAKIEARKLELV 2374

Query: 617  KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIK 674
              +  L  +++  + +    AQ K I      P +L      D++ ++++L  +L N++K
Sbjct: 2375 PVDTYLPAVLHSVVEICKIKAQQKGIDFVY-APKDLPIGVRVDEKCLRQVLINLLGNAVK 2433

Query: 675  FTNNNGKMMIRTSK-----IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
            FT +NG + +             ++  + DTGIGI ++ L K+   FE +    D+   G
Sbjct: 2434 FT-DNGTVTLNVEVLSTSNQEASLLFQVMDTGIGIAETDLSKLFDAFEQV-GARDRRAEG 2491

Query: 730  FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
             GLGLAIS  +  L G  +++ SQ G G+  +  +
Sbjct: 2492 TGLGLAISQRIVQLMGHSIEVKSQVGIGSQFSFRL 2526



 Score =  163 bits (413), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 66/506 (13%), Positives = 154/506 (30%), Gaps = 58/506 (11%)

Query: 44   FFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNN-- 101
              S      P    +F   IA   + K      +   +  +    L E + +   +N   
Sbjct: 1550 GQSWEKLYSPAEVQLFQ-EIAFPILAKTGRWSGEATAI-RKDGSSLDEEVSLFLLDNGKL 1607

Query: 102  --IKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEII 159
              I  D++ +K AE+   +LLA     S   I+      ++ + +   +   G    E I
Sbjct: 1608 ICICRDISDRKIAEAN-SRLLASVVESSNDVIVTKNLEGIITSWNQAATDLFGYSEAEAI 1666

Query: 160  PELSRSRSRSKTVQMSEASLD-----QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREE 214
             +                 L      +   +  +V L      I I  +  P        
Sbjct: 1667 GQSILMLFPPDRHHEETHILTCLKNKKSVENFETVRLHKQGYPIDISVTISP-------- 1718

Query: 215  VTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRG--------RC 266
                    +    ++        R  ++ K  +  L ++       L+            
Sbjct: 1719 ------LVNSQGKVIGASKI--VRDIRERKIAEVALRQSESKFRNLLTNLDGVVYRCQND 1770

Query: 267  GLWNFNFDNKKFHLSRSMYEIMGIPYENKT-LSFRAIARLIHYDNKKICEIARSVTGKHV 325
              W          +S ++  + G P  +      R+ A +IH  + +  +   +    H 
Sbjct: 1771 AHWTME------FMSDAVTALSGYPVADFIDNRHRSYASIIHPGDVEWVDQVINEQLTHH 1824

Query: 326  KQLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRL 384
            +     + + H  G+  W+  + + +        ++ G+  D++++ H E     ++ R 
Sbjct: 1825 QPFSLEYRVIHRDGSIRWVTEKGKGIFNADHQLQHLEGVIFDISDRKHTELALQLSEARA 1884

Query: 385  SKAIECTSEALVLWDKN-DRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIE-Y 442
            + A +  +  +V  +    ++   N       G     L+      I          +  
Sbjct: 1885 NAAFDQAALGIVEVNNQTGKISRVNNYMCDLLGYSRLELLQKTVADITHPDDLSESYQLM 1944

Query: 443  RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
            +     +  + + E +           +   DGG I   T +TL++    + + S   ++
Sbjct: 1945 QLLQRGKIGNFTTEER-----------YLRQDGGIIWSSTTVTLVEMGNGEAQYSLGMIQ 1993

Query: 503  ATINDLSTSRQILERQKTELSIANAK 528
               +D   +   L+  + +       
Sbjct: 1994 DI-SDRKAAELALKDSQAQFRRMTEN 2018



 Score =  104 bits (259), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 72/569 (12%), Positives = 155/569 (27%), Gaps = 72/569 (12%)

Query: 36   SIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEA--- 92
             + + L        Q+ P   +   +   +     +  +      +  +  + +      
Sbjct: 1434 DLATDLPILDDFLQQSQPRSLLCLPILYQSHLRGLLYLQNRNMAGVFTRDRVTVLNFLCS 1493

Query: 93   -IEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYI 151
               I  +N  +   LA        L   + ++       IL           +  ++   
Sbjct: 1494 QAAISLENARLFESLA--------LKSSIIESAVD-GMAIL---EGGKFIYLNQFHTTLF 1541

Query: 152  GKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLW 211
            G +  E++ +              E  L Q+    +       SG    I      L   
Sbjct: 1542 GYEPNELLGQSWEKLYSPA-----EVQLFQEIAFPILAKTGRWSGEATAIRKDGSSLDE- 1595

Query: 212  REEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF 271
                  EV  F + +  L+ I     R     K  +      +  + + +      +   
Sbjct: 1596 ------EVSLFLLDNGKLICIC----RDISDRKIAE----ANSRLLASVVESSNDVIVTK 1641

Query: 272  NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
            N +      +++  ++ G          ++I  L   D         +         +  
Sbjct: 1642 NLEGIITSWNQAATDLFGYSEAEAIG--QSILMLFPPDRHHEETHILTCLKNKKSVENFE 1699

Query: 332  -FHMRHASGADIWIQVRAQMMRTISGGMNIIG---IAMDLTEKYHLEKRYAEADQRLSKA 387
               + H  G  I I V    +    G   +IG   I  D+ E+   E    +++ +    
Sbjct: 1700 TVRL-HKQGYPIDISVTISPLVNSQG--KVIGASKIVRDIRERKIAEVALRQSESKFRNL 1756

Query: 388  IECTSEALVLW--DKNDRLVMCNANYQKAYGLPDHVLVPGNAR---SIIQDAQTRPIIEY 442
            +      +     D +  +   +       G P    +    R   SII       + + 
Sbjct: 1757 LTNLDGVVYRCQNDAHWTMEFMSDAVTALSGYPVADFIDNRHRSYASIIHPGDVEWVDQV 1816

Query: 443  RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLK 502
                    Q  S E +               DG    V      + +   QL+  +  + 
Sbjct: 1817 INEQLTHHQPFSLEYR-----------VIHRDGSIRWVTEKGKGIFNADHQLQHLEGVIF 1865

Query: 503  ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
               +   T          +LS A A      ++A       +    K+S  +   +  +L
Sbjct: 1866 DISDRKHT------ELALQLSEARA--NAAFDQAALGIVEVNNQTGKIS-RVNNYMCDLL 1916

Query: 563  GF--SEVIKKEIFGELGSVKYYEYAQDIH 589
            G+   E+++K +          E  Q + 
Sbjct: 1917 GYSRLELLQKTVADITHPDDLSESYQLMQ 1945


>gi|117926684|ref|YP_867301.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117610440|gb|ABK45895.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 2654

 Score =  404 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 120/684 (17%), Positives = 246/684 (35%), Gaps = 57/684 (8%)

Query: 104  FDLASQKKAESMLGQLLAKTRF---LSESFILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
             D+  +K  E+ L +   ++R         I            +   +  +G +  E+  
Sbjct: 1413 QDITERKLMEAALSESEERSRLILTSVTDGIFGMDAQGCTTFVNPAAAAMLGYREDELTG 1472

Query: 161  ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHN--SGSILIINSRVPLLRLWR--EEVT 216
                         +  +  D  PY      +      G++ +I   V   +         
Sbjct: 1473 -------MLMHDTVHHSHPDGSPYAHEQCPMRAAFAEGAVRVITDEVLWHKDGHAFPVEY 1525

Query: 217  LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
              V        +   ++   +R   + K ++  L E+   +  AL     GLW++  +  
Sbjct: 1526 TAVPMQKRGKRVGAVVV---FRDITQRKADEKRLAESEQRLVLALQGANLGLWDWQAETG 1582

Query: 277  KFHLSRSMYEIMGIPYENKTL----SFRAIARLIHYDNKKICEIARS-VTGKHVKQLDQI 331
                +     ++G   E        +F     L+H D+    +           ++    
Sbjct: 1583 SLITNDIWSAMIGYTKEALDARYGNTFERWLALVHADDLPETQQRLEAHLRGETEEFRAE 1642

Query: 332  FHMRHASGADIWIQVRAQ-MMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
            + M   SG   WI    + +     G    ++GI  D+       ++   A+    +A++
Sbjct: 1643 YRMLTESGEWKWILDIGRGVEWDEQGVAKRLVGIHQDIDALKRSAEQLRLANFLSDQALD 1702

Query: 390  CTSEALVLW--DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDP 447
             +            D     +      +G P     P     ++ +         + +  
Sbjct: 1703 LSQAGYWHVPLTAEDGYYNSSERAAAVFGDPP---RPDWRYHVMDEWFANVEAGDKLASA 1759

Query: 448  ERSQDMSKEIKLADSRWLQINEWCTH-DGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
                + +  I     R+  I  +    DG  + +     + +  Q +  +          
Sbjct: 1760 ATLANFTAAINGTVPRYDSIYAYKRPLDGKVVWIHAMGHVERDEQGKATDMYGITMDITA 1819

Query: 507  DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
                             +A    Q  KE A+ AN+ KS+FLA MSHE+RTP+NAI+G S 
Sbjct: 1820 S---------------KLAADAIQQAKEIADAANQAKSDFLANMSHEIRTPMNAIIGMSH 1864

Query: 567  VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
            +  +         +   Y   +  S + LL +IN+IL+ SKIE  K++++  +  L  ++
Sbjct: 1865 LALQTDLNG----RQRNYITKVKRSAEALLGIINDILDFSKIEAGKLTMEFIDFRLEDVL 1920

Query: 627  NEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMI 684
            +    L+G  A+ K +++   +P  L      D   + ++L  + +N++KFT  +G +++
Sbjct: 1921 DNLSNLVGLKAEEKGLELHFSLPPGLHTALKGDPLRLGQVLINLGNNAVKFT-AHGDVVV 1979

Query: 685  RTSKIGQ-----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDA 739
            +  ++ +      +  ++ D+GIG+       + + F        +  GG GLGLAIS  
Sbjct: 1980 KVQQLERTTERIKLYFSVKDSGIGMTPEQKGLLFKSFSQADASTTRKFGGTGLGLAISKR 2039

Query: 740  LTNLHGGRLKIISQEGKGTIVTIC 763
            L  +  G + + S   +G+     
Sbjct: 2040 LVEMMEGEIDVDSVPEQGSDFHFS 2063



 Score =  179 bits (454), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 60/553 (10%), Positives = 164/553 (29%), Gaps = 50/553 (9%)

Query: 41   LFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNN 100
            L S++++ N  + ++++  L+ +A +    +                      +++   +
Sbjct: 1117 LTSYYANRNALLWVLAVTLLLSLALTVFSALLGER---------------ANRQLLKSKD 1161

Query: 101  NIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
             ++  + S+  A +   + L        + +++      +   +      + +    ++ 
Sbjct: 1162 ELEDMVQSRTMALNRASEGLNLALSSMSNGLIMLDQALTILIVNGHYLSLL-QLPETLVG 1220

Query: 161  EL----SRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
                     R             +      L       SG+I +       + + +    
Sbjct: 1221 VGKPIEPVVRYLVVRGDYGAVDEESMVRQQLQSMRQQQSGNIELNTPDRRSIDVHQAPTE 1280

Query: 217  LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
               + F++                 + K        +   +  AL  G  G W+ N    
Sbjct: 1281 TGGMVFTLT-------------DVTERKR-------SEERLNLALEGGSLGYWDVNLITD 1320

Query: 277  KFHLSRSMYEIMGIPYENK-TLSFRAIARLIHYDNKKIC-EIARSVTGKHVKQLDQIFHM 334
            +  +++   E++G   +    +  +     IH +++++            + + +  +  
Sbjct: 1321 EMVVNQRWAEMLGYGLDEISPVLRQTWLETIHPEDRELVLARGNDYRAGVLDRYEVEYRA 1380

Query: 335  RHASGADIWIQVRAQMMR--TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS 392
            R   G   W+  R  +M          ++G   D+TE+  +E   +E+++R    +   +
Sbjct: 1381 RAKDGTARWLVSRGAIMEHQEDGQPRRMVGTVQDITERKLMEAALSESEERSRLILTSVT 1440

Query: 393  EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQD 452
            + +   D        N       G  +  L        +  +            P R+  
Sbjct: 1441 DGIFGMDAQGCTTFVNPAAAAMLGYREDELTGMLMHDTVHHSHPDGSPYAHEQCPMRAAF 1500

Query: 453  MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
                +++     L        DG    V      ++    ++         T       R
Sbjct: 1501 AEGAVRVITDEVLWH-----KDGHAFPVEYTAVPMQKRGKRVGAVVVFRDITQRKADEKR 1555

Query: 513  QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS-EVIKKE 571
                 Q+  L++  A   +   +AET +   ++  + M    +  L+A  G + E     
Sbjct: 1556 LAESEQRLVLALQGANLGLWDWQAETGSLITNDIWSAMIGYTKEALDARYGNTFERWLAL 1615

Query: 572  IFGELGSVKYYEY 584
            +  +         
Sbjct: 1616 VHADDLPETQQRL 1628


>gi|110639274|ref|YP_679483.1| PAS/PAC sensor hybrid histidine kinase [Cytophaga hutchinsonii ATCC
            33406]
 gi|110281955|gb|ABG60141.1| PAS/PAC sensor hybrid histidine kinase [Cytophaga hutchinsonii ATCC
            33406]
          Length = 1324

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 128/675 (18%), Positives = 243/675 (36%), Gaps = 55/675 (8%)

Query: 104  FDLASQKKAESMLG---QLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
             D++ +K+ E  L    Q          S I +   N      +        +    II 
Sbjct: 409  KDISERKRTEQALQDQKQFYEDILNNIPSDIAVFNTNYQYLYVNPAAIKDE-ETRKWIIG 467

Query: 161  ELSRS--RSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
            +      R R K   ++                       +  +    +  + R+     
Sbjct: 468  KTDLDYCRYRGKDDSLAIMRRKNHDILHEFKK--PIEWEDVFTDKDGNVSYVLRKFH--- 522

Query: 219  VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
                     + + I         + K+    L ++       +     G+W+++  +   
Sbjct: 523  -PVLDENDNIKIIIGNGINI--TEIKQVQEKLAKSEELYRLVIHAANDGIWDWDIASGSL 579

Query: 279  HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS 338
            +LS     ++G   E       +  + +H D+  I +       +  K  +      H  
Sbjct: 580  YLSERWKSMLGYTDETLANHISSWEKTMHPDDLSIAKEILQNHFEKRKPYNYTLRYLHVD 639

Query: 339  GADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL 397
            G+  WI  R   +R   G    ++G   D+T+    E++  E +++L      + +A  L
Sbjct: 640  GSIRWIMCRGFAIRNRKGEPYRMVGSCTDVTDTQIAEEKLKENEEKLQAIFNHSHDAKFL 699

Query: 398  WDK-NDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKE 456
             D   ++++  N    + +       +     + +   +  P+ +   +D +        
Sbjct: 700  VDPCTNKIIEFNKRTLELFETDKPDTLYTIPLTSL---RKYPLTDAELADTQNQFKQL-- 754

Query: 457  IKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
                   W Q   + T              +  N+ ++   +                  
Sbjct: 755  -----GYWNQEVLYITQKKNEFWGNIVAKTIFINKKEVILVRIT---------------- 793

Query: 517  RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGEL 576
               +E      +    K+ AE + K K  FLA MSHE+RTP+N ILG +E+I +      
Sbjct: 794  -DISENKKIEQELIKAKQIAEESTKAKEMFLANMSHEIRTPMNGILGMAELISRTSLDV- 851

Query: 577  GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSS 636
                  ++ Q I  S  +LL +IN+IL+++KIE+ K++I++   D+  +I   I+ +   
Sbjct: 852  ---TQKKHVQLIKNSADNLLIIINDILDIAKIESGKLTIEQIPFDICEVIKSAIQTLTYK 908

Query: 637  AQSKNIKIEKKI--PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-----KI 689
            A+ K I +              D   + + L  +++N+IKFT  NG + I          
Sbjct: 909  AEEKGIDLIIHPIKLDHRVVIGDPFRLTQALLNLINNAIKFT-ENGSVEISGRIPHSSST 967

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
                  T+ DTGIGIP+  L+ I + F        +  GG GLGL IS  L  + GG + 
Sbjct: 968  DITFEFTVKDTGIGIPQEKLDSIFEGFTQASPDTSRKYGGTGLGLTISKNLIQMQGGNIW 1027

Query: 750  IISQEGKGTIVTICM 764
            + S  GKG+     +
Sbjct: 1028 VESVVGKGSKFIFSI 1042



 Score = 92.0 bits (227), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 52/452 (11%), Positives = 144/452 (31%), Gaps = 40/452 (8%)

Query: 103 KFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPEL 162
             D+ S K++E  +  LL +     + FI +          +  +++   + I E     
Sbjct: 288 ATDITSTKESEEKIY-LLKELLNQLDEFIQVIDKEGNFVFINESSANRFQRTIEEFETLN 346

Query: 163 SRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFF 222
            +         +  +  +   +             +L      P    +  E +++    
Sbjct: 347 IK--------NIVPSFYNNMTWEEQFDFFKQKQNFLLESTHTKPDKTSYPIESSVKYT-- 396

Query: 223 SIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSR 282
              +      + S+ +   + K  +  L +     E  L+     +  FN + +  +++ 
Sbjct: 397 ---TVHEKEYIISFSKDISERKRTEQALQDQKQFYEDILNNIPSDIAVFNTNYQYLYVNP 453

Query: 283 SMYE-------IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKH-VKQLDQIFHM 334
           +  +       I+G                   D+  I             K ++     
Sbjct: 454 AAIKDEETRKWIIG------KTDLDYCRYRGKDDSLAIMRRKNHDILHEFKKPIEWEDVF 507

Query: 335 RHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
               G   ++  +   +         IIG  +++TE   ++++ A++++     I   ++
Sbjct: 508 TDKDGNVSYVLRKFHPVLDENDNIKIIIGNGINITEIKQVQEKLAKSEELYRLVIHAAND 567

Query: 394 ALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG-NARSIIQDAQTRPIIEYRTS---DPER 449
            +  WD     +  +  ++   G  D  L    ++           I +       +  +
Sbjct: 568 GIWDWDIASGSLYLSERWKSMLGYTDETLANHISSWEKTMHPDDLSIAKEILQNHFEKRK 627

Query: 450 SQDMSKEIKLADS--RWLQINEWCTHDG-----GTISVGTDITLLKHNQAQLRESKRRLK 502
             + +      D   RW+    +   +        +   TD+T  +  + +L+E++ +L+
Sbjct: 628 PYNYTLRYLHVDGSIRWIMCRGFAIRNRKGEPYRMVGSCTDVTDTQIAEEKLKENEEKLQ 687

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           A  N    ++ +++    ++   N +     E
Sbjct: 688 AIFNHSHDAKFLVDPCTNKIIEFNKRTLELFE 719



 Score = 50.4 bits (119), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/199 (9%), Positives = 47/199 (23%), Gaps = 18/199 (9%)

Query: 236 YYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENK 295
           Y       KE++  +      +       +      + +     ++ S            
Sbjct: 287 YATDITSTKESEEKIYLLKELLNQLDEFIQV----IDKEGNFVFINES-------SANRF 335

Query: 296 TLSFRAIARL----IHYDNKKICEIARS-VTGKHVKQLDQIFHMRHASGADIWIQVRAQM 350
             +      L    I                 K  +                 I+   + 
Sbjct: 336 QRTIEEFETLNIKNIVPSFYNNMTWEEQFDFFKQKQNFLLESTHTKPDKTSYPIESSVK- 394

Query: 351 MRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNAN 410
             T+     II  + D++E+   E+   +  Q     +      + +++ N + +  N  
Sbjct: 395 YTTVHEKEYIISFSKDISERKRTEQALQDQKQFYEDILNNIPSDIAVFNTNYQYLYVNPA 454

Query: 411 YQKAYGLPDHVLVPGNARS 429
             K        ++      
Sbjct: 455 AIKD-EETRKWIIGKTDLD 472


>gi|325103345|ref|YP_004272999.1| multi-sensor hybrid histidine kinase [Pedobacter saltans DSM 12145]
 gi|324972193|gb|ADY51177.1| multi-sensor hybrid histidine kinase [Pedobacter saltans DSM 12145]
          Length = 1304

 Score =  402 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 131/657 (19%), Positives = 253/657 (38%), Gaps = 55/657 (8%)

Query: 118 QLLAKTRFLSESFI---LLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQM 174
               + R   E+ I    +   +  + A + K    +     E+     R       + +
Sbjct: 291 NSERRFRNFFENAIGLMSMHDMDGNIIAVNEKGRDILHYTAEEVKKLNLRQLVPPHHIPL 350

Query: 175 SEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILF 234
            E+ L++   +        +   +L      P+  L+   +            ++   L 
Sbjct: 351 LESYLERIARNKE-----DSDMMVLQTKDGTPIYWLYHNMLE---TDLEGKPYVVSTAL- 401

Query: 235 SYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYEN 294
                     + +  LL     +E   +  + G W  + +  K + S     I G+  ++
Sbjct: 402 ----NMTDRIQLEHDLLHTKQILEQTNAVAQVGGWEVDLEKNKVYWSDPTKIIHGVK-KD 456

Query: 295 KTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTI 354
                 +       ++KK                D    +R   G  IW++V+       
Sbjct: 457 FVPDLDSAIGFFEPESKKKVREIFEQAVVKGTSYDIELRLRKQDGESIWVRVKGVPEFEE 516

Query: 355 SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKA 414
                + GI  D+ +   L       +  L   +     ++ ++D++   V  +  + + 
Sbjct: 517 GKCKRVFGIIQDINQSKTLYLELERKEAMLQAFVNYVPASVAMFDRDFNYVFVSNQWIED 576

Query: 415 YGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHD 474
           +      L+  N   +           Y+ +   +    + EI                 
Sbjct: 577 FHQGKADLLNRNFFELFPHIPQERKKIYKEALEGKPYKNTNEIISVGG------------ 624

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
                    I+  +H   ++R          +       I  +  +E    N + +  K 
Sbjct: 625 ---------ISEPQHFNWEVR-----PWHLRDGGIGGIIIFTQNISESVKVNEELKKAKT 670

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
            A+ A+K KSEFLA MSHE+RTPLN ++GFS+++ K       +    +Y   I+ SG  
Sbjct: 671 FADLASKAKSEFLANMSHEIRTPLNGVIGFSDLLLKTPL----NETQKQYLNYINESGNS 726

Query: 595 LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF- 653
           LL++IN+IL+ SKIE  K+ +     ++  I N+ I ++   AQ K++++   I   L  
Sbjct: 727 LLSIINDILDFSKIEAGKLELFIDKFNIYDIANQVINIVLYQAQRKDVELLLNIEQGLPS 786

Query: 654 -FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKS 707
               D+  IK++L  +L N++KFT  +G++ ++  K+        +  ++ DTGIGIPK 
Sbjct: 787 SIWVDESRIKQVLINLLGNAVKFT-EHGEIELKIEKLSSYNDKITLRFSVRDTGIGIPKD 845

Query: 708 ALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
             ++I + F    +   +  GG GLGL IS+ L N    +L++ S+ GKG+I    +
Sbjct: 846 KQQRIFEAFTQEDSSVSKRYGGTGLGLTISNNLLNYMKSKLQLKSEPGKGSIFYFDL 902



 Score = 76.2 bits (186), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 42/368 (11%), Positives = 114/368 (30%), Gaps = 24/368 (6%)

Query: 111 KAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSK 170
           K + +  +  ++   LS++ I +     L+   +   S  +G      + +      + K
Sbjct: 166 KKQKVEAEYFSEIVRLSKNMICVLDSQFLLKEINPAFSEGLGISRSAALGKSLLDILQDK 225

Query: 171 TVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLL 230
                         H     L    G+   I       +   ++ T++  F    +    
Sbjct: 226 D-------------HTPEGLLKKLIGTTQGIQLVTTTQKENGKKTTIDWHFKYDSAN--- 269

Query: 231 FILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF-NFDNKKFHLSRSMYEIMG 289
             +F++ R   K  E    L  +             GL +  + D     ++    +I+ 
Sbjct: 270 GEIFAFGRNTTKELEEKLKLENSERRFRNFFENA-IGLMSMHDMDGNIIAVNEKGRDILH 328

Query: 290 IPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
              E   +    + +L+   +  + E       ++ +  D +  ++   G  I+      
Sbjct: 329 YTAEE--VKKLNLRQLVPPHHIPLLESYLERIARNKEDSDMMV-LQTKDGTPIYWLYHNM 385

Query: 350 MMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNA 409
           +   + G   ++  A+++T++  LE       Q L +            D     V  + 
Sbjct: 386 LETDLEGKPYVVSTALNMTDRIQLEHDLLHTKQILEQTNAVAQVGGWEVDLEKNKVYWSD 445

Query: 410 NYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDP---ERSQDMSKEIKLADSRWLQ 466
             +  +G+    +   ++     + +++  +            S D+   ++  D   + 
Sbjct: 446 PTKIIHGVKKDFVPDLDSAIGFFEPESKKKVREIFEQAVVKGTSYDIELRLRKQDGESIW 505

Query: 467 INEWCTHD 474
           +      +
Sbjct: 506 VRVKGVPE 513


>gi|37522318|ref|NP_925695.1| two-component hybrid sensor and regulator [Gloeobacter violaceus PCC
            7421]
 gi|35213318|dbj|BAC90690.1| two-component hybrid sensor and regulator [Gloeobacter violaceus PCC
            7421]
          Length = 1296

 Score =  402 bits (1034), Expect = e-109,   Method: Composition-based stats.
 Identities = 127/617 (20%), Positives = 248/617 (40%), Gaps = 35/617 (5%)

Query: 162  LSRSRSRSKT--VQMSEASLDQQPYHVLSV-NLPHNSGSILIINSRVPLLRLWREEVTLE 218
             +  R         +    LD          +    +  ++++++R              
Sbjct: 691  AAVERRMPDLVLTDVMMPRLDGFGLLAALRTDERTRALPVIVLSARAGEEATLAGLERGA 750

Query: 219  VVFFS--IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
              + S    +  LL  + +    ++   E   +L  +      A+  GR G W F   + 
Sbjct: 751  DDYLSKPFAARELLGRVKANLELSRLRGETARLLHASEERARLAIRVGRLGTWRFVPTSG 810

Query: 277  KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTG--KHVKQLDQIFHM 334
               +   M EI G P +   LS       IH  +++    A            L+  + +
Sbjct: 811  VATMDERMREIWGEPEDTFQLSLAQAMERIHPADRERVSQAVDAALDPASAGTLEIDYRI 870

Query: 335  RHASGADIWIQVRAQMMR--TISGGMN---IIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
               +G++ W+    Q+    T +G       IG A+D+TE+  +E+  A ++QR     E
Sbjct: 871  VWPNGSERWVSANGQVFFEQTEAGSRRAVDFIGTALDITERKRIEQALAGSEQRYRLLAE 930

Query: 390  CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
               + +   D    L+  N  + +  G     +      S++       +    T+  + 
Sbjct: 931  SIPQLVWTADVGGTLLDVNGRWSQYTGFTLEQVKKSGWESVVHPEDVPGLRRQWTAAIKA 990

Query: 450  SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
                  E ++              DG          L +       E +           
Sbjct: 991  VAAYRAEGRM-----------RRTDGTYRW-----HLHQAMPLMDGEGRILKWFGTATDI 1034

Query: 510  TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
              R+ LE    E      + +  +E AE AN+TK EFLA + HELRTPLN I+G++++++
Sbjct: 1035 EERKQLE---AEREQLLERAEQAREAAEAANRTKDEFLAILGHELRTPLNPIIGWTQMLR 1091

Query: 570  KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
            +   G     K+ +  + I  + +    +I+++L++S+I    + I  Q   L  I+   
Sbjct: 1092 RGKVGP---DKHDQALEIIERNARLQTQLIDDLLDVSRIMRGSLRIAPQPITLAAIVVCA 1148

Query: 630  IRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            +  +   A+ K +++ +++ +    +AD   ++++++ +L+N++KFT   G++ +R    
Sbjct: 1149 LEAVRGLAEQKQVQLFEQLRTTAPLSADPTRLQQVVWNLLTNAVKFTPAGGQVQVRLESG 1208

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
            G    +TI+DTG+GIP   L  + + F     +  +   G GLGL I   +   HGG ++
Sbjct: 1209 GGMARLTISDTGVGIPAEFLPHLFERFRQADTKSTREQKGLGLGLFIVRHIVEAHGGTVQ 1268

Query: 750  IISQ-EGKGTIVTICMP 765
              S+ EGKG   T+ +P
Sbjct: 1269 AESEGEGKGAAFTVVLP 1285



 Score =  226 bits (577), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 68/244 (27%), Positives = 122/244 (50%), Gaps = 8/244 (3%)

Query: 526 NAKYQVEKERAETA---NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYY 582
              Y+ E  RAE     ++ K+ F + +SHE RTPL+ +LG  E     + G+  S    
Sbjct: 353 ARAYEAECRRAEALAEIDRAKTVFFSNVSHEFRTPLSLLLGPLE---DVLAGDGISAPTR 409

Query: 583 EYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNI 642
           E       +G+ LL ++N +L+ S+IE  +I  +    DL  +  + + +  S+ +   +
Sbjct: 410 EQLTLAQRNGRRLLKLVNTLLDFSRIEAGRIQANFLPTDLASLTAQLVSVFRSAVEKAGL 469

Query: 643 KIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTG 701
           ++    P        D+ + +KI+  +LSN+ KFT   G++ +R  +    V + + DTG
Sbjct: 470 RLVIDCPPLAEAVYVDRDMWEKIVLNLLSNAFKFTLR-GQIAVRLRQQTGEVCLELEDTG 528

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           +GI    L +I   F  +     +S  G G+GLA+   L  +HGG++ + S  G+G+  T
Sbjct: 529 VGIAAHELPRIFDRFHRVAGVAGRSHEGSGIGLALVAELVEIHGGKVSVQSVSGRGSTFT 588

Query: 762 ICMP 765
           + +P
Sbjct: 589 VRLP 592


>gi|119488833|ref|ZP_01621795.1| PAS/PAC Sensor Hybrid Histidine Kinase [Lyngbya sp. PCC 8106]
 gi|119454994|gb|EAW36136.1| PAS/PAC Sensor Hybrid Histidine Kinase [Lyngbya sp. PCC 8106]
          Length = 1205

 Score =  402 bits (1033), Expect = e-109,   Method: Composition-based stats.
 Identities = 119/722 (16%), Positives = 251/722 (34%), Gaps = 62/722 (8%)

Query: 62   FIATSSIIKVTTRYAQQEKMTNQTSLML-----TEAIEIIFQNNNIKFDLASQK-KAESM 115
             +A   +    +   Q E    Q    L         ++   N  ++ ++ ++   AE +
Sbjct: 518  TVAVIGVYHDISDRKQAELELQQYRDHLEYLVDQRTSQLEKSNAKLQREIEARAILAEEL 577

Query: 116  L--GQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQ 173
            L     LA     +   I+       +   +       G +  E++ +        +   
Sbjct: 578  LASEARLAGILDNANDAIISVNEAHQIILFNKGAEKIFGYQSEEVLNQALDLLLPRRFSA 637

Query: 174  MSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFIL 233
                 +     H  +      +  I                ++   +  +I    +L  +
Sbjct: 638  THCEHIKTFRKHSQTARNMGENREISGRRQNGQEFPA-EASISRLQLGNTITYTAILRDI 696

Query: 234  FSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYE 293
                   K+ ++ +T L E+     T       G++  +      +++    +I G+  E
Sbjct: 697  SERVAAFKERQQAETALRESEQRYATLAEVSPVGIFRSDAVGNCLYVNERWCQIAGLSLE 756

Query: 294  NKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRT 353
                  +   + +H D++     A              +  +   G   W+  +A +   
Sbjct: 757  QSLG--QGWIQTLHPDDRDRVIQAWKQAVCDRCSFQLEYRFQRTDGMITWVFGQAVVEID 814

Query: 354  ISGGMN-IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQ 412
            I G +   +G   D+ ++   E    E+++R    +E    A+V  +    +   N  + 
Sbjct: 815  IKGEIKGFVGSITDINDRKQAEATLQESERRWRSLLENVHLAVVGLNDQGIIDYVNPFFL 874

Query: 413  KAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCT 472
            +  G     L+  +  +    A  R  +     +  + Q  S             N   T
Sbjct: 875  ELTGYTQTELLGQDWFTTFLPASQRSPVYQYFQEILKQQLNSY----------YQNTILT 924

Query: 473  HDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE 532
              G    +  + T L+  Q     +                              +Y +E
Sbjct: 925  KSGEEKIIAWNNTRLQSLQGDALGTMSIG---------------------EDITERYAIE 963

Query: 533  KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
            +         K+EF++ +SHELRTPL AI G   ++   +     S +     +    S 
Sbjct: 964  R--------MKNEFISVVSHELRTPLTAIHGALNLLSTGLVAPE-SPRGQHVIKIAAEST 1014

Query: 593  QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
            + L+ ++N+ILE+ ++E  +I + K   +   ++      +   A    IK+E  +P ++
Sbjct: 1015 ERLVRLVNDILELERLECGRIKLVKHCVNAAQLLRVAQDQMQVMANRTGIKLEI-LPQDI 1073

Query: 653  FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI----GQC-----VIITIADTGIG 703
             F AD   + ++L  ++SN+IKF+++   + +         G       V+  + D G G
Sbjct: 1074 EFEADGDRMIQVLTNLISNAIKFSDSGSTIQLSVEAEWRTFGGETPIASVLFCVRDQGRG 1133

Query: 704  IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
            IP   +E I + F+ +     +  GG GLGLAI  ++   HGG + + S   + +     
Sbjct: 1134 IPLEKMESIFERFQQVDASDSRQKGGTGLGLAICRSIVEQHGGIIWVESVLDQESCFYFS 1193

Query: 764  MP 765
            +P
Sbjct: 1194 IP 1195



 Score =  105 bits (262), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/529 (10%), Positives = 135/529 (25%), Gaps = 43/529 (8%)

Query: 45  FSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKF 104
            +     I  I  +F+       + ++      Q K+  Q SL +     +   N  +  
Sbjct: 91  EAGLTLIILGIVGIFIGQKTAQYLAQINKLKTTQTKLEQQLSLSIQ---TLAKANQKVLQ 147

Query: 105 DLASQ---KKAESMLGQLLAKTRFLSESFILLAQPNEL--VFASSTKNSHYIGKKIGEII 159
           DL      K    M    L      S   I  +  +    +   S      +G       
Sbjct: 148 DLNEHQLNKDQLQMAQARLQHLIQSSPVVIYSSPTSGHECITFISDNVQSVLGY------ 201

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRL-WREEVTLE 218
            E  +               D          +                    W ++    
Sbjct: 202 -ESQKFADTGFWATHIHPE-DACRIFAEFPRVFEQGKHSYEYRFLHGDGTYHWIQDELRL 259

Query: 219 VVFFSIISALLLFILFSYYRQAKKNKENDTILLEAN-------ICVETALSRGRCGLWNF 271
           V             +  Y+      K+    L ++          + +  S     ++  
Sbjct: 260 VTDSQGKPL----EIVGYWIDINVRKQAQFALKDSEIRYRSLAQRLHSITSNAPIYIYEL 315

Query: 272 NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
           +   +    +R+           + +    +      + +              +     
Sbjct: 316 DRQGRVLFANRTYE-----NVTQEQVLGNLLIDCFPPEKQPNITQIIEQVFTTGQVQSLE 370

Query: 332 FHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
           + + +++G       +   +   S   +++ IA D++E    E+         +   E  
Sbjct: 371 YIIPNSTGEIRAYTAQLAPIWMNSTFNSVVFIATDISEYKQAEQTLQRH----ALIFEQI 426

Query: 392 SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGN----ARSIIQDAQTRPIIEYRTSDP 447
            + +++ D   R++  N   ++ +G     +V                T+ ++E+     
Sbjct: 427 YDGVIMTDLTGRIIDWNPGAERMFGYSHSEVVGKTSALVHYPEQTPMPTQTMLEHIKKQG 486

Query: 448 ERSQDMSKEIKLADSRWLQINEWCTHD--GGTISVGTDITLLKHNQAQLRESKRRLKATI 505
               +M+   +               D  G T++V      +   +    E ++      
Sbjct: 487 YWLSEMTFIRENKTQGICDTIVVPIFDHQGETVAVIGVYHDISDRKQAELELQQYRDHLE 546

Query: 506 NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
             +      LE+   +L        +  E    +    +  L   +  +
Sbjct: 547 YLVDQRTSQLEKSNAKLQREIEARAILAEELLASEARLAGILDNANDAI 595


>gi|298530364|ref|ZP_07017766.1| PAS/PAC sensor signal transduction histidine kinase
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509738|gb|EFI33642.1| PAS/PAC sensor signal transduction histidine kinase
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 919

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 134/719 (18%), Positives = 269/719 (37%), Gaps = 68/719 (9%)

Query: 67  SIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQ---LLAKT 123
           +++   + + + +++          A E    +  ++  +    KA   L +    L   
Sbjct: 161 AVVTDLSEHKRLQEIKAAEQTARARAQEAERYSETLESLVRDLNKARKGLKENQNFLESV 220

Query: 124 RFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQP 183
               +  I++   +  +  ++    +             +    R +   +   S   Q 
Sbjct: 221 LDTIQDGIVVLDKDMNIIKTNRVIQNLYSLDHSRQEKCYTAFHGRREPCDLCPTSRAMQT 280

Query: 184 YHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKN 243
            ++    +P     +      V      R+E             +   + ++  R   K 
Sbjct: 281 GNLEVEEIPIIQNGVETGTMEVFAY-PMRDE----------QGNITGVVEYA--RDISKV 327

Query: 244 KENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIA 303
           K N   L  +   +         G W  + D      S  +Y + G   ++    +++  
Sbjct: 328 KRNRQALKRSQALLSRTQEIADIGSWEMDLDKDVLTWSDQVYRMFGYAPQSFQPGYQSFL 387

Query: 304 RLIHYDNKKICE-IARSVTGKHVKQLDQIFHMRHAS-GADIWIQVRAQMMRTISGGMNI- 360
             +H ++++              +  +    +  A      +++ +       +G + + 
Sbjct: 388 DAVHPEDRESVHKKYLESMLDVSQGFEFEHRIVRADSQEVRYVREQGLHELDDAGRVVLS 447

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
            G   D+ E      +  E +++    ++ + E + L D   R +  NA      G    
Sbjct: 448 YGAIQDIAENKLAADKLREREEKYRALVDQSVEMIYLHDMEGRFIEVNAAAVSNTGYTRE 507

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV 480
            L+  N   +  D  ++  ++         Q M+ E            E    DG  I V
Sbjct: 508 ELLSMNVFDLHTDQLSQEEVKNYWQSMLPGQSMTVE-----------TEHHKKDGSVIPV 556

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
              I  + ++  +                     L +  TE    + +  + +  AE AN
Sbjct: 557 EVKIGKIYYSNQEHIM-----------------ALVQDITERKQVHQEL-IARRSAEEAN 598

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
           + KS FLA MSHE+RTP+NA+LGF+ +++          K    A  I  SG HLL ++N
Sbjct: 599 RAKSRFLANMSHEIRTPMNAVLGFARMLEN---DPALPAKQAAQAGTIVRSGDHLLQLLN 655

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADK 658
           +IL+MS+IE  +  +  ++  L  +I++ + +   SAQ K +++  +    L    +AD+
Sbjct: 656 SILDMSRIEAGQSGLHPEDFHLPGLIDKLMTMFELSAQDKGLELVLEKDPHLPPDLHADQ 715

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRT------------SKIGQCVIITIADTGIGIPK 706
             + +IL  +LSN+IKFT + G++ +               +    ++  + D+G GI  
Sbjct: 716 GKLLQILTNLLSNAIKFT-STGEVKLTISSKPPGPADTACEEQDLGLVFQVQDSGPGITA 774

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
               ++ +PF    N+     GG GLGL IS     L GG L + SQEG+G+   + +P
Sbjct: 775 QDQAQLFEPFFQTQNKM--HPGGTGLGLTISREYAVLMGGNLTVSSQEGRGSCFRLEIP 831



 Score = 37.7 bits (86), Expect = 8.5,   Method: Composition-based stats.
 Identities = 40/259 (15%), Positives = 75/259 (28%), Gaps = 35/259 (13%)

Query: 368 TEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA 427
           T++         AD      +E  SE  +    +  ++  N  + +        LV G+ 
Sbjct: 44  TDQGEQVFTLKGADHPFRVLMEDMSEGALTLSSDGIVLYANQRFAEML-KSHLNLVAGSD 102

Query: 428 RSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLL 487
                 +  R    Y     +  Q  S EI L DS+           G  +     +T L
Sbjct: 103 LVQWIQSGHRCRF-YSLLQGQSGQRSSGEINLVDSQ-----------GALVPTQFSLTPL 150

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFL 547
           +    Q          + +      +  E+     +    +Y    E       +    L
Sbjct: 151 ETQDIQGAFCAVVTDLSEHKRLQEIKAAEQTARARAQEAERYSETLE-------SLVRDL 203

Query: 548 AKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINN--ILEM 605
            K    L+   N +    + I+  I          +    I  +      +I N   L+ 
Sbjct: 204 NKARKGLKENQNFLESVLDTIQDGIVV------LDKDMNIIKTN-----RVIQNLYSLDH 252

Query: 606 SKIETEKISID--KQNADL 622
           S+ E    +    ++  DL
Sbjct: 253 SRQEKCYTAFHGRREPCDL 271


>gi|308050680|ref|YP_003914246.1| multi-sensor hybrid histidine kinase [Ferrimonas balearica DSM 9799]
 gi|307632870|gb|ADN77172.1| multi-sensor hybrid histidine kinase [Ferrimonas balearica DSM 9799]
          Length = 1756

 Score =  400 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 118/705 (16%), Positives = 258/705 (36%), Gaps = 73/705 (10%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLA-----QPNELV 140
               L        +   I  D++ +   +  L +   + R L  +   +        +  +
Sbjct: 606  LSELPAFAGQQPRIAAIIRDISERHAMDRKLRESEERFRTLVGNIPGVVYRCALDSHWTM 665

Query: 141  FASSTKNSHYIGKKIGEII---PELSRSRSRSKTVQMSEASLD-----QQPYHVLSVNLP 192
               S       G    + +        S    +        +         +      + 
Sbjct: 666  AFISDHIKDLSGYPASDFLNNAKRSFASLIHPEDATRLAEVVKLGVEAGDSWSQEYRIIN 725

Query: 193  HNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLE 252
                   +            + + L+                       + + N   +L 
Sbjct: 726  RRGQVRWVYEKGRAHYDENGKPMWLDGSIH----------------DITEARSNHQQMLA 769

Query: 253  ANICVETALSRGRCGLWNFNFDNKKF-----HLSRSMYEIMGIPYENKTLSFRAIARLIH 307
            A   +ET        ++    D+ +       +S  + + +G+       +  ++  L+H
Sbjct: 770  AKAQLETITESVPGVVFQLQQDDSELGIRCSFVSGGIRQALGVSKSRVLENLNSVLELVH 829

Query: 308  YDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDL 367
             +++   E     +    +   +        G + W  V  Q+ R  SG +   G  +++
Sbjct: 830  PEDRGALETTLKRSADSQQDWSREVRFVIG-GTEQWFSVSVQVSRDDSGALWWNGFLVNI 888

Query: 368  TEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA 427
            +++  +E++   ++       +    A+V  +K   +   N  +Q+   L    L+ G  
Sbjct: 889  SQRKAMEQQLVNSEAHFRALFDNAGIAIVTLNKLGVIGEANERFQQFAELEPEQLI-GQH 947

Query: 428  RSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLL 487
             S +  A+ R       +     +      ++          +   DG            
Sbjct: 948  ISQLLPAEDRDSFNQSLAPLLAGEQRHLAQEMR---------YRKPDGSLRWA------- 991

Query: 488  KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFL 547
                    + +  +        ++  +     TE    N   +  KE A+ A+K K++FL
Sbjct: 992  --------DMRAVVLKDYQGGLSALVLTMSDVTERRQINEALRQAKEAADAASKAKTDFL 1043

Query: 548  AKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSK 607
            A MSHE+RTP+NAI+G +++  +         +  +Y + I  + Q LL +IN++L+ SK
Sbjct: 1044 ANMSHEIRTPMNAIIGMTQLCLQTDLPP----RQADYLRKIDSASQSLLGIINDVLDYSK 1099

Query: 608  IETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKIL 665
            IE  ++ ++++   L  ++ +   L    A+ K +++   +  E+    N D   + +IL
Sbjct: 1100 IEAGRLELEQEPFALDELLEQLSDLFAVRAKEKGVELLFAVEPEVPARLNGDMLRLGQIL 1159

Query: 666  FPILSNSIKFTNNNGKMMIRTSKIGQ------CVIITIADTGIGIPKSALEKIGQPFEPL 719
              +LSN+IKFT ++G++++   ++         +  ++ DTGIG+      ++ Q F   
Sbjct: 1160 INLLSNAIKFT-DHGEVVLAIRQLDGAPPGQTRLTFSVRDTGIGMSPEQQARLFQSFSQA 1218

Query: 720  HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
             +   +  GG GLGLAIS  L +L GG++++ S  G G+     +
Sbjct: 1219 DSSTTRKYGGTGLGLAISQRLVSLMGGQIQVNSAAGAGSTFHFSI 1263



 Score =  143 bits (361), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 64/476 (13%), Positives = 156/476 (32%), Gaps = 34/476 (7%)

Query: 83  NQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRF------LSESFILLAQP 136
              +  + +    +    +++ DL   +   + + + L   R+       +   ILLA+P
Sbjct: 472 RHENGEVRQFSAYMQPVTDVQGDLLGIEALLTDMTEELEAGRWYQSVLDAAPDAILLAEP 531

Query: 137 NELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSG 196
           +  V   + +     G    E+I +         +        +       +        
Sbjct: 532 DGTVVYLNQQAESLTGYLRDELIGQSVEVLVPPASRNHHPQLREAFLSDATARP---GGM 588

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
            + +  +    L +  E    E+  F+     +  I+    R   +    D  L E+   
Sbjct: 589 ELALYRADGKKLAV--EISLSELPAFAGQQPRIAAII----RDISERHAMDRKLRESEER 642

Query: 257 VETALSRGRCGLWNFNFDNKKF--HLSRSMYEIMGIPYENKTLSF-RAIARLIHYDNKKI 313
             T +      ++    D+      +S  + ++ G P  +   +  R+ A LIH ++   
Sbjct: 643 FRTLVGNIPGVVYRCALDSHWTMAFISDHIKDLSGYPASDFLNNAKRSFASLIHPEDATR 702

Query: 314 CEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNII-GIAMDLTEKYH 372
                 +  +      Q + + +  G   W+  + +     +G    + G   D+TE   
Sbjct: 703 LAEVVKLGVEAGDSWSQEYRIINRRGQVRWVYEKGRAHYDENGKPMWLDGSIHDITEARS 762

Query: 373 LEKRYAEADQRLSKAIECTSEALVLWDKND-----RLVMCNANYQKAYGLPDHVLVP--G 425
             ++   A  +L    E     +    ++D     R    +   ++A G+    ++    
Sbjct: 763 NHQQMLAAKAQLETITESVPGVVFQLQQDDSELGIRCSFVSGGIRQALGVSKSRVLENLN 822

Query: 426 NARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADS---RWLQINEWCTHDGG----TI 478
           +   ++       +        +  QD S+E++       +W  ++   + D        
Sbjct: 823 SVLELVHPEDRGALETTLKRSADSQQDWSREVRFVIGGTEQWFSVSVQVSRDDSGALWWN 882

Query: 479 SVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
               +I+  K  + QL  S+   +A  ++   +   L +    +  AN ++Q   E
Sbjct: 883 GFLVNISQRKAMEQQLVNSEAHFRALFDNAGIAIVTLNKLGV-IGEANERFQQFAE 937



 Score = 85.4 bits (210), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 52/431 (12%), Positives = 133/431 (30%), Gaps = 39/431 (9%)

Query: 111 KAESMLGQLLAKTRFLSESFIL--LAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSR 168
           + +   G  LAK               P+  V  +S      +G    E      R    
Sbjct: 385 RLQDAHGSRLAKLLEGMGDTAFYYAMDPDGKVLHASDSVKAVLGYSPEEFARRYPRLFV- 443

Query: 169 SKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISAL 228
               +++E+S   Q   +    +P +  ++   N  V     + + VT            
Sbjct: 444 --DDEINESSWRYQEQLMQGQAVPPHPLALRHENGEVRQFSAYMQPVTDVQGDLLG---- 497

Query: 229 LLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIM 288
               + +      +  E            ++ L      +     D    +L++    + 
Sbjct: 498 ----IEALLTDMTEELEAGRW-------YQSVLDAAPDAILLAEPDGTVVYLNQQAESLT 546

Query: 289 GIPYENKTLSFRAIARLIHYDNKKICEIARS--VTGKHVKQLDQIFHMRHASGADIWIQV 346
           G   +      +++  L+   ++      R   ++    +       +  A G  + +++
Sbjct: 547 GYLRDELIG--QSVEVLVPPASRNHHPQLREAFLSDATARPGGMELALYRADGKKLAVEI 604

Query: 347 RAQMMRT-ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW--DKNDR 403
               +         I  I  D++E++ ++++  E+++R    +      +     D +  
Sbjct: 605 SLSELPAFAGQQPRIAAIIRDISERHAMDRKLRESEERFRTLVGNIPGVVYRCALDSHWT 664

Query: 404 LVMCNANYQKAYGLPDHVLV--PGNARSIIQDAQTRPIIEYRTSDPERSQD---MSKEI- 457
           +   + + +   G P    +     + + +   +    +         + D       I 
Sbjct: 665 MAFISDHIKDLSGYPASDFLNNAKRSFASLIHPEDATRLAEVVKLGVEAGDSWSQEYRII 724

Query: 458 -KLADSRWLQINEWCTHD--GGTISVG---TDITLLKHNQAQLRESKRRLKATINDLSTS 511
            +    RW+       +D  G  + +     DIT  + N  Q+  +K +L+     +   
Sbjct: 725 NRRGQVRWVYEKGRAHYDENGKPMWLDGSIHDITEARSNHQQMLAAKAQLETITESVPGV 784

Query: 512 RQILERQKTEL 522
              L++  +EL
Sbjct: 785 VFQLQQDDSEL 795



 Score = 81.2 bits (199), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 56/463 (12%), Positives = 136/463 (29%), Gaps = 97/463 (20%)

Query: 131 ILLAQPNELVFA-SSTKNSHYIGKKIGEII-----PELSRSRSRSKTVQMSE-ASLDQQP 183
           +L+A  +  + A ++ +    + + + +++     P     R R + + +      D   
Sbjct: 219 LLIADRDGFMLAHANPEF--ILNRNLSQLLDNDANPADLLDRMRQQELGIERMVMADGGE 276

Query: 184 YHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA--- 240
           + V    +P     + I      +      ++   V+   + + L   I +   R+    
Sbjct: 277 FVVAYQWIPTTDWLLAIARPAETVDAPILAKMRNSVLQLLLFTLLFALIAWWLTRRIARP 336

Query: 241 -------------------------KKNKEN--------DTILLEANICVETA------- 260
                                     +  +            L E  + ++ A       
Sbjct: 337 LEQLRHRVIALQHGSRSLTALKVPGTEEIQALDQGLLSMAEALKERELRLQDAHGSRLAK 396

Query: 261 -LSRGRCGLWNF--NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIA 317
            L       + +  + D K  H S S+  ++G   E     +  +   +  +  +     
Sbjct: 397 LLEGMGDTAFYYAMDPDGKVLHASDSVKAVLGYSPEEFARRYPRL--FVDDEINESSWRY 454

Query: 318 RSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGI---AMDLTEKYHLE 374
           +    +          +RH +G         Q +  + G   ++GI     D+TE+    
Sbjct: 455 QEQLMQGQAVPPHPLALRHENGEVRQFSAYMQPVTDVQGD--LLGIEALLTDMTEE---- 508

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA 434
               EA +     ++   +A++L + +  +V  N   +   G     L+  +   ++  A
Sbjct: 509 ---LEAGRWYQSVLDAAPDAILLAEPDGTVVYLNQQAESLTGYLRDELIGQSVEVLVPPA 565

Query: 435 QT--RPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQA 492
                P +         ++    E+ L              DG  ++V   ++ L     
Sbjct: 566 SRNHHPQLREAFLSDATARPGGMELAL-----------YRADGKKLAVEISLSEL----- 609

Query: 493 QLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKER 535
                                 + R  +E    + K +  +ER
Sbjct: 610 ----------PAFAGQQPRIAAIIRDISERHAMDRKLRESEER 642


>gi|146294229|ref|YP_001184653.1| multi-sensor hybrid histidine kinase [Shewanella putrefaciens CN-32]
 gi|145565919|gb|ABP76854.1| PAS/PAC sensor hybrid histidine kinase [Shewanella putrefaciens
            CN-32]
          Length = 1771

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 131/701 (18%), Positives = 258/701 (36%), Gaps = 68/701 (9%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVF- 141
              +L   ++   Q      D+  +   E  +     + R         +   +  E+   
Sbjct: 607  LSILPADVDGSRQVAASIRDMTQKLAIEQKIRDSELRFRGLVANIPGAVYRTRIGEVWVM 666

Query: 142  -ASSTKNSHYIGKKIGEIIPELSRSRS-------RSKTVQMSEASLDQQPYHVLSVNLPH 193
               S   +   G    + I    R+ S       R    Q  + +L QQ    +   + H
Sbjct: 667  EYISDNIADITGYAASQFIENRQRNFSSLILEEDRPLCHQHIDKALAQQETFEVEYRIRH 726

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GSI  ++ +      + EE     ++F                   ++K     L  +
Sbjct: 727  RDGSIRWVHEKG--KASYNEE--GFPLWFDGSID-----------DITESKLVSVELEAS 771

Query: 254  NICVETALSRGRCGLW--NFNFDNKK--FHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +        C ++   +   + +    LS +   ++G+  +N    F  IA  I  +
Sbjct: 772  RQQLTNITESIPCTVYQLRWRSPSDRAFTFLSGAALPMLGLQRDNLMNDFNIIAERIFDE 831

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A +       Q  + F  RH +G+  W++  A         +   G  MD+T+
Sbjct: 832  ERPEVVRALAGKSDDKLQWIREFRYRHPNGSIRWMEAGASGHVESDDVIIWNGYVMDITQ 891

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       +  +  ++  D    ++ CN  + +  G     L       
Sbjct: 892  RKTMEQELALSEAHFRALFDGATIGIINIDAKGLILDCNDQFCEDIGRAREELRNIPIFD 951

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
            ++                +   D           +     +    G  + +  +++ L  
Sbjct: 952  VLSPQDREIAKAQFKDLADGKVDH----------YRGERSFIRPSGEPMWMTVNVSALFD 1001

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
               Q   +   +                  TEL + + +  + KE A+ A+K K +FLA 
Sbjct: 1002 CHHQFESAVVSMVDM---------------TELKLLSDELLIAKEEADAASKAKGDFLAN 1046

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            MSHE+RTP+NAI+G S++  +    +    K   Y + I  + Q LL++IN+IL+ SKIE
Sbjct: 1047 MSHEIRTPMNAIIGMSQLCLQTALDK----KQKNYVEKIERASQSLLSIINDILDFSKIE 1102

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFP 667
              K+ ID     L  ++ +   +       K +++   +   +      D   + ++L  
Sbjct: 1103 AGKLDIDAVPFQLDTMLEDLSDMFSEKVVHKQLELLFAVAPNVPRHLFGDSLRLGQVLIN 1162

Query: 668  ILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
            +++N+IKFT   G++++  + + Q      +  ++ D+GIG+      K+ + F      
Sbjct: 1163 LMNNAIKFT-ERGEVLLSINLVEQQNDDVTLRFSVRDSGIGLTDEQQAKLFKSFSQADTS 1221

Query: 723  YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
              +  GG GLGLAI   L  L GG + + SQ G G+     
Sbjct: 1222 TTRKYGGTGLGLAICKQLVELMGGNIGVESQFGHGSTFYFT 1262



 Score =  123 bits (308), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/369 (9%), Positives = 103/369 (27%), Gaps = 19/369 (5%)

Query: 113 ESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTV 172
           +             +   +L+      +  S+++     G     ++  L       + +
Sbjct: 507 QFSAAAWSNAVLEAAPEAMLIVDEKGEIIFSNSRCQQLFGYHAEAMLG-LQVEALLPQAL 565

Query: 173 QMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFI 232
                   QQ           N+  +  + +          E+ L ++   +  +  +  
Sbjct: 566 GSEHVRYRQQFLRDGRDRSMANARHVRAVKADGNEFIA---EIALSILPADVDGSRQVA- 621

Query: 233 LFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF--HLSRSMYEIMGI 290
             +  R   +    +  + ++ +     ++     ++           ++S ++ +I G 
Sbjct: 622 --ASIRDMTQKLAIEQKIRDSELRFRGLVANIPGAVYRTRIGEVWVMEYISDNIADITGY 679

Query: 291 PYENK-TLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
                     R  + LI  +++ +C           +  +  + +RH  G+  W+  + +
Sbjct: 680 AASQFIENRQRNFSSLILEEDRPLCHQHIDKALAQQETFEVEYRIRHRDGSIRWVHEKGK 739

Query: 350 MMRTISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIECT----SEALVLWDKNDRL 404
                 G      G   D+TE   +      + Q+L+   E       +       +   
Sbjct: 740 ASYNEEGFPLWFDGSIDDITESKLVSVELEASRQQLTNITESIPCTVYQLRWRSPSDRAF 799

Query: 405 VMCNANYQKAYGLPDHVLVPGNAR--SIIQDAQTRPIIEYRT--SDPERSQDMSKEIKLA 460
              +       GL    L+         I D +   ++      SD +         +  
Sbjct: 800 TFLSGAALPMLGLQRDNLMNDFNIIAERIFDEERPEVVRALAGKSDDKLQWIREFRYRHP 859

Query: 461 DSRWLQINE 469
           +     +  
Sbjct: 860 NGSIRWMEA 868



 Score = 56.9 bits (136), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 36/326 (11%), Positives = 108/326 (33%), Gaps = 13/326 (3%)

Query: 134 AQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPH 193
                + + +S      +  ++  ++PE     +    +      L      +L      
Sbjct: 269 VDVQGISYLASVATVPKLKWRVVVMVPEQELFTALLDDIASIVLDLSLLTLLLLLTCYLT 328

Query: 194 NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
                  +      +  + +    ++V      + ++ +  ++ + A+   E +  +L++
Sbjct: 329 AKRLTRPLELLESGILAFGQGKAQQLVIPKGAVSEIVTLSQTFNQMAELLAEREQAILDS 388

Query: 254 N-ICVETALSRGRCGLW--NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
                   +       +  +     +   +S  + +++GI  E     ++ +  +   + 
Sbjct: 389 RGNRFARLIDGMSDKSFYCSLEPSGQLAQVSDGVTKVLGIAPELLKRKYQRLFSVNPLNE 448

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGI-AMDLTE 369
           K        +  K          M  A G    + V  Q + + +G +  + +   D+TE
Sbjct: 449 KNW--QYTDLALKGQNVPSHQVEMIDAQGHLRRLDVFMQPLVSETGELMSVEMLFTDVTE 506

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           ++             +  +E   EA+++ D+   ++  N+  Q+ +G     ++     +
Sbjct: 507 QFSAA-------AWSNAVLEAAPEAMLIVDEKGEIIFSNSRCQQLFGYHAEAMLGLQVEA 559

Query: 430 IIQDAQTRPIIEYRTSDPERSQDMSK 455
           ++  A     + YR       +D S 
Sbjct: 560 LLPQALGSEHVRYRQQFLRDGRDRSM 585


>gi|120597632|ref|YP_962206.1| multi-sensor hybrid histidine kinase [Shewanella sp. W3-18-1]
 gi|120557725|gb|ABM23652.1| PAS/PAC sensor hybrid histidine kinase [Shewanella sp. W3-18-1]
          Length = 1771

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 131/701 (18%), Positives = 258/701 (36%), Gaps = 68/701 (9%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVF- 141
              +L   ++   Q      D+  +   E  +     + R         +   +  E+   
Sbjct: 607  LSILPADVDGSRQVAASIRDMTQKLAIEQKIRDSELRFRGLVANIPGAVYRTRIGEVWVM 666

Query: 142  -ASSTKNSHYIGKKIGEIIPELSRSRS-------RSKTVQMSEASLDQQPYHVLSVNLPH 193
               S   +   G    + I    R+ S       R    Q  + +L QQ    +   + H
Sbjct: 667  EYISDNIADITGYAASQFIENRQRNFSSLILEEDRPLCHQHIDKALAQQETFEVEYRIRH 726

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GSI  ++ +      + EE     ++F                   ++K     L  +
Sbjct: 727  RDGSIRWVHEKG--KASYNEE--GFPLWFDGSID-----------DITESKLVSVELEAS 771

Query: 254  NICVETALSRGRCGLW--NFNFDNKK--FHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +        C ++   +   + +    LS +   ++G+  +N    F  IA  I  +
Sbjct: 772  RQQLTNITESIPCTVYQLRWRSPSDRAFTFLSGAALPMLGLQRDNLMNDFNIIAERIFDE 831

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A +       Q  + F  RH +G+  W++  A         +   G  MD+T+
Sbjct: 832  ERPEVVRALAGKSDDKLQWIREFRYRHPNGSIRWMEAGASGHVESDDVIIWNGYVMDITQ 891

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       +  +  ++  D    ++ CN  + +  G     L       
Sbjct: 892  RKTMEQELALSEAHFRALFDGATIGIINIDAKGLILDCNDQFCEDIGRAREELRNIPIFD 951

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
            ++                +   D           +     +    G  + +  +++ L  
Sbjct: 952  VLSPQDREIAKAQFKDLADGKVDH----------YRGERSFIRPSGEPMWMTVNVSALFD 1001

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
               Q   +   +                  TEL + + +  + KE A+ A+K K +FLA 
Sbjct: 1002 CHHQFESAVVSMVDM---------------TELKLLSDELLIAKEEADAASKAKGDFLAN 1046

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            MSHE+RTP+NAI+G S++  +    +    K   Y + I  + Q LL++IN+IL+ SKIE
Sbjct: 1047 MSHEIRTPMNAIIGMSQLCLQTALDK----KQKNYVEKIERASQSLLSIINDILDFSKIE 1102

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFP 667
              K+ ID     L  ++ +   +       K +++   +   +      D   + ++L  
Sbjct: 1103 AGKLDIDAVPFQLDTMLEDLSDMFSEKVVHKQLELLFAVAPNVPRHLFGDSLRLGQVLIN 1162

Query: 668  ILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
            +++N+IKFT   G++++  + + Q      +  ++ D+GIG+      K+ + F      
Sbjct: 1163 LMNNAIKFT-ERGEVLLSINLVEQQNDDVTLRFSVRDSGIGLTDEQQAKLFKSFSQADTS 1221

Query: 723  YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
              +  GG GLGLAI   L  L GG + + SQ G G+     
Sbjct: 1222 TTRKYGGTGLGLAICKQLVELMGGNIGVESQFGHGSTFYFT 1262



 Score =  123 bits (308), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/369 (9%), Positives = 103/369 (27%), Gaps = 19/369 (5%)

Query: 113 ESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTV 172
           +             +   +L+      +  S+++     G     ++  L       + +
Sbjct: 507 QFSAAAWSNAVLEAAPEAMLIVDEKGEIIFSNSRCQQLFGYHAEAMLG-LQVEALLPQAL 565

Query: 173 QMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFI 232
                   QQ           N+  +  + +          E+ L ++   +  +  +  
Sbjct: 566 GSEHVRYRQQFLRDGRDRSMANARHVRAVKADGNEFIA---EIALSILPADVDGSRQVA- 621

Query: 233 LFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF--HLSRSMYEIMGI 290
             +  R   +    +  + ++ +     ++     ++           ++S ++ +I G 
Sbjct: 622 --ASIRDMTQKLAIEQKIRDSELRFRGLVANIPGAVYRTRIGEVWVMEYISDNIADITGY 679

Query: 291 PYENK-TLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
                     R  + LI  +++ +C           +  +  + +RH  G+  W+  + +
Sbjct: 680 AASQFIENRQRNFSSLILEEDRPLCHQHIDKALAQQETFEVEYRIRHRDGSIRWVHEKGK 739

Query: 350 MMRTISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIECT----SEALVLWDKNDRL 404
                 G      G   D+TE   +      + Q+L+   E       +       +   
Sbjct: 740 ASYNEEGFPLWFDGSIDDITESKLVSVELEASRQQLTNITESIPCTVYQLRWRSPSDRAF 799

Query: 405 VMCNANYQKAYGLPDHVLVPGNAR--SIIQDAQTRPIIEYRT--SDPERSQDMSKEIKLA 460
              +       GL    L+         I D +   ++      SD +         +  
Sbjct: 800 TFLSGAALPMLGLQRDNLMNDFNIIAERIFDEERPEVVRALAGKSDDKLQWIREFRYRHP 859

Query: 461 DSRWLQINE 469
           +     +  
Sbjct: 860 NGSIRWMEA 868



 Score = 56.1 bits (134), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 35/326 (10%), Positives = 108/326 (33%), Gaps = 13/326 (3%)

Query: 134 AQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPH 193
                + + +S      +  ++  ++PE     +    +      L      +L      
Sbjct: 269 VDVQGISYLASVATVPKLKWRVVVMVPEQELFTALLDDIASIVLDLSLLTLLLLLTCYLT 328

Query: 194 NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
                  +      +  + +    ++V      + ++ +  ++ + A+   E +  ++++
Sbjct: 329 AKRLTRPLELLESGILAFGQGKAQQLVIPKGAVSEIVTLSQTFNQMAELLAEREQAIIDS 388

Query: 254 N-ICVETALSRGRCGLW--NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
                   +       +  +     +   +S  + +++GI  E     ++ +  +   + 
Sbjct: 389 RGNRFARLIDGMSDKSFYCSLEPSGQLAQVSDGVTKVLGIAPELLKRKYQRLFSVNPLNE 448

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGI-AMDLTE 369
           K        +  K          M  A G    + V  Q + + +G +  + +   D+TE
Sbjct: 449 KNW--QYTDLALKGQNVPSHQVEMIDAQGHLRRLDVFMQPLVSETGELMSVEMLFTDVTE 506

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           ++             +  +E   EA+++ D+   ++  N+  Q+ +G     ++     +
Sbjct: 507 QFSAA-------AWSNAVLEAAPEAMLIVDEKGEIIFSNSRCQQLFGYHAEAMLGLQVEA 559

Query: 430 IIQDAQTRPIIEYRTSDPERSQDMSK 455
           ++  A     + YR       +D S 
Sbjct: 560 LLPQALGSEHVRYRQQFLRDGRDRSM 585


>gi|319427574|gb|ADV55648.1| multi-sensor hybrid histidine kinase [Shewanella putrefaciens 200]
          Length = 1770

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 132/701 (18%), Positives = 258/701 (36%), Gaps = 68/701 (9%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVF- 141
              +L   ++   Q      D+  +   E  +     + R         +   +  E+   
Sbjct: 607  LSILPADVDGSRQVAASIRDMTQKLAIEQKIRDSELRFRGLVANIPGAVYRTRIGEVWVM 666

Query: 142  -ASSTKNSHYIGKKIGEIIPELSRSRS-------RSKTVQMSEASLDQQPYHVLSVNLPH 193
               S   +   G    + I    R+ S       R    Q  + +L QQ    +   + H
Sbjct: 667  EYISDNIADITGYAASQFIENRQRNFSSLILEEDRPLCHQHIDKALAQQETFEVEYRIRH 726

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GSI  ++ +      + EE     ++F                   ++K     L  +
Sbjct: 727  RDGSIRWVHEKG--KASYNEE--GFPLWFDGSID-----------DITESKLVSVELEAS 771

Query: 254  NICVETALSRGRCGLW--NFNFDNKK--FHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +        C ++   +   + +    LS +   ++G+  +N    F  IA  I  D
Sbjct: 772  RQQLTNITESIPCTVYQLRWRSPSDRAFTFLSGAALPMLGLQRDNLMNDFNIIAERIFDD 831

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A +       Q  + F  RH +G+  W++  A         +   G  MD+T+
Sbjct: 832  ERPEVVRALAGKSDDKLQWIREFRYRHPNGSIRWMEAGASGHVESDDVIIWNGYVMDITQ 891

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       +  +  ++  D    ++ CN  + +  G     L       
Sbjct: 892  RKTMEQELALSEAHFRALFDGATIGIINIDAKGLILDCNDQFCEDIGRAREELRNIPIFD 951

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
            ++                +   D           +     +    G  + +  +++ L  
Sbjct: 952  VLSPQDREIAKAQFKDLADGKVDH----------YRGERSFIRPSGEPMWMTVNVSALFD 1001

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
               Q   +   +                  TEL + + +  + KE A+ A+K K +FLA 
Sbjct: 1002 CHHQFESAVVSMVDM---------------TELKLLSDELLIAKEEADAASKAKGDFLAN 1046

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            MSHE+RTP+NAI+G S++  +    +    K   Y + I  + Q LL++IN+IL+ SKIE
Sbjct: 1047 MSHEIRTPMNAIIGMSQLCLQTALDK----KQKNYVEKIERASQSLLSIINDILDFSKIE 1102

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFP 667
              K+ ID     L  ++ +   +       K +++   +   +      D   + ++L  
Sbjct: 1103 AGKLDIDAVPFQLDTMLEDLSDMFSEKVVHKQLELLFAVAPNVPRHLFGDSLRLGQVLIN 1162

Query: 668  ILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
            +++N+IKFT   G++++  + + Q      +  ++ D+GIG+      K+ + F      
Sbjct: 1163 LMNNAIKFT-ERGEVLLSINLVEQQNDDVTLRFSVRDSGIGLTDEQQAKLFKSFSQADTS 1221

Query: 723  YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
              +  GG GLGLAI   L  L GG + + SQ G G+     
Sbjct: 1222 TTRKYGGTGLGLAICKQLVELMGGNIGVESQFGHGSTFYFT 1262



 Score =  123 bits (309), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/369 (9%), Positives = 103/369 (27%), Gaps = 19/369 (5%)

Query: 113 ESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTV 172
           +             +   +L+      +  S+++     G     ++  L       + +
Sbjct: 507 QFSAAAWSNAVLEAAPEAMLIVDEKGEIIFSNSRCQQLFGYHAEAMLG-LQVEALLPQAL 565

Query: 173 QMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFI 232
                   QQ           N+  +  + +          E+ L ++   +  +  +  
Sbjct: 566 GSEHVRYRQQFLRDGRDRSMANARHVRAVKADGNEFIA---EIALSILPADVDGSRQVA- 621

Query: 233 LFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF--HLSRSMYEIMGI 290
             +  R   +    +  + ++ +     ++     ++           ++S ++ +I G 
Sbjct: 622 --ASIRDMTQKLAIEQKIRDSELRFRGLVANIPGAVYRTRIGEVWVMEYISDNIADITGY 679

Query: 291 PYENK-TLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
                     R  + LI  +++ +C           +  +  + +RH  G+  W+  + +
Sbjct: 680 AASQFIENRQRNFSSLILEEDRPLCHQHIDKALAQQETFEVEYRIRHRDGSIRWVHEKGK 739

Query: 350 MMRTISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIECT----SEALVLWDKNDRL 404
                 G      G   D+TE   +      + Q+L+   E       +       +   
Sbjct: 740 ASYNEEGFPLWFDGSIDDITESKLVSVELEASRQQLTNITESIPCTVYQLRWRSPSDRAF 799

Query: 405 VMCNANYQKAYGLPDHVLVPG-NARSIIQDAQTRPIIEYRTS---DPERSQDMSKEIKLA 460
              +       GL    L+   N  +       RP +    +   D +         +  
Sbjct: 800 TFLSGAALPMLGLQRDNLMNDFNIIAERIFDDERPEVVRALAGKSDDKLQWIREFRYRHP 859

Query: 461 DSRWLQINE 469
           +     +  
Sbjct: 860 NGSIRWMEA 868



 Score = 56.5 bits (135), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 36/326 (11%), Positives = 106/326 (32%), Gaps = 13/326 (3%)

Query: 134 AQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPH 193
                + + +S      +  ++  ++PE     +    +      L      +L      
Sbjct: 269 VDVQGISYLASVATVPKLKWRVVVMVPEQELFTALLDDIASIVLDLSLLTLLLLLTCYLT 328

Query: 194 NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
                  +      +  + E    ++       + ++ +  ++ + A+   E +  +L++
Sbjct: 329 AKRLTRPLELLESGILAFGEGKAQQLAIPKGAVSEIVTLSQTFNQMAELLAEREQAILDS 388

Query: 254 N-ICVETALSRGRCGLW--NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
                   +       +  +     +   +S  + +++GI  E     ++ +      + 
Sbjct: 389 RGNRFARLIDGMSDKSFYCSLEPSGQLAQVSDGVTKVLGIAPELLKRKYQRLFSANPLNE 448

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGI-AMDLTE 369
           K        +  K          M  A G    + V  Q + + +G +  + +   D+TE
Sbjct: 449 KNW--QYTDLALKGQNVPSHQVEMIDAQGHLRRLDVFMQPLVSETGELMSVEMLFTDVTE 506

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           ++             +  +E   EA+++ D+   ++  N+  Q+ +G     ++     +
Sbjct: 507 QFSAA-------AWSNAVLEAAPEAMLIVDEKGEIIFSNSRCQQLFGYHAEAMLGLQVEA 559

Query: 430 IIQDAQTRPIIEYRTSDPERSQDMSK 455
           ++  A     + YR       +D S 
Sbjct: 560 LLPQALGSEHVRYRQQFLRDGRDRSM 585


>gi|114570768|ref|YP_757448.1| PAS/PAC sensor hybrid histidine kinase [Maricaulis maris MCS10]
 gi|114341230|gb|ABI66510.1| PAS/PAC sensor hybrid histidine kinase [Maricaulis maris MCS10]
          Length = 1070

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 120/678 (17%), Positives = 248/678 (36%), Gaps = 54/678 (7%)

Query: 100 NNIKFDLASQKKAESMLGQLLAKTRFLSESFIL-LAQPNELVFASSTKNSHYIGKKIGEI 158
            +I   + ++++    L +  +    + +  +  +  P  +V   +       G    EI
Sbjct: 274 TDITAQIETRERLSRALRESQSLMDVIRQHTVFSVTDPAGVVTDVNDAFCQQSGYTKEEI 333

Query: 159 IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
           + +  ++   S          D     + S           I N        W + +   
Sbjct: 334 LGKTHQTLLSSGMHP------DAFWVEMRSTIKAGRPWRGEICNRNKSGELFWVDSIVAP 387

Query: 219 VVFFSIISALLLFILFSYYRQAKKNKEND-------TILLEANICVETALSRGRCGLWNF 271
            +         +FI F         K  +         L  +   +      G  G W  
Sbjct: 388 QMNAGGEIERYIFIRF----DITNRKHIEAGLAASQRQLEASLERLSAVTELGGIGSWEV 443

Query: 272 NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI 331
           + D           +I  +   +   +          +++     A +   +  +  D  
Sbjct: 444 DLDTMTPIWDDITRKIHEVD-GDYVPNMDTAINFYAPESRGPISDAVAHCVETGEPWDLE 502

Query: 332 FHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
             +  A+   IW++   + +      + ++G   D++E+   E+       RL  A+E +
Sbjct: 503 LPLITATNRRIWVRAVGRRVLRDGKPIRLVGSFQDVSERREREEELRLISTRLEVALESS 562

Query: 392 SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG-NARSIIQDAQTRPIIEYRTSDPERS 450
              +            +   ++ +G+      P  +          R  +    ++   +
Sbjct: 563 GIGVWDICPPTGEYHWDDGSRRLFGIDRDSANPAPDDWFNGIHPDDREAVSAGLANAYAT 622

Query: 451 QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLST 510
           +   +              +   DGG   + +     +   A    +   L  + +    
Sbjct: 623 KTHVRREYR----------YRRSDGGYRHIRSFGVYRERLDAPPIITGVHLDVSADI--- 669

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
                           A  ++ +ERAE+A+  KS+FLA MSHE+RTPLN +LG ++V+  
Sbjct: 670 -------------EQAAALELARERAESASYAKSQFLANMSHEIRTPLNGVLGMTQVLHM 716

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
                  + +   + + I  SGQ L ++I++IL++SKIE+  I ++++  ++  ++    
Sbjct: 717 TEL----TEQQSRHVETIRSSGQALADLIDDILDISKIESGMIELEQRAFEMPELVAMVS 772

Query: 631 RLIGSSAQSKNIKIEKKIPSEL--FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            +    AQ K + ++  +  ++      D++ +++IL  I+ N++KFT++ G++ I    
Sbjct: 773 DITRLRAQEKQLALDMSLAPDVAKVVVGDEKRLRQILINIVGNAVKFTDS-GRVSIDIRA 831

Query: 689 -IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
                V   I+DTG GI    L  I   F    N   +  GG GLGLAI   L  L GG 
Sbjct: 832 GAEDVVEFRISDTGPGIEPDHLASIFDRFAQADNSITRQYGGTGLGLAICHELVTLMGGE 891

Query: 748 LKIISQEGKGTIVTICMP 765
           + + S  G+G+     +P
Sbjct: 892 IGVESVPGEGSTFWFKLP 909



 Score =  108 bits (269), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 54/445 (12%), Positives = 129/445 (28%), Gaps = 50/445 (11%)

Query: 65  TSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR 124
             ++  +       ++      + L   IE +            +++  +   + LA   
Sbjct: 122 LGTLCAIHDEPLTLDETARNRLISLARLIEELI-----------RERVGAREHERLALVA 170

Query: 125 FLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSR------SKTVQMSEAS 178
             + + +++   + ++   +       G K+ E+   L  +              ++EA 
Sbjct: 171 RHTHNSVVITDRDGVIDWVNPAFERLSGYKLAEVRGRLPGTFLLCPNSDSGAVKALAEAV 230

Query: 179 LDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYR 238
            D +   V  VN   N     I+    P+            V   I +            
Sbjct: 231 RDGRECQVELVNRAKNGAEYTILIELTPIRDEDGCCTGFMSVQTDITA------------ 278

Query: 239 QAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLS 298
           Q +  +     L E+   ++         +   +       ++ +  +  G   E     
Sbjct: 279 QIETRERLSRALRESQSLMDVIRQHTVFSV--TDPAGVVTDVNDAFCQQSGYTKEEILGK 336

Query: 299 FRA--IARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG 356
                ++  +H D      +    T K  +        R+ SG   W+           G
Sbjct: 337 THQTLLSSGMHPD---AFWVEMRSTIKAGRPWRGEICNRNKSGELFWVDSIVAPQMNAGG 393

Query: 357 GM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS-------EALVLWDKNDRLVMCN 408
            +   I I  D+T + H+E   A + ++L  ++E  S             D +    + +
Sbjct: 394 EIERYIFIRFDITNRKHIEAGLAASQRQLEASLERLSAVTELGGIGSWEVDLDTMTPIWD 453

Query: 409 ANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD---PERSQDMSKEIKLADSRWL 465
              +K + +    +   +        ++R  I    +         D+   +  A +R +
Sbjct: 454 DITRKIHEVDGDYVPNMDTAINFYAPESRGPISDAVAHCVETGEPWDLELPLITATNRRI 513

Query: 466 QINE---WCTHDGGTISVGTDITLL 487
            +         DG  I +      +
Sbjct: 514 WVRAVGRRVLRDGKPIRLVGSFQDV 538



 Score = 51.5 bits (122), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/170 (12%), Positives = 55/170 (32%), Gaps = 14/170 (8%)

Query: 353 TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQ 412
             +    +I +A  + E+   E+  A   +RL+     T  ++V+ D++  +   N  ++
Sbjct: 136 DETARNRLISLARLI-EELIRERVGAREHERLALVARHTHNSVVITDRDGVIDWVNPAFE 194

Query: 413 KAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQIN-EWC 471
           +  G     +      + +    +        ++  R           D R  Q+     
Sbjct: 195 RLSGYKLAEVRGRLPGTFLLCPNSDSGAVKALAEAVR-----------DGRECQVELVNR 243

Query: 472 THDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
             +G   ++  ++T ++                      +R+ L R   E
Sbjct: 244 AKNGAEYTILIELTPIRDEDGCCTGFMSVQTDITAQ-IETRERLSRALRE 292


>gi|153869151|ref|ZP_01998829.1| Signal Transduction Histidine Kinase [Beggiatoa sp. PS]
 gi|152074304|gb|EDN71172.1| Signal Transduction Histidine Kinase [Beggiatoa sp. PS]
          Length = 1630

 Score =  399 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 135/668 (20%), Positives = 248/668 (37%), Gaps = 52/668 (7%)

Query: 105  DLASQKKAESMLG---QLLAKTRFLSESFILLAQ-PNELVFASSTKNSHYIGKKIGEIIP 160
            D+ ++K+AE  L    + +       +S + ++      V   +     Y  K   ++I 
Sbjct: 958  DITARKQAEDALKKANERVTTVLDSLDSAVYVSDMQTYNVLFVNKYAQKYYNKN--DVIG 1015

Query: 161  ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
            ++                      +   +        +        +   W       + 
Sbjct: 1016 KMCWQTFHIGQTGPC-----NFCTNAQLITEEGQPTDVHTWEFEDTVQNRWFYVQDRAIP 1070

Query: 221  FFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHL 280
            +       L     S Y      K     L E    +         G+   N +    + 
Sbjct: 1071 WDDGRLVRL-----SVYTDITPRKRALEALREREAYLHAIFENAAVGIMLANAEGNFINC 1125

Query: 281  SRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHV-KQLDQIFHMRHASG 339
            +    E+ G   +   L       + H ++ +I         ++              +G
Sbjct: 1126 NIKWLEMTGYSCDE--LYQLTYLDVTHPNDIEISRQHFGPLTRNAIDSYHIEKRFVRKNG 1183

Query: 340  ADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
            +  W  V   ++R   G   +++G+ +D+TE+   E+    ++ R    +E  +E +  +
Sbjct: 1184 SFFWADVSVTVIRNQQGIFDSVVGVIVDITERKQAEEALRASEARYRGVVEDQTELICRF 1243

Query: 399  DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK 458
              +  L   N  Y +  G+    ++ G   S +     R  +          +D      
Sbjct: 1244 LPDTTLTFVNHAYCRHLGIQREAII-GTKFSKLIPEVARKDVLAHLQQLINQKDS----- 1297

Query: 459  LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
                               + V        +     ++   R            Q + R 
Sbjct: 1298 -------------------MIVYEHPIETANGHKGWQQWSDRAITDDAGRILEIQAVGRD 1338

Query: 519  KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
             TE   A  K Q  KE AE AN+ KS FLA MSHELRTPLN ILG+++++ ++       
Sbjct: 1339 ITERKQAEEKLQEAKEAAEAANRAKSAFLANMSHELRTPLNGILGYAQIMGRDSH---LC 1395

Query: 579  VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
              Y E    I  SG +LL +IN+IL++SKIE  KI +   +      I     +    A+
Sbjct: 1396 ENYREGIGIIERSGNYLLTLINDILDLSKIEAGKIELYPTDFYFNQFIQAITEIFQMRAE 1455

Query: 639  SKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIIT 696
             K+I    +  S L    +AD++ +++IL  +L N++KFT   G ++++     + +   
Sbjct: 1456 QKSISFNYQPLSSLPLAVHADEKRLRQILINLLGNAVKFTKQGG-IVLKVGLEKEKIRFQ 1514

Query: 697  IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
            + DTGIGI    L+ I  PF  + N   ++  G GLGL+I+  L ++ GG L + S  G+
Sbjct: 1515 VEDTGIGIATEDLDNIFSPFLQVGNPNYRA-EGTGLGLSITQKLVDMMGGELHVESVLGQ 1573

Query: 757  GTIVTICM 764
            G+   + +
Sbjct: 1574 GSRFWMVL 1581



 Score =  179 bits (454), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 45/293 (15%), Positives = 90/293 (30%), Gaps = 17/293 (5%)

Query: 234 FSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYE 293
               ++  + ++ +  L  +    E A+     GLW++N + ++ + S    E++G    
Sbjct: 422 IRLQQEIDERQQIEKALRASEKRFELAMQGANDGLWDWNLETQEVYFSPRWKEMLGYADH 481

Query: 294 NKTLSFRAIARLIHYDNKKI-CEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR 352
                     + IH   +    +   +   K +   + I  ++H  G  IW+  R   + 
Sbjct: 482 EILNHCDEWHKRIHQTERAQTMDNIAAYLDKDIPTYENIHRLQHRHGPYIWVLARGIALW 541

Query: 353 TISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANY 411
              G  +  +G  +DLTE+   E+   ++ +R+    E     + +       +  N   
Sbjct: 542 NAQGKAIRFVGTHVDLTEQKQAEEALRKSQERIRHFFELPLIGMAITSPTKGWLQVNDKL 601

Query: 412 QKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWC 471
              +G     +     R I         +E R                 D   +      
Sbjct: 602 CDLFGYTRDEIFQKEWREITHSDDLAAHLEQRNQLLCGKS---------DGYTMDKRFIR 652

Query: 472 THDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSI 524
             DG TI      T L     +           +    T R+  E    E   
Sbjct: 653 -KDGNTI-----FTNLSVRCVRNLAGTVDYFVVLIQDITERKQAENLLREKEE 699



 Score =  157 bits (398), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 51/450 (11%), Positives = 125/450 (27%), Gaps = 31/450 (6%)

Query: 94  EIIFQNNNIKFDLASQKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHY 150
           E+  QN  ++ ++  +++ E  L     +       +   +            S +    
Sbjct: 416 ELAQQNIRLQQEIDERQQIEKALRASEKRFELAMQGANDGLWDWNLETQEVYFSPRWKEM 475

Query: 151 IGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRL 210
           +G    EI+        R    + ++   +   Y    +    N      I+        
Sbjct: 476 LGYADHEILNHCDEWHKRIHQTERAQTMDNIAAYLDKDIPTYEN------IHRLQHRHGP 529

Query: 211 WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
           +   +   +      +          +    + K+ +  L ++   +         G+  
Sbjct: 530 YIWVLARGIAL--WNAQGKAIRFVGTHVDLTEQKQAEEALRKSQERIRHFFELPLIGMAI 587

Query: 271 FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKI-CEIARSVTGKHVKQLD 329
            +       ++  + ++ G   +      +    + H D+     E    +         
Sbjct: 588 TSPTKGWLQVNDKLCDLFGYTRDEIFQ--KEWREITHSDDLAAHLEQRNQLLCGKSDGYT 645

Query: 330 QIFHMRHASGADIWIQVRAQMMRT-ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
                    G  I+  +  + +R         + +  D+TE+   E    E ++ L   I
Sbjct: 646 MDKRFIRKDGNTIFTNLSVRCVRNLAGTVDYFVVLIQDITERKQAENLLREKEEFLRLII 705

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLP--DHVLVPGNARSIIQDAQTR----PIIEY 442
           +   + +   + N+  + CN  + K          +V      +                
Sbjct: 706 DNIPQLIFWKEINNVYLGCNKAFAKLLIESKQPVDVVGKTDFDLNLPFDQAQNLSETDSE 765

Query: 443 RTSDPERSQDMSKEIKLADS-RWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRL 501
                       +EI  ++  RW++ N+   HD     +G   T     + +  E     
Sbjct: 766 IMETDTPQYHYVEEIYQSNGKRWVESNKIPLHDSTCQVIGILGTSEDITERKQAELLLTE 825

Query: 502 KATINDLSTSRQILERQKTELSIANAKYQV 531
                      Q LER   E + A  + + 
Sbjct: 826 Y---------NQTLERDVAERTRALREQKA 846



 Score =  109 bits (272), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 57/442 (12%), Positives = 149/442 (33%), Gaps = 49/442 (11%)

Query: 102  IKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSHYI--GKKIG 156
            +  D+  +K+AE++L +     R + ++    I   + N +    +   +  +   K+  
Sbjct: 680  LIQDITERKQAENLLREKEEFLRLIIDNIPQLIFWKEINNVYLGCNKAFAKLLIESKQPV 739

Query: 157  EIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
            +++ +     +       + +  D +        +  ++     +          R   +
Sbjct: 740  DVVGKTDFDLNLPFDQAQNLSETDSE-------IMETDTPQYHYVEEIYQSNGK-RWVES 791

Query: 217  LEVVFFSIISALLLFILFSYYRQAKKNKEND------------------TILLEANICVE 258
             ++        ++  +  S      + K+ +                    L E    + 
Sbjct: 792  NKIPLHDSTCQVIGILGTSE--DITERKQAELLLTEYNQTLERDVAERTRALREQKAFLR 849

Query: 259  TALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE-IA 317
              +      ++  +  +     +R + + + +    +         L+  ++ +  +   
Sbjct: 850  LIIDNIPQLIFWKDIHSVFLGCNRRVAQFVQLKNPKEIKGKTDF-DLVWKEHAEYFQDQD 908

Query: 318  RSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKR 376
            R V   ++ +   I  +   +G+  W +     +   SG  + I+G   D+T +   E  
Sbjct: 909  RRVMLTNIPEYHTIESITRPNGSVFWGETNRIPLHDDSGKVVGILGTVEDITARKQAEDA 968

Query: 377  YAEADQRLSKAIECTSEALVLWDKND-RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQ 435
              +A++R++  ++    A+ + D     ++  N   QK      + ++           Q
Sbjct: 969  LKKANERVTTVLDSLDSAVYVSDMQTYNVLFVNKYAQKY--YNKNDVIGKMCWQTFHIGQ 1026

Query: 436  TRP-----IIEYRTSDPERSQDMSKEIK-LADSRWLQINEWCTH--DGGTI--SVGTDIT 485
            T P       +  T + + +   + E +    +RW  + +      DG  +  SV TDIT
Sbjct: 1027 TGPCNFCTNAQLITEEGQPTDVHTWEFEDTVQNRWFYVQDRAIPWDDGRLVRLSVYTDIT 1086

Query: 486  LLKHNQAQLRESKRRLKATIND 507
              K     LRE +  L A   +
Sbjct: 1087 PRKRALEALREREAYLHAIFEN 1108


>gi|119776084|ref|YP_928824.1| sensory box histidine kinase/response regulator [Shewanella
            amazonensis SB2B]
 gi|119768584|gb|ABM01155.1| sensory box histidine kinase/response regulator [Shewanella
            amazonensis SB2B]
          Length = 1763

 Score =  399 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 135/702 (19%), Positives = 251/702 (35%), Gaps = 73/702 (10%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNEL--V 140
              +L        Q      DL  Q   E  + +  ++ R         +   + N    +
Sbjct: 607  LSLLPADSRGQRQVAASIRDLTEQLAVERQIRESESRFRGLVSNIPGAVYRTRINGTWTM 666

Query: 141  FASSTKNSHYIGKKIGEII-------PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPH 193
               S   +   G      I         L       +   +   +L +Q    +   + H
Sbjct: 667  EYVSDNITELTGYPAWHFIESKKRSFGSLILDEDAERCDAIISGALAEQHAFEVEYRIRH 726

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GS+  ++ +               V+F                   ++K     + ++
Sbjct: 727  RDGSLRWVHEKGKASYD----EDGNPVWFDGSLN-----------DITESKLAQERIEQS 771

Query: 254  NICVETALSRGR----CGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +ET            +W    D +   LS +    +G        +F  +A  I  +
Sbjct: 772  REQLETITESVPSTVYQLVWRSERDRRFTFLSSAAMATLGFHRNEVLDNFELVAERIVEE 831

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
            ++   EI + + G+H  Q  + F     SG   W++  A+  +     +   G  MD++ 
Sbjct: 832  DRG--EIIQMLAGRHGMQWTKAFRYHFPSGELRWLEAGARGSKQQD-ALVWNGYLMDISG 888

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E   A+++       +     +V  D    +  CN  +    G+    L       
Sbjct: 889  RKRMETELAQSEAHFRALFDNAGIGIVNLDDRGIIKDCNGQFVSDLGISSDSLKRKQLAD 948

Query: 430  IIQDAQTRPII-EYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
            ++           Y+         +S E ++ D            DG  + +    ++L+
Sbjct: 949  LMHPEDRALATGLYQALAESEQGSISGEWRMLDG-----------DGELMWMAVIASVLE 997

Query: 489  HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLA 548
                  R     +                  T L + + +    KE A+ AN+ KS+FLA
Sbjct: 998  EGDGGERSVVMSIAN---------------ITRLKLLSDELMAAKEDADAANQAKSDFLA 1042

Query: 549  KMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKI 608
             MSHE+RTP+NAI+G S++  +         K   Y + I  + + LL +IN+IL+ SKI
Sbjct: 1043 NMSHEIRTPMNAIIGMSQLCLQTELDR----KQRNYVEKIERASKSLLGIINDILDFSKI 1098

Query: 609  ETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILF 666
            E  K+ I+     L  I+ +   +    A  K +++   +   +      D   + ++L 
Sbjct: 1099 EAGKLDIEVVPFQLDTILEDLGDMFSVKAADKQLELLFSVAPGVPTHLEGDPLRLSQVLI 1158

Query: 667  PILSNSIKFTNNNGKMMIRTS---KIGQCVI--ITIADTGIGIPKSALEKIGQPFEPLHN 721
             +++N+IKFT   G++M+  S   +    V     + D+GIG+      K+ + F     
Sbjct: 1159 NLMNNAIKFT-ERGEVMLSISELARDEDQVQLKFAVRDSGIGLTAEQQAKLFKSFSQADT 1217

Query: 722  QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
               +  GG GLGLAI   L  L GG + + SQ G G+     
Sbjct: 1218 STTRKYGGTGLGLAICKQLVELMGGEIGVDSQFGNGSTFYFT 1259



 Score =  128 bits (322), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/370 (10%), Positives = 110/370 (29%), Gaps = 19/370 (5%)

Query: 113 ESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTV 172
           +             +   +L+   +  +  S+++     G    E++  L+      +  
Sbjct: 507 QFSAAAWSNAVLEAAPEAMLIVDESGQLVFSNSRCQELFGYSGEEMLN-LNIDALIPENE 565

Query: 173 QMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFI 232
           +       Q         +  N   +  +        +   ++ L ++         +  
Sbjct: 566 RHGHQGKRQLFIEGGRDKVMANGKPLHALKCGGEQFPV---QIGLSLLPADSRGQRQVA- 621

Query: 233 LFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF--HLSRSMYEIMGI 290
             +  R   +    +  + E+       +S     ++    +      ++S ++ E+ G 
Sbjct: 622 --ASIRDLTEQLAVERQIRESESRFRGLVSNIPGAVYRTRINGTWTMEYVSDNITELTGY 679

Query: 291 PY-ENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
           P         R+   LI  ++ + C+   S         +  + +RH  G+  W+  + +
Sbjct: 680 PAWHFIESKKRSFGSLILDEDAERCDAIISGALAEQHAFEVEYRIRHRDGSLRWVHEKGK 739

Query: 350 MMRTISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIEC----TSEALVLWDKNDRL 404
                 G      G   D+TE    ++R  ++ ++L    E       + +   +++ R 
Sbjct: 740 ASYDEDGNPVWFDGSLNDITESKLAQERIEQSREQLETITESVPSTVYQLVWRSERDRRF 799

Query: 405 VMCNANYQKAYGLPDHVLVPGNAR--SIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADS 462
              ++      G   + ++         I +     II+            +        
Sbjct: 800 TFLSSAAMATLGFHRNEVLDNFELVAERIVEEDRGEIIQMLAGRHGMQWTKAFRYHFPSG 859

Query: 463 --RWLQINEW 470
             RWL+    
Sbjct: 860 ELRWLEAGAR 869



 Score = 60.8 bits (146), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 78/213 (36%), Gaps = 13/213 (6%)

Query: 244 KENDTILLEAN-ICVETALSRGRCGLW--NFNFDNKKFHLSRSMYEIMGIPYENKTLSFR 300
           +E +  LL++      T +       +  +   D     +S  + +++GI  E     ++
Sbjct: 379 EEREQALLDSRGNRFATLIDGMSDKSFYCSMTPDGNIDQVSAGVEKVLGISPEVLKRKYQ 438

Query: 301 AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI 360
            +      + +        +  +          M  A G+   + +  Q +    G +  
Sbjct: 439 RLFSSNAINEQNW--QFMEMALRGEAVPPHQVEMAGADGSLRRLDLFMQPLLDDEGQLIS 496

Query: 361 IGIAM-DLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPD 419
           + +   D+TE++             +  +E   EA+++ D++ +LV  N+  Q+ +G   
Sbjct: 497 VEMLFNDVTEQFSAA-------AWSNAVLEAAPEAMLIVDESGQLVFSNSRCQELFGYSG 549

Query: 420 HVLVPGNARSIIQDAQTRPIIEYRTSDPERSQD 452
             ++  N  ++I + +       R    E  +D
Sbjct: 550 EEMLNLNIDALIPENERHGHQGKRQLFIEGGRD 582


>gi|119944259|ref|YP_941939.1| multi-sensor histidine kinase [Psychromonas ingrahamii 37]
 gi|119862863|gb|ABM02340.1| multi-sensor histidine kinase with CHASE and PAS/PAC sensory
           domains [Psychromonas ingrahamii 37]
          Length = 1255

 Score =  399 bits (1025), Expect = e-108,   Method: Composition-based stats.
 Identities = 111/692 (16%), Positives = 257/692 (37%), Gaps = 59/692 (8%)

Query: 101 NIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFAS-------STKNSHYIGK 153
            +  +   Q +A  ++   + +    +++   LA+    +          +       G+
Sbjct: 188 KLVQETGKQDQAGFLMYVPIYQNGTNNDT---LAERQAHILGWVYSPFRMNDLMEGLFGE 244

Query: 154 KIGE-----IIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
           +  +        E   + +          +   +      +++  +  ++  I     + 
Sbjct: 245 RANDMDIQIFDGETMSNEALLYDSSAVNVATTNEFEATRILHIADHPWTVQ-IRPLDSMT 303

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKN-----KENDTILLEANICVETALSR 263
              R      V    II ++   +L  +    ++      +  +  L      +   +  
Sbjct: 304 SRIRAVSPNLVASIGIILSVFFTVLIWFLVSGRERAINTARYINKELSIERQRLSDIIDA 363

Query: 264 GRCGLWNFNFDNKKFHLSRSMYEIMGIPYENK-TLSFRAIARLIHYDNKKI-CEIARSVT 321
              G W +N    +   +     ++G         SF    + IH ++K++  +  +   
Sbjct: 364 TNSGTWQWNIQTGEAFFNDHWPRVLGYELSELGPTSFETWLKFIHPEDKELSIKRLQKHL 423

Query: 322 GKHVKQLDQIFHMRHASGADIWIQVRAQMMRT--ISGGMNIIGIAMDLTEKYHLEKRYAE 379
              +   +    MRH  G  +W+  R ++         + + G   D+T++    ++  +
Sbjct: 424 SGELDYYEYETRMRHKKGGWVWVLARGKVTTWTADGKPLLMCGTHQDITKQKFATEQLQD 483

Query: 380 ADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPI 439
           +   +   +    + ++  ++   +   N   +  +G     ++ G+  +++     R  
Sbjct: 484 SAALIEAILNTVVDGIITINEYGIVESINPAAEHIFGYSATEVI-GHNITMLMPESYRSQ 542

Query: 440 IEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKR 499
            +        + +             +I E    +G    +   ++ +   + +L     
Sbjct: 543 HDGYIEHFNITGEAKIVG------IDRIIEGKRKNGSIFPMELGVSKVLLGEKKLF---- 592

Query: 500 RLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLN 559
                          + R  TE   A       K  AE AN  KS+FLA MSHE+RTP+N
Sbjct: 593 -------------ASVVRDITEQKRAKQALISAKTEAEKANLAKSQFLAAMSHEIRTPMN 639

Query: 560 AILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQN 619
            ++G  +V+++            +    I  S   LL++I +IL+ SKIE  K+ I+   
Sbjct: 640 GVIGMVDVLQQSSLKGF----QVDMVDTIRDSAFSLLSIIEDILDFSKIEAGKLDIEYAP 695

Query: 620 ADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFT- 676
             +  ++ +   ++   A+ K +++       +      D   +++I+  + +N+IKF+ 
Sbjct: 696 MAVAEVVEKACFMLAHLAEKKKVELTLFTDPAIPDITLGDANRLRQIVVNLTNNAIKFSS 755

Query: 677 --NNNGKMMIRTSKIG-QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLG 733
             +  G++ ++        + I + D GIG+ +SAL K+  PF        +  GG GLG
Sbjct: 756 GSDRPGRVSVQALMTDPTMLEIRVIDNGIGMNESALSKLFMPFYQADVTTTRRFGGTGLG 815

Query: 734 LAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + I+  L  L GG + + S   KG+I ++ +P
Sbjct: 816 ITIARNLVQLMGGEITVQSTLNKGSIFSVHLP 847


>gi|317152599|ref|YP_004120647.1| PAS sensor protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316942850|gb|ADU61901.1| PAS sensor protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 876

 Score =  399 bits (1025), Expect = e-108,   Method: Composition-based stats.
 Identities = 128/724 (17%), Positives = 258/724 (35%), Gaps = 71/724 (9%)

Query: 100 NNIKFDLASQKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKIG 156
             +  D+   K+AE  L Q     R +   + + +++   + +V   +++     G    
Sbjct: 156 RGVVIDITDTKRAEEALYQSENYYRTIFEHTGTAMIIFGADAVVHRCNSQFETLTGYTAD 215

Query: 157 EIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
           EI+        ++  + ++   L++         +   S       + +      +    
Sbjct: 216 EIVN------RKTWDIFVAPEDLERVRGFNRQRRMQDPSVPSDYEMTILTKDGDRKLAHL 269

Query: 217 LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
                      +   I              +  L ++    E        G+W+++    
Sbjct: 270 FVQAIPRTDDMVCSLI------DITARHRTERALRDSEKRYELVARGANDGIWDWDLQTD 323

Query: 277 KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKK-ICEIARSVTGKHVKQLDQIFHMR 335
               S    E++G        +  +    IH D+ + I    R+ T     Q +  + +R
Sbjct: 324 TIFYSARYREMLGYEEAEFPNTSDSWKNAIHPDDLEPILAANRTCTEGGTDQFEVEYRLR 383

Query: 336 HASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEA-------------- 380
           H  G   W+  R    R   G    + G   D+TE+   E+                   
Sbjct: 384 HKDGTYRWVLGRGASARDERGEVYRLAGTHTDITERKLSERTTQAMYAISKAISTTDNLQ 443

Query: 381 ------DQRLSKAIECTSEALVLWDKNDRLVMC--------------NANYQKAYGLPDH 420
                    L + I+ T+  + L+D+    V                N +     GL  H
Sbjct: 444 ALYETIHAILGQVIDATNFFIALYDEPGDRVAFAYFADDKDELYDIRNVSDPNTRGLTVH 503

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLA-DSRWLQINEWCTHDGGTIS 479
           +L  G    I Q     P              +   + L    R +       +      
Sbjct: 504 ILRTGRPLFISQADPIPPENARNIGIVGTPAAVWLGVPLKLKGRTMGAMAVQHYTNPRHY 563

Query: 480 VGTDITLLKHNQAQL---RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERA 536
              D++ L+    Q+    E K   +           ++E + TEL +  ++ +   +R 
Sbjct: 564 TDADVSFLEAVSEQVALAIERKSNEEELTRFSEDLEDMVELRTTELQVQASELESANQRL 623

Query: 537 ETANKTKSEFLAKMSHELRTPLNAILGFSEV-----------IKKEIFGELGSVKYYEYA 585
              +  KS  ++ +SHELRTPL +I GF+++           + +    E    +  +  
Sbjct: 624 TELDTIKSALVSSISHELRTPLTSIRGFAKLTRKEFVRHFLPLAESPLAEAKGERIRQNL 683

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE-GIRLIGSSAQSKNIKI 644
             I   G+ L  +IN+ L++++IE+ K+  + Q  +   ++++    L G+ A    IK+
Sbjct: 684 GIIETEGERLTRLINDFLDINRIESGKVVWNDQFLNPCEVVHQAANALAGALAARPAIKL 743

Query: 645 EKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIG 703
           +  +P  +   +AD   ++++L  +L+N+ KFT   G + I  +     + IT++DTG+G
Sbjct: 744 KLSLPPTVPLIHADPDKVQQVLINLLNNACKFTAE-GFIKISVTGNVDSLTITVSDTGMG 802

Query: 704 IPKSALEKIGQPFEPLHNQYD--QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           I       I + F              G GLGL+I   +   +GG + + S  G+G+  +
Sbjct: 803 IGPEDQPNIFEKFYKARAGDTLVAEARGTGLGLSICKEIVEHYGGSIWVDSTLGQGSAFS 862

Query: 762 ICMP 765
             +P
Sbjct: 863 FTLP 866



 Score =  123 bits (309), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/372 (9%), Positives = 96/372 (25%), Gaps = 29/372 (7%)

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
            +            +       G    ++        +     Q+       +    ++ 
Sbjct: 63  IVYEMDLEGRFVYVNAFALKRFGFTAQDV-------ATGLYLHQILHPDSIGRARAGMAR 115

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
            L     +     +       +  +V  + VF    +      +          K  +  
Sbjct: 116 TLRGTGANGEEYIAVCKDGTSFPIKVYSQGVFSDGHA----TGVRGVVIDITDTKRAEEA 171

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
           L ++     T        +  F  D      +     + G   +      +     +  +
Sbjct: 172 LYQSENYYRTIFEHTGTAMIIFGADAVVHRCNSQFETLTGYTADEIVNR-KTWDIFVAPE 230

Query: 310 NKKICE--IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDL 367
           + +       +          D    +    G      +  Q +        ++   +D+
Sbjct: 231 DLERVRGFNRQRRMQDPSVPSDYEMTILTKDGDRKLAHLFVQAIPRTDD---MVCSLIDI 287

Query: 368 TEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP--G 425
           T ++  E+   ++++R        ++ +  WD     +  +A Y++  G  +        
Sbjct: 288 TARHRTERALRDSEKRYELVARGANDGIWDWDLQTDTIFYSARYREMLGYEEAEFPNTSD 347

Query: 426 NARSIIQDAQTRPIIEYRTSDPERSQDM---SKEIKLADS--RWLQINEWCTHDG----- 475
           + ++ I      PI+    +  E   D       ++  D   RW+        D      
Sbjct: 348 SWKNAIHPDDLEPILAANRTCTEGGTDQFEVEYRLRHKDGTYRWVLGRGASARDERGEVY 407

Query: 476 GTISVGTDITLL 487
                 TDIT  
Sbjct: 408 RLAGTHTDITER 419



 Score =  114 bits (285), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 44/324 (13%), Positives = 104/324 (32%), Gaps = 16/324 (4%)

Query: 255 ICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC 314
                 +      ++  + + +  +++    +  G   ++       + +++H D+    
Sbjct: 51  ERYRQMVDGLPQIVYEMDLEGRFVYVNAFALKRFGFTAQDVATGLY-LHQILHPDSIGRA 109

Query: 315 EIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLE 374
               + T +      + +      G    I+V +Q + +      + G+ +D+T+    E
Sbjct: 110 RAGMARTLRGTGANGEEYIAVCKDGTSFPIKVYSQGVFSDGHATGVRGVVIDITDTKRAE 169

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA 434
           +   +++       E T  A++++  +  +  CN+ ++   G     +V      I    
Sbjct: 170 EALYQSENYYRTIFEHTGTAMIIFGADAVVHRCNSQFETLTGYTADEIVNRKTWDIFVAP 229

Query: 435 QTRPIIE-----YRTSDPERSQDMSKEIKLADS-----RWLQINEWCTHDGGTISVGTDI 484
           +    +       R  DP    D    I   D               T D   +    DI
Sbjct: 230 EDLERVRGFNRQRRMQDPSVPSDYEMTILTKDGDRKLAHLFVQAIPRTDD--MVCSLIDI 287

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKS 544
           T     +  LR+S++R +      +      + Q   +  +   Y+      E      S
Sbjct: 288 TARHRTERALRDSEKRYELVARGANDGIWDWDLQTDTIFYSAR-YREMLGYEEAEFPNTS 346

Query: 545 EFLAKMSH--ELRTPLNAILGFSE 566
           +      H  +L   L A    +E
Sbjct: 347 DSWKNAIHPDDLEPILAANRTCTE 370


>gi|254293651|ref|YP_003059674.1| histidine kinase [Hirschia baltica ATCC 49814]
 gi|254042182|gb|ACT58977.1| histidine kinase [Hirschia baltica ATCC 49814]
          Length = 752

 Score =  398 bits (1024), Expect = e-108,   Method: Composition-based stats.
 Identities = 167/520 (32%), Positives = 267/520 (51%), Gaps = 23/520 (4%)

Query: 249 ILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHY 308
              E           G+ G W +N +   F L     E++G+  +N  LS +    LIH 
Sbjct: 240 AKKEIETHWRELEIGGQNGYWTWNRETGLFSLRTKTAEMLGL-IDNSDLSLQQFQELIHP 298

Query: 309 DNKKICEIARSVTGKHVKQLDQIFHMRHASGAD--IWIQVRAQMMRTISGGMNIIGIAMD 366
            N+K          KH K     F     +G+    + +++    +       + GI  D
Sbjct: 299 GNQKNVLYELEKA-KHNKSFQVSF---KGNGSFSSRYFEMQGGPFQDG-----LSGIMTD 349

Query: 367 LTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGN 426
            TE+   E R   ++       +        WD+  RL++ N ++ + + LP++VL  G 
Sbjct: 350 TTERVRAEARSRMSEHLARSVADAYPGPFASWDQRHRLLLWNRHFARLFNLPENVLKAGT 409

Query: 427 ARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITL 486
           +  ++     + I   R   P    D  +EI L    WL   +  T  GG ++VG DI+ 
Sbjct: 410 SYDVVMAEAAKQI---RIERPVPGSDNGREILLLSDIWLNFYDRPTAGGGLVTVGLDISS 466

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           +K++Q  L   +++L+            L+R + +      KY  EK +AE A++ KS F
Sbjct: 467 IKNHQESLLGKEKKLR-------RLVLELDRMQGQSEEHARKYAEEKTKAEKASQAKSVF 519

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLNAI GFSE++ KEI+G LG  +Y  YA+DI  SGQHLL+MIN+IL+M+
Sbjct: 520 LANMSHELRTPLNAINGFSEMLIKEIYGPLGDERYIGYAEDILSSGQHLLDMINDILDMA 579

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKIL 665
           KIE  K+SI  +  D +  ++  +R+I   A  K+I +   +  ++     D R IK+++
Sbjct: 580 KIEAGKMSISTREIDPVEAVDSAVRMIRRRAADKDIDLNLTVKDDIPDIEGDHRAIKQMV 639

Query: 666 FPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQ 725
             ++SN+IKFT+  G + I   K    V +++AD GIGIPK  + ++ QPFE      ++
Sbjct: 640 LNLVSNAIKFTDPGGYINISVVKENAFVRVSVADNGIGIPKQDIPRLAQPFEQSSADENR 699

Query: 726 SIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +  G GLGL+++ +   +HGGRL+I S+ G+GT V+  +P
Sbjct: 700 NSKGSGLGLSLTKSFAEMHGGRLEIESEFGEGTTVSFLLP 739


>gi|146338894|ref|YP_001203942.1| hypothetical protein BRADO1833 [Bradyrhizobium sp. ORS278]
 gi|146191700|emb|CAL75705.1| conserved hypothetical protein; putative sensor histidine kinase
           with a response regulator receiver domain
           [Bradyrhizobium sp. ORS278]
          Length = 787

 Score =  398 bits (1024), Expect = e-108,   Method: Composition-based stats.
 Identities = 147/591 (24%), Positives = 259/591 (43%), Gaps = 37/591 (6%)

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKEN----DTILL 251
             I+ +     L + W   + +  +   II A+L  +L     QA+   +     +  L 
Sbjct: 46  AMIMAVEQITDLKQDWIVSLLMLAIAAIIIMAVLTSMLIRNSAQARAMTQALTRQNEQLA 105

Query: 252 EANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNK 311
           +    +  A   GR G W    +      S  ++EI G+   +  +SF  +  +IH ++ 
Sbjct: 106 QTTKLLNEAQRIGRLGHW-MTAEGDAAVWSEELFEITGLEPLSS-VSFSKMIEIIHPEDV 163

Query: 312 KICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMN-IIGIAMDLTEK 370
                AR  T K    L Q   +    G   WI++ A  +  + G      GI  D+TE+
Sbjct: 164 GTYIRARDRTLKTGCALKQDLRVIRPDGEIRWIRIVADPIDDVDGRFRERFGIVQDITER 223

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
              E    +A Q L  AIE  ++  VL+DK+DR V+ N  +++ +     ++ PG + + 
Sbjct: 224 KQAEVAADQAQQLLLDAIEALTKGFVLFDKDDRFVLSNTRFREMFPGWATLMRPGISFTD 283

Query: 431 IQDAQTR-----------PIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTIS 479
           +                      R            E +  + RW+Q  +    DGGT+ 
Sbjct: 284 LMRKAHDHGLVRPKGDGFEDWLERKRAWHLGGSRMIEHREINGRWIQSVDHRISDGGTVC 343

Query: 480 VGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETA 539
           + TDIT  K  QA+L +        +  +   R  LE QK EL    A+ +  ++ AE A
Sbjct: 344 LVTDITAFKTVQAELEQ-------KLAYVQAIRSDLEEQKRELEATGAELRAARDAAEAA 396

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N+ KS+FLA MSHE+RTPL+ ++G  ++++    G   + +   Y      S   LL +I
Sbjct: 397 NRAKSDFLAIMSHEIRTPLSGMVGMVDLLR----GTSLNDEQKRYTSLAKESADLLLQVI 452

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNAD 657
           N+IL+ SK+E  K+  +  + D+  ++   +  +G  A+ + + ++      L      D
Sbjct: 453 NDILDFSKLEAGKLKSECIDFDVPSLVESAVSFMGEKARRRGLDLKVSFAPGLPQYLEGD 512

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRT--SKIGQC---VIITIADTGIGIPKSALEKI 712
              I++++  ++ N+IKFT   G + +     ++      + I + D+GIG+ +    +I
Sbjct: 513 PTRIRQVMLNLVGNAIKFT-EQGAIEVHASHRELDDGAVDLRIEVIDSGIGMSQEIQAQI 571

Query: 713 GQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
             PF        +  GG GLGLAI   L  + GG + + S+ G+G+     
Sbjct: 572 FDPFVQADTSISRKYGGSGLGLAICKQLCAIMGGSIGVESEPGRGSRFWFE 622


>gi|294496643|ref|YP_003543136.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
 gi|292667642|gb|ADE37491.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
          Length = 632

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 134/663 (20%), Positives = 239/663 (36%), Gaps = 76/663 (11%)

Query: 125 FLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSE-----ASL 179
             S   I++   N  +   +    H  G    E+    +   +  +  +  +        
Sbjct: 21  KQSVDSIVVTDTNSAIIYMNKAAEHLFGWSFEELKGRKTDVFNAEQMSEEIQKEIYDTVA 80

Query: 180 DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQ 239
             + Y+   +N   +     +     P+       +                      R 
Sbjct: 81  SGKIYNGELLNKKKDGTYFYVQIRISPIYDKKGNIIAY----------------MGSQRD 124

Query: 240 AKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSF 299
               K+ +  L +    +E  +      +   + ++     + S  +I G   E      
Sbjct: 125 ITNLKQTEKRLQQEREFLEKLIQTSPVAIHGTDTNSNVIIWNESSEKIFGWSREEV---I 181

Query: 300 RAIARLIHYDNKKI-CEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG- 357
                 +  +N      +   V         ++  +R   G+ ++  +    M    G  
Sbjct: 182 GEFLPTVPEENIDEHLSLRNRVLAGETITGYEVCRLR-KDGSYLYGSLSVAPMYDQKGNI 240

Query: 358 MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV--LWDKNDRLV--MCNANYQK 413
             I+    D+TEK   E +  EA  +L         ++     D+    V    +    +
Sbjct: 241 FGIMANMEDITEKKQYEYKLKEAFNQLESIHFNLPISVWSATVDETGDFVDTYISEGVNE 300

Query: 414 AYGLPDHVLVPGNARSIIQD-------AQTRPIIEYRTSDPERSQDMSKEIKLADS--RW 464
              LP + +  GN      +        + +   E    +P +      E+       RW
Sbjct: 301 LLALPPNTI--GNDFKAFLNYVKPHYLPEIKDKFEEGIKNPGKVVSFEYEVINGSGVTRW 358

Query: 465 LQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSI 524
              +     + GT+ V      +  N                                  
Sbjct: 359 FLSSGRAQEENGTVKVYGSTIDITKN--------------------------------KN 386

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           A       K  AE AN+ K+EFLA +SHELRTPLNAI+GFS+++     G L   +   Y
Sbjct: 387 AEKSLINAKLLAENANRAKTEFLANVSHELRTPLNAIIGFSQILSTNKSGNLNDKELK-Y 445

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
             +I  SG HLL +IN IL++SK++  K  ++ +  D   I  +    I      KN+  
Sbjct: 446 VSNILKSGNHLLELINKILDISKLQAGKQDLEIEYVDFAEICEDIKPFIDPLIAKKNLSF 505

Query: 645 EKKIP-SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIG 703
           E  +  ++    ADK  + +I+  +L N+IKFT  NG + I    IG    +++ DTGIG
Sbjct: 506 ECILDCTDTNIKADKTKMLQIMHNLLGNAIKFTPENGSIAINARCIGDNFQVSVKDTGIG 565

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           IP+++ + I   F+ + +   +   G GLGLA+      +HGG + + S+ GKG+  T  
Sbjct: 566 IPEASHKDIFHSFKQVDSSATRKYEGTGLGLALVKEYIEMHGGDIWVESEVGKGSTFTFV 625

Query: 764 MPQ 766
           +PQ
Sbjct: 626 IPQ 628



 Score =  105 bits (261), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 46/320 (14%), Positives = 96/320 (30%), Gaps = 29/320 (9%)

Query: 96  IFQNNNIKFDLASQKKAESMLG---QLLAKTRFLSESFILLAQPNELVFASSTKNSHYIG 152
           I      + D+ + K+ E  L    + L K    S   I     N  V   +  +    G
Sbjct: 115 IIAYMGSQRDITNLKQTEKRLQQEREFLEKLIQTSPVAIHGTDTNSNVIIWNESSEKIFG 174

Query: 153 KKIGEIIPE---LSRSRSRSKTVQMSEASLDQQPYHV-LSVNLPHNSGSILIINSRVPLL 208
               E+I E        +  + + +    L  +         L  +   +    S  P+ 
Sbjct: 175 WSREEVIGEFLPTVPEENIDEHLSLRNRVLAGETITGYEVCRLRKDGSYLYGSLSVAPMY 234

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGL 268
                                +F + +      + K+ +  L EA   +E+        +
Sbjct: 235 DQKGN----------------IFGIMANMEDITEKKQYEYKLKEAFNQLESIHFNLPISV 278

Query: 269 WN--FNFDNKKF--HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC-EIARSVTGK 323
           W+   +        ++S  + E++ +P       F+A    +         +        
Sbjct: 279 WSATVDETGDFVDTYISEGVNELLALPPNTIGNDFKAFLNYVKPHYLPEIKDKFEEGIKN 338

Query: 324 HVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQR 383
             K +   + + + SG   W     +  +  +G + + G  +D+T+  + EK    A   
Sbjct: 339 PGKVVSFEYEVINGSGVTRWFLSSGRA-QEENGTVKVYGSTIDITKNKNAEKSLINAKLL 397

Query: 384 LSKAIECTSEALVLWDKNDR 403
              A    +E L       R
Sbjct: 398 AENANRAKTEFLANVSHELR 417



 Score = 97.0 bits (240), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/286 (11%), Positives = 84/286 (29%), Gaps = 30/286 (10%)

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
               + +    +   + ++   +++++   + G  +E        +         +  + 
Sbjct: 16  WSEIVKQSVDSIVVTDTNSAIIYMNKAAEHLFGWSFEELKGRKTDVFN--AEQMSEEIQK 73

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEK 375
               T    K  +     +   G   ++Q+R   +    G +   +G   D+T     EK
Sbjct: 74  EIYDTVASGKIYNGELLNKKKDGTYFYVQIRISPIYDKKGNIIAYMGSQRDITNLKQTEK 133

Query: 376 RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQ 435
           R  +  + L K I+ +  A+   D N  +++ N + +K +G     ++ G     + +  
Sbjct: 134 RLQQEREFLEKLIQTSPVAIHGTDTNSNVIIWNESSEKIFGWSREEVI-GEFLPTVPEEN 192

Query: 436 TRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLR 495
               +  R            E+                DG  +     +  +   +  + 
Sbjct: 193 IDEHLSLRNRVLAGETITGYEV-----------CRLRKDGSYLYGSLSVAPMYDQKGNIF 241

Query: 496 ESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANK 541
                +                  TE      K +    + E+ + 
Sbjct: 242 GIMANM---------------EDITEKKQYEYKLKEAFNQLESIHF 272


>gi|294496206|ref|YP_003542699.1| multi-sensor signal transduction histidine kinase [Methanohalophilus
            mahii DSM 5219]
 gi|292667205|gb|ADE37054.1| multi-sensor signal transduction histidine kinase [Methanohalophilus
            mahii DSM 5219]
          Length = 1108

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 149/679 (21%), Positives = 261/679 (38%), Gaps = 68/679 (10%)

Query: 129  SFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMS-----EASLDQQP 183
              IL           S  +   +G+   E++ +          +        E     + 
Sbjct: 434  DVILETDVEGRYTYISPSHQRILGR-GKELLGKNCMKDLHPDDIDFVAGIFGEIVETGEQ 492

Query: 184  YHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKN 243
            +H     L    G I        +   + +E   + V  +              R   + 
Sbjct: 493  HHAEYRYLHPEKGYIW----LESVATSYVDENGQKRVLINT-------------RDVTER 535

Query: 244  KENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIA 303
            KE +  L+++    ++ +++   G++  + +     ++ +  E+ G   +          
Sbjct: 536  KETENTLIKSEAKFKSYITQAPAGIFIADENGYYVDVNPAACEMTGYSKDELLGMNLL-E 594

Query: 304  RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGI 363
             L H  ++ + +    V  K    +D         G   W +V A  +        +IG 
Sbjct: 595  LLPHDIHRHVIDQFEDVINKGK--IDIEIPYLTKEGDRKWWRVTAAALPEG----RVIGF 648

Query: 364  AMDLTEKYHLE----KRYAEADQRLSKAIE--CTSEALV-----------LWDKNDRLVM 406
              D+T +   E    +    +  R  +  E   ++ A++           ++D   R++ 
Sbjct: 649  VKDITIQKSTESDLSEALNRSQHREKEITELLNSTRAILEIDDFEVVARHIFDACARVIG 708

Query: 407  CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQ 466
              A Y                          P +             + E+   +     
Sbjct: 709  AKAGYVALLSDTGEENELLFLEDGGMPCSVDPDLPMPVRGLRNEAYETGEVVFENDFMAS 768

Query: 467  INEWCTHDGGTI--------------SVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
                   +G  +              +VG      K     + ++        +     R
Sbjct: 769  EWVKYMPEGHMVLPNVLFSPLNIEGKTVGVLGFAYKDGDFTIHDAWLAKTFGEHAAIALR 828

Query: 513  -----QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
                  +L+     L     K      +AE ANK+KSEFLA MSHELRTPLN+I+GFS++
Sbjct: 829  NSRNFDVLKGTNKRLEDTVLKANELAAQAEYANKSKSEFLANMSHELRTPLNSIIGFSDI 888

Query: 568  IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
            +  E FG+L + K  +Y  +I+ SG+HLL +IN IL++SKIE  K+     +  L  + +
Sbjct: 889  LNGETFGKL-TQKQEKYTANINKSGKHLLYLINEILDLSKIEAGKMEFVCDDFKLNSVFS 947

Query: 628  EGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
            +   +I   AQ K+I +E     ++  NADK  IK+I+F +LSN+IKFT+ NG++ +   
Sbjct: 948  DIESIISLQAQKKSIDLEISKSVDIEINADKSKIKQIIFNLLSNAIKFTDENGRVSMSAR 1007

Query: 688  KIG-QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            K+    V I + DTGIGIP+   E I  PF  +     +  GG GLGLA+       HGG
Sbjct: 1008 KVDRDRVEIAVKDTGIGIPEDKFETIFDPFMQVDASTSRKYGGTGLGLALVKKYVEKHGG 1067

Query: 747  RLKIISQEGKGTIVTICMP 765
             + + S+ GKG+     +P
Sbjct: 1068 EVWVESEIGKGSTFMFTIP 1086



 Score =  128 bits (323), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/285 (16%), Positives = 100/285 (35%), Gaps = 10/285 (3%)

Query: 245 ENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIAR 304
           E +    +    +          +   + + +  ++S S   I+G     K L  +   +
Sbjct: 413 EMEKKRDQYETHLHLMSRNMNDVILETDVEGRYTYISPSHQRILG---RGKELLGKNCMK 469

Query: 305 LIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIA 364
            +H D+            +  +Q    +   H     IW++  A      +G   ++   
Sbjct: 470 DLHPDDIDFVAGIFGEIVETGEQHHAEYRYLHPEKGYIWLESVATSYVDENGQKRVLINT 529

Query: 365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP 424
            D+TE+   E    +++ +    I      + + D+N   V  N    +  G     L+ 
Sbjct: 530 RDVTERKETENTLIKSEAKFKSYITQAPAGIFIADENGYYVDVNPAACEMTGYSKDELLG 589

Query: 425 GNARSIIQDAQTRPIIEYRTSDPERS---QDMSKEIKLADSRWLQINEWCTHDGGTISVG 481
            N   ++     R +I+       +     ++    K  D +W ++      +G  I   
Sbjct: 590 MNLLELLPHDIHRHVIDQFEDVINKGKIDIEIPYLTKEGDRKWWRVTAAALPEGRVIGFV 649

Query: 482 TDITLLKHNQAQLRESKRRLKATINDLST----SRQILERQKTEL 522
            DIT+ K  ++ L E+  R +    +++     +R ILE    E+
Sbjct: 650 KDITIQKSTESDLSEALNRSQHREKEITELLNSTRAILEIDDFEV 694



 Score = 80.8 bits (198), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 45/306 (14%), Positives = 97/306 (31%), Gaps = 39/306 (12%)

Query: 121 AKTRFLSESFILLAQPNEL-----VFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMS 175
            +  F      ++   N+          ++      G K   I+ + +            
Sbjct: 13  EEYTFAYARHKIILDENDKPVNYQFLDVNSAFEDMTGLKKDHILNKTATEVLP------- 65

Query: 176 EASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFS 235
           +   D   +  L  ++      I  +    PL + ++         +     + LF + S
Sbjct: 66  KIVEDDFDWAALFGHVALTGEDISFVQYSEPLGKWYQINAKSSEKGY----FVTLFSVLS 121

Query: 236 YYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENK 295
                    +N+    E        + R     + F       H++++  +++G   E  
Sbjct: 122 ---------QNEAKFYEFAERSSDLIYR-----YEFTPTPGFTHVNKASTKLVGYTPEEH 167

Query: 296 TLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD--QIFHMRHASGADIWIQVRAQMMRT 353
            L  +   ++IH D+K+               +D        H  G  +WI+ R   +  
Sbjct: 168 YLDPQLAVKIIHPDDKQRFLDYIE----GKTPIDKPIQVRWIHKDGQVVWIEQRNTPVYD 223

Query: 354 -ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV-LWDKNDRLVMCNANY 411
             S  + + GI  D+T+  + +KR       L  AI   ++ +V   D    +    +N 
Sbjct: 224 RNSDLIALEGIGRDITDIKNAQKREEHIKNVL-LAIRNINQMIVKEHDPERLIQKACSNL 282

Query: 412 QKAYGL 417
            +  G 
Sbjct: 283 TETLGY 288



 Score = 51.9 bits (123), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/159 (10%), Positives = 43/159 (27%), Gaps = 20/159 (12%)

Query: 103 KFDLASQKKAESMLGQLLAK---TRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEII 159
             D+  +K+ E+ L +  AK       + + I +A  N      +       G    E++
Sbjct: 529 TRDVTERKETENTLIKSEAKFKSYITQAPAGIFIADENGYYVDVNPAACEMTGYSKDELL 588

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
                        +      +                       ++ +   +  +     
Sbjct: 589 GMNLLELLPHDIHRHVIDQFEDVINKG-----------------KIDIEIPYLTKEGDRK 631

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE 258
            +    +AL    +  + +     K  ++ L EA    +
Sbjct: 632 WWRVTAAALPEGRVIGFVKDITIQKSTESDLSEALNRSQ 670



 Score = 44.2 bits (103), Expect = 0.097,   Method: Composition-based stats.
 Identities = 57/446 (12%), Positives = 123/446 (27%), Gaps = 87/446 (19%)

Query: 140 VFASSTKNSHYIGKKIGE--IIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLP--HNS 195
               +  ++  +G    E  + P+L+         Q     ++ +      + +   H  
Sbjct: 149 FTHVNKASTKLVGYTPEEHYLDPQLAVKIIHPDDKQRFLDYIEGKTPIDKPIQVRWIHKD 208

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI 255
           G ++ I                    +   S L+        R     K           
Sbjct: 209 GQVVWIEQ-------------RNTPVYDRNSDLIALEGIG--RDITDIKNAQKREEHIKN 253

Query: 256 CVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTL------------SFRAIA 303
            +    +  +  +   + +        ++ E +G       L            SF   A
Sbjct: 254 VLLAIRNINQMIVKEHDPERLIQKACSNLTETLGYYSAWIALVDDEKNVISTASSFSDFA 313

Query: 304 RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWI------QVRAQMMRTISGG 357
                 ++++ E       + V   D+I  M   +G             RA +   +   
Sbjct: 314 SGFDRLDRQLKEGIFPQCMQQVLAKDEILIMDDPAGNCFECPLSFKYSDRASLCYRLQYN 373

Query: 358 MNIIGIAM--------DLTEKYH-----------------LEKRYAEADQRLSKAIECTS 392
             + GI          D+ E +                  +EK+  + +  L       +
Sbjct: 374 SKVYGILSVAVPRKYADMDEIHDLFREVSDDLGFALYKIEMEKKRDQYETHLHLMSRNMN 433

Query: 393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQD 452
           + ++  D   R    + ++Q+  G     L+  N    +             +       
Sbjct: 434 DVILETDVEGRYTYISPSHQRILGR-GKELLGKNCMKDLHPDDID-----FVAGIFGEIV 487

Query: 453 MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
            + E   A+ R+L        + G I + +  T           S          L  +R
Sbjct: 488 ETGEQHHAEYRYLH------PEKGYIWLESVAT-----------SYVDENGQKRVLINTR 530

Query: 513 QILERQKTE--LSIANAKYQVEKERA 536
            + ER++TE  L  + AK++    +A
Sbjct: 531 DVTERKETENTLIKSEAKFKSYITQA 556



 Score = 37.7 bits (86), Expect = 7.8,   Method: Composition-based stats.
 Identities = 34/284 (11%), Positives = 75/284 (26%), Gaps = 37/284 (13%)

Query: 276 KKFHLSRSMYEIMGIPYENKTL-SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM 334
           +   ++ +  ++ G+  ++    +   +   I  D+     +   V           +  
Sbjct: 36  QFLDVNSAFEDMTGLKKDHILNKTATEVLPKIVEDDFDWAALFGHVALTGEDISFVQY-- 93

Query: 335 RHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA 394
               G    I  ++       G    +   +   E    E     +D             
Sbjct: 94  SEPLGKWYQINAKSS----EKGYFVTLFSVLSQNEAKFYEFAERSSDLIYR--------- 140

Query: 395 LVLWDKNDRLVMCNANYQKAYGLPDHV--LVPGNARSIIQDAQTRPIIEYRTSDPERSQD 452
              +         N    K  G       L P  A  II     +  ++Y        + 
Sbjct: 141 -YEFTPTPGFTHVNKASTKLVGYTPEEHYLDPQLAVKIIHPDDKQRFLDYIEGKTPIDKP 199

Query: 453 MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
           +         RW+        DG  + +    T +    + L   +   +   +  +  +
Sbjct: 200 IQV-------RWIH------KDGQVVWIEQRNTPVYDRNSDLIALEGIGRDITDIKNAQK 246

Query: 513 QILERQKTELSIANAKYQVEKER-----AETANKTKSEFLAKMS 551
           +    +   L+I N    + KE       + A    +E L   S
Sbjct: 247 REEHIKNVLLAIRNINQMIVKEHDPERLIQKACSNLTETLGYYS 290


>gi|149927836|ref|ZP_01916087.1| PAS [Limnobacter sp. MED105]
 gi|149823458|gb|EDM82689.1| PAS [Limnobacter sp. MED105]
          Length = 1085

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 128/699 (18%), Positives = 245/699 (35%), Gaps = 72/699 (10%)

Query: 86  SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASST 145
            L +      +             K  +    +        +   +      +      +
Sbjct: 271 ILAVLMVKASMTYQAQQVLAKEKAKADQQFNDERFQLATESAGIGVWEYNIQDKFIRWDS 330

Query: 146 KNSHYIGK-------KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSI 198
                 G           E +  +           + EAS +Q  +         + G I
Sbjct: 331 AMRKIYGVKDEQELVSYKEWLHYVVPEDVNKLGTVLLEASKNQDTFQFNFNIRRASDGRI 390

Query: 199 LIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE 258
             I +R    R                +  + F +          ++ +  L EA     
Sbjct: 391 RHIQARAKTHR---------------NTKGIPFRMIGVNVDVTVQRQFEDALREAEARFR 435

Query: 259 TALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN-KKICEIA 317
           ++      G+   +F  +   +++++ EI+G   E       +   + H  +  +   + 
Sbjct: 436 SSFEWAAIGMAMLDFKGQFLQVNKALSEILGYSEEELLGF--SFDAITHPQDTMQHTHLV 493

Query: 318 RSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKR 376
           R V               H  G  +W+ +    +R   G  +  I    D++E+   E  
Sbjct: 494 RDVLKGRRHNYQLEKRYIHKDGHVVWVHLSVSAVRNDKGRVIYFISQIQDISERKRNEAT 553

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
             E +  L    EC    +  W  + R    N N++K   +P   +  G     +   + 
Sbjct: 554 LIEREHFLRTLSECLPGLVSYWSTDLRCHFANRNHEKWSNIPADKMR-GQHMRKVLGEEL 612

Query: 437 RPIIEYRTSDPERSQDMSKEIK--LADSRWLQINEWCTHD------GGTISVGTDITLLK 488
                +      + +    E +  L    +  +      D       G  S+ T+IT  K
Sbjct: 613 FIHDHHYVLGVLKGEKQRFERRKPLPSGGYADMLVHLIPDVLYGKVEGFFSISTNITDFK 672

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLA 548
                                        Q+ EL   N       ++AE A+K K  FLA
Sbjct: 673 A----------------------------QQRELERINHVLTDRTQQAEAASKAKGAFLA 704

Query: 549 KMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKI 608
            MSHE+RTP+NAI+G  ++++          +  +Y   I  +   LLN++N+IL++S++
Sbjct: 705 NMSHEIRTPMNAIMGLLQLLEDTDL----QARQRDYLSKIGSAADVLLNVLNDILDISRV 760

Query: 609 ETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFF--NADKRIIKKILF 666
           E  K+ +      L  ++++   L    A+ K I++     +        D+  + +IL 
Sbjct: 761 EANKLELSHSRFLLDQVLSKATDLFAYRAEEKAIQLYCSKDANCPVSLKGDRLRLAQILN 820

Query: 667 PILSNSIKFTNNNGKMMIRTSK--IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYD 724
            +LSN++KFT   G++ ++      G+ +  ++ DTGIG+ +     + QPF  + +   
Sbjct: 821 NLLSNALKFT-EKGRIHLQVQSVADGKQLQFSVKDTGIGMNEEQCAALFQPFSQVDDSSS 879

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           +  GG GLGL+I   L  L GG++ + S  G GT     
Sbjct: 880 RRYGGAGLGLSICKNLVELMGGQIWVESTPGLGTTFHFT 918


>gi|17230584|ref|NP_487132.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17132186|dbj|BAB74791.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 1290

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 114/674 (16%), Positives = 245/674 (36%), Gaps = 53/674 (7%)

Query: 105  DLASQKKAESMLGQLLA-KTRFLSESFILLAQ--PNELVFASSTKNSHYIGKKIGEIIPE 161
            D+  +++  S+L Q             I          +   S +     G + GE    
Sbjct: 511  DVTERQQLMSLLQQKQEWLDLAQKSGKIGSFDWKLTSNINVWSQELEEIYGLQPGEFGGT 570

Query: 162  LS--RSRSRSKTVQMSEASLDQ------QPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
             +          +   E  L +      + +      +  +     + +          +
Sbjct: 571  FADWAKHVHPDDLARVEVELRELLNTGSKEFFSDFRIIRQDGSICWLQSRARVFYDDHGQ 630

Query: 214  EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF 273
             + +                        + K+ +  L ++   ++  L     G+   + 
Sbjct: 631  PLRM----------------VGVNVDVTERKQAEAALQQSEARLKRLLQSSIIGIIEADP 674

Query: 274  DNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFH 333
            + +    + +  +I+G  +E+          +   +  ++ +            +     
Sbjct: 675  E-RINFANDAFLKIVGYTHEDLLTGKLRWQDMTPPEYSELDQAKVEEVINSGFCIPFEKE 733

Query: 334  MRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
                 G+ + I + A   R  S  +  +   +DLTE+   +    +++       +   +
Sbjct: 734  YIRKDGSRVPILLGAA--RLSSSPLTWVCFILDLTERKQAQAALQQSELMFRTLADTMPQ 791

Query: 394  ALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDM 453
               +   N      N  +    G           ++I+     +  IE      +  +D 
Sbjct: 792  MFWITQPNGYHEYFNQRWYDYTGTTLEQTQGAGWQNILHPDDVQRTIEQWQDSLDTGKDY 851

Query: 454  SKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQ 513
              E +L              DG           L+    ++ +         +       
Sbjct: 852  DIEYRL----------RRAADGEYRWHLGRAFPLRDENGRILKWFGSCTDIHDQKLA--- 898

Query: 514  ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
                   E + A  + +  +   E AN+ K +FLA +SHELR+PLN ILG+++++K    
Sbjct: 899  -----IEERAQAWEQERAARIELERANRMKDDFLAIVSHELRSPLNPILGWAKLLKSRKL 953

Query: 574  GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
              L   K  +  + I  + +    +I+++L++S+I   K+S++    DL+  I   +  +
Sbjct: 954  DAL---KTNQALEVIERNAKLQARLIDDLLDVSRILRGKLSLNVCTVDLVTTIEAALETV 1010

Query: 634  GSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
              +A+SK+I I+ ++ S +     D   ++++++ +L+N++KFT   G++ +   ++G  
Sbjct: 1011 RLTAESKSIHIQTELTSHVCRVEGDPNRLQQVVWNLLTNAVKFTPEGGQIEVSLERVGSL 1070

Query: 693  VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
              I + DTG GI    L  + + F        +  GG GLGLAI   L  LHGG +++ S
Sbjct: 1071 AHIQVRDTGKGISLDFLPYVFERFRQADEVTTRKFGGLGLGLAIVRHLVELHGGAVQVTS 1130

Query: 753  Q-EGKGTIVTICMP 765
              EG GT  T+ +P
Sbjct: 1131 PGEGLGTTFTVKLP 1144



 Score =  185 bits (471), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 58/455 (12%), Positives = 143/455 (31%), Gaps = 31/455 (6%)

Query: 92  AIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSE----------SFILLA-QPNELV 140
           A   I     +  D+  +K+ E+ L Q  A  +  +E          + + +A  P    
Sbjct: 355 ATGAIVNAVTVNVDITERKRVEAALRQSEALAKARAEELETIMETVPAAVWIAHDPLCHS 414

Query: 141 FASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILI 200
            + +      +    G ++     S       ++ +   D     +           +  
Sbjct: 415 MSVNRAAYDMMRVPPGSVMTATPASGGYPFPFKIQKNGQDIPLNELAMQQAGLTGQEVEA 474

Query: 201 INSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETA 260
                      R      +        +   I         + ++  ++L +    ++ A
Sbjct: 475 EVEFFFSPEDVRHIYGKAIPLCDPDGNVRGVIGAFL--DVTERQQLMSLLQQKQEWLDLA 532

Query: 261 LSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE-IARS 319
              G+ G +++   +     S+ + EI G+       +F   A+ +H D+    E   R 
Sbjct: 533 QKSGKIGSFDWKLTSNINVWSQELEEIYGLQPGEFGGTFADWAKHVHPDDLARVEVELRE 592

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYA 378
           +     K+    F +    G+  W+Q RA++     G    ++G+ +D+TE+   E    
Sbjct: 593 LLNTGSKEFFSDFRIIRQDGSICWLQSRARVFYDDHGQPLRMVGVNVDVTERKQAEAALQ 652

Query: 379 EADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA-RSIIQDAQTR 437
           +++ RL + ++ +   ++  D   R+   N  + K  G     L+ G      +   +  
Sbjct: 653 QSEARLKRLLQSSIIGIIEADPE-RINFANDAFLKIVGYTHEDLLTGKLRWQDMTPPEYS 711

Query: 438 PIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRES 497
            + + +            E+  +        E+   DG  + +      L  +       
Sbjct: 712 ELDQAKVE----------EVINSGFCIPFEKEYIRKDGSRVPILLGAARLSSSPLTWV-- 759

Query: 498 KRRLKATINDLSTSRQILERQKTELSIANAKYQVE 532
                  + +   ++  L++ +             
Sbjct: 760 --CFILDLTERKQAQAALQQSELMFRTLADTMPQM 792



 Score =  103 bits (258), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 70/579 (12%), Positives = 159/579 (27%), Gaps = 69/579 (11%)

Query: 33  AYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEA 92
             + +      F S +    P +    L  +   +   +T   +      N    ++  A
Sbjct: 36  EISPLFFASVVFSSWYGGLAPGLVATVLAIL-VKNYFFITPFNSIAVSQGNDLLNLIVFA 94

Query: 93  IEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSH 149
              +  ++     L +++ +E+ LG+L    R L E+    I +          S + + 
Sbjct: 95  SVAVLISSLNLQVLTAREVSEAKLGKLKVNYRQLLETAYEGIWIFDSEGKTEYVSPQLAQ 154

Query: 150 YIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYH-------VLSVNLPHNSGSILIIN 202
            +G  +  I      +    +     E  L+QQ  +               +  S+ +I 
Sbjct: 155 ILGYSVERIGEFSIFNFLEPQARLEIEQWLEQQQKYNHQTKQQFDLRLQRRDGASLWVIV 214

Query: 203 SRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALS 262
           S   +L   R                      +      ++K            +   L 
Sbjct: 215 SLSSILDKHRRFSG----------------AVAMLTDITEHKHEQAEPDLERQRLRAILD 258

Query: 263 RGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR------AIARLIHYDNKKICEI 316
               G+   +   +   ++  +  I G        + +                     +
Sbjct: 259 ILPMGVVISDAKGQLLEINPGVKAIWGEDAPLLDNTSQYHQYKGWWPDTGQPLTAAEWTL 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEK 375
           AR++        +    +    G    I   A  +   +G + N + + +D+TE+  +E 
Sbjct: 319 ARTLATGEAIIGE-EIDIATFDGKRKTILNSAVPIYDATGAIVNAVTVNVDITERKRVEA 377

Query: 376 RYAEAD-------QRLSKAIECTSEALVL-WDKNDRLVMCNANYQKAYGLPDHVLVPGNA 427
              +++       + L   +E    A+ +  D     +  N        +P   ++    
Sbjct: 378 ALRQSEALAKARAEELETIMETVPAAVWIAHDPLCHSMSVNRAAYDMMRVPPGSVMTATP 437

Query: 428 RS-------------IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHD 474
            S                      + +   +  E   ++       D R +        D
Sbjct: 438 ASGGYPFPFKIQKNGQDIPLNELAMQQAGLTGQEVEAEVEFFFSPEDVRHIYGKAIPLCD 497

Query: 475 -----GGTISVGTDITLLKHNQ------AQLRESKRRLKATINDLSTSRQILERQKTELS 523
                 G I    D+T  +          +  +  ++     +        +     EL 
Sbjct: 498 PDGNVRGVIGAFLDVTERQQLMSLLQQKQEWLDLAQKSGKIGSFDWKLTSNINVWSQELE 557

Query: 524 IA--NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNA 560
                   +     A+ A     + LA++  ELR  LN 
Sbjct: 558 EIYGLQPGEFGGTFADWAKHVHPDDLARVEVELRELLNT 596



 Score = 95.4 bits (236), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 46/355 (12%), Positives = 113/355 (31%), Gaps = 20/355 (5%)

Query: 220 VFFSIISALLLFILFSYYRQA-KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
           +   I+ A +  ++ S   Q     + ++  L +  +     L     G+W F+ + K  
Sbjct: 87  LLNLIVFASVAVLISSLNLQVLTAREVSEAKLGKLKVNYRQLLETAYEGIWIFDSEGKTE 146

Query: 279 HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGK--HVKQLDQIFHMRH 336
           ++S  + +I+G   E   +   +I   +    +   E       K  H  +      ++ 
Sbjct: 147 YVSPQLAQILGYSVE--RIGEFSIFNFLEPQARLEIEQWLEQQQKYNHQTKQQFDLRLQR 204

Query: 337 ASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
             GA +W+ V    +          + +  D+TE  H +       QRL   ++     +
Sbjct: 205 RDGASLWVIVSLSSILDKHRRFSGAVAMLTDITEHKHEQAEPDLERQRLRAILDILPMGV 264

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           V+ D   +L+  N   +  +G    +L   +           P      +  E +   + 
Sbjct: 265 VISDAKGQLLEINPGVKAIWGEDAPLLDNTSQYHQY--KGWWPDTGQPLTAAEWTLART- 321

Query: 456 EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
            +   ++   +  +  T DG   ++      +      +  +              R+ +
Sbjct: 322 -LATGEAIIGEEIDIATFDGKRKTILNSAVPIYDATGAIVNAVTVNVDITE-----RKRV 375

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE-LRTPLNAILGFSEVIK 569
           E    +          E E               ++H+ L   ++      ++++
Sbjct: 376 EAALRQSEALAKARAEELETIMETVPA----AVWIAHDPLCHSMSVNRAAYDMMR 426



 Score = 51.5 bits (122), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/202 (13%), Positives = 52/202 (25%), Gaps = 13/202 (6%)

Query: 62  FIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLA 121
            I +   I     Y +++       L                 DL  +K+A++ L Q   
Sbjct: 721 VINSGFCIPFEKEYIRKDGSRVPILLGAARLSSSPLTWVCFILDLTERKQAQAALQQSEL 780

Query: 122 KTRFLSES---FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEAS 178
             R L+++      + QPN      + +   Y G  + +      ++      VQ +   
Sbjct: 781 MFRTLADTMPQMFWITQPNGYHEYFNQRWYDYTGTTLEQTQGAGWQNILHPDDVQRTIEQ 840

Query: 179 LDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYR 238
                      +L       +    R      +R  +            +L    F    
Sbjct: 841 WQD--------SLDTGKDYDIEYRLRRAADGEYRWHLGRAFPLRDENGRIL--KWFGSCT 890

Query: 239 QAKKNKENDTILLEANICVETA 260
                K       +A      A
Sbjct: 891 DIHDQKLAIEERAQAWEQERAA 912


>gi|297537877|ref|YP_003673646.1| multi-sensor hybrid histidine kinase [Methylotenera sp. 301]
 gi|297257224|gb|ADI29069.1| multi-sensor hybrid histidine kinase [Methylotenera sp. 301]
          Length = 1239

 Score =  396 bits (1018), Expect = e-108,   Method: Composition-based stats.
 Identities = 123/656 (18%), Positives = 253/656 (38%), Gaps = 52/656 (7%)

Query: 117 GQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSE 176
              L+     +   I+    N  + + +       G +  EI+ +   +    K   +  
Sbjct: 269 QSRLSTILDTAVDGIITIDMNGRILSFNHAAEQLFGWQSAEIVGQ-DTAILMPKAYHVRH 327

Query: 177 ASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLL-FILFS 235
               +         +      +  +              T+ +      + +    ++F 
Sbjct: 328 NHFLKHFGEAGQAKILGVGREVTGVRKNGS---------TVPIRLAIGKAKISGETLIFG 378

Query: 236 YYRQAKKNKENDTILLEANICVETALSRGRCGLWN--FNFDNKKFHLSRSMYEIMGIPYE 293
           +     +       + E +  + + +S      +   +N D +   +S S+ ++ G   E
Sbjct: 379 FITDLTQRNAMKKTMRERDEQLRSLMSNIPGVTFRCQYNQDWRMLVISDSVKDLTGYAAE 438

Query: 294 NKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRT 353
               +  +     H ++             + +     + ++H  G++ W+      +R 
Sbjct: 439 EFLKNGLSCTLFTHTEDAARVIAEIQTALANGEHYAIEYRIKHRDGSEKWVSEMGCAIRD 498

Query: 354 ISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQ 412
            SG + ++ G+ +D+TE      R+AE +       + TS A   +  N  ++  NA + 
Sbjct: 499 KSGAVQMLDGVILDVTESKL---RHAEYESIARAINQSTSVA--EFSMNGTILDANATFL 553

Query: 413 KAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCT 472
              G   + ++               I          S     E            +   
Sbjct: 554 TLLGYEKNEVIGK----------HHSIFCSAQDAASASYRNKWEALNRGEFVQGEFKRLG 603

Query: 473 HDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE 532
            +G  + +    + L +   +  +    +                  TE +      ++ 
Sbjct: 604 KNGSEVWIHASYSPLLNADGKPSKVLMFMI---------------DITERTRMENDLKLA 648

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           K++AE A   K+ FLA MSHE+RTP+NAI+GFSE++           +   Y   I+ S 
Sbjct: 649 KDKAEQAASAKATFLANMSHEIRTPMNAIIGFSEIMMDTEM----QDEQRRYMNTINNSA 704

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
           + LL+++N+IL+ +K+E  K+ ++  +  L  +++  +  +   A+ KN+ ++ ++    
Sbjct: 705 KSLLHLLNDILDSAKLEKGKLELEIVDFSLYELVDSIVSTLWVQAKRKNLDLQLELDPNT 764

Query: 653 --FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-VIITIADTGIGIPKSAL 709
             ++      I++IL  +L NSIKFT  +G + +   ++    +  +I DTGIGIP+  L
Sbjct: 765 ASYYLGAPDRIRQILMNLLGNSIKFT-EHGYVKLVVKQLDNHELSFSIIDTGIGIPQDRL 823

Query: 710 EKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + I +PF    +   +  GG GLG  IS  L  L GGRL   S+ G G+  T+ +P
Sbjct: 824 DVIFEPFTQADSSMSRKFGGTGLGTTISKQLVELMGGRLTAKSEIGSGSCFTMILP 879



 Score = 83.9 bits (206), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/347 (11%), Positives = 109/347 (31%), Gaps = 18/347 (5%)

Query: 166 RSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINS--RVPLLRLWREEVTLEVVFFS 223
            ++ + +              +++   H +G      +    P+        +   +  S
Sbjct: 180 LNQQQRISPIYTLATGGGLMGIAIAAMHYTGMASARITGVIDPMYDAINNHSSSLSLGIS 239

Query: 224 IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRS 283
           +++ L+  +  S      + ++    L      + T L     G+   + + +    + +
Sbjct: 240 LVTVLIGVLAASINALI-RYRQMLRSLQNNQSRLSTILDTAVDGIITIDMNGRILSFNHA 298

Query: 284 MYEIMGIPYENKTLSFRAIA--RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGAD 341
             ++ G           AI   +  H  +    +         +  + +       +G+ 
Sbjct: 299 AEQLFGWQSAEIVGQDTAILMPKAYHVRHNHFLKHFGEAGQAKILGVGREVTGVRKNGST 358

Query: 342 IWIQ-VRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW-- 398
           + I+    +    ISG   I G   DLT++  ++K   E D++L   +            
Sbjct: 359 VPIRLAIGKA--KISGETLIFGFITDLTQRNAMKKTMRERDEQLRSLMSNIPGVTFRCQY 416

Query: 399 DKNDRLVMCNANYQKAYGLPDHV-LVPGNARSIIQDAQTRPIIEYRTSDPERSQDM---S 454
           +++ R+++ + + +   G      L  G + ++    +    +         + +     
Sbjct: 417 NQDWRMLVISDSVKDLTGYAAEEFLKNGLSCTLFTHTEDAARVIAEIQTALANGEHYAIE 476

Query: 455 KEIKLADSRWLQINEW----CTHDGGTISVGTDITLLKHNQAQLRES 497
             IK  D     ++E         G    +   I  +  ++ +  E 
Sbjct: 477 YRIKHRDGSEKWVSEMGCAIRDKSGAVQMLDGVILDVTESKLRHAEY 523



 Score = 51.5 bits (122), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/152 (13%), Positives = 47/152 (30%), Gaps = 7/152 (4%)

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
             + +       RLS  ++   + ++  D N R++  N   ++ +G     +V G   +I
Sbjct: 259 RQMLRSLQNNQSRLSTILDTAVDGIITIDMNGRILSFNHAAEQLFGWQSAEIV-GQDTAI 317

Query: 431 IQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHN 490
           +          +       +        L   R +        +G T+ +   I   K +
Sbjct: 318 LMPKAYHVRHNHFLKHFGEAGQAK---ILGVGREV---TGVRKNGSTVPIRLAIGKAKIS 371

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTEL 522
              L           N +  + +  + Q   L
Sbjct: 372 GETLIFGFITDLTQRNAMKKTMRERDEQLRSL 403


>gi|315126040|ref|YP_004068043.1| sensor protein [Pseudoalteromonas sp. SM9913]
 gi|315014554|gb|ADT67892.1| putative sensor protein [Pseudoalteromonas sp. SM9913]
          Length = 1101

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 119/536 (22%), Positives = 231/536 (43%), Gaps = 48/536 (8%)

Query: 244 KENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYEN---KTLSFR 300
           + +   + ++    E A+     G+W+++    + + S  +  ++G    +         
Sbjct: 287 ESSREAIKQSEARYELAVKGSNDGIWDWDIVTNEVYFSPRISVLLGYDENDKNALPHCAD 346

Query: 301 AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTI-SGGMN 359
           A+ +L+H D+    +   +         +  + ++  SGA  +  V+   +R   +  + 
Sbjct: 347 ALYKLLHPDDITKHKKQIANHLISNIPFNYDYRLKTKSGAYRYFTVKGMALRNEHNKAIR 406

Query: 360 IIGIAMDLTEKYHLEKRYAEADQR---LSKAIECTSEALVLWDKNDR---LVMCNANYQK 413
           + G   D+TE+   +K   +A ++   L++AIE  +  + + D + +   LV  N+ ++K
Sbjct: 407 MAGSVTDITEQKRSQKALKQAKEQNDLLAQAIESCNVGISIADASVQGFPLVFLNSEFEK 466

Query: 414 AYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTH 473
             G     ++ G   S++Q   T        ++  ++    +   L              
Sbjct: 467 ITGYSKEEML-GINCSLLQGPNTDKNAIDIITNAIKTLKTQRIEIL----------NYKK 515

Query: 474 DGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEK 533
           DG        I+ + +                    T+   +++  TE   AN      K
Sbjct: 516 DGTEFWNSLQISPVFNE---------------QQQLTAYVGIQQDITEQKAANQLLIEAK 560

Query: 534 ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQ 593
             AE AN  KSEFLA MSHE+RTP+N +LG   +I         + K +        S  
Sbjct: 561 AAAEQANIAKSEFLAAMSHEIRTPMNGVLGMLNLILDSSL----NEKQHHQVSIALNSAN 616

Query: 594 HLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP--SE 651
            LLN+IN+IL+ SK++  K+ +++   +L  ++++ I  I   A SKNI +   I     
Sbjct: 617 SLLNIINDILDFSKVDAGKLELEELEFNLCNMLDDFIETIAIHAHSKNIPLMLDIEHLEY 676

Query: 652 LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS---KIGQCVII--TIADTGIGIPK 706
            F   D   +K+IL  +++N++KFT+  G++ +           +     + D+GIGI  
Sbjct: 677 AFVIGDAGRLKQILTNLVNNALKFTHK-GEVQVIAKLTPINNNQMRFNCQVIDSGIGISA 735

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           +   K+ + F  + +   +  GG GLGLAI   L +L  G +++ S+E KG+  + 
Sbjct: 736 AQQAKLFKSFSQVDSSTTRKYGGTGLGLAIVKKLCHLMEGDIQVQSKENKGSNFSF 791



 Score = 63.8 bits (154), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 37/298 (12%), Positives = 77/298 (25%), Gaps = 33/298 (11%)

Query: 106 LASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGE-----IIP 160
           L S ++A              S   I            S + S  +G    +        
Sbjct: 286 LESSREAIKQSEARYELAVKGSNDGIWDWDIVTNEVYFSPRISVLLGYDENDKNALPHCA 345

Query: 161 ELSRSRSRSKTVQMSE----ASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
           +          +   +      L           L   SG+      +       R E  
Sbjct: 346 DALYKLLHPDDITKHKKQIANHLISNIPFNYDYRLKTKSGAYRYFTVKG---MALRNEHN 402

Query: 217 LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC---VETALSRGRCGLWNFNF 273
             +     ++               + K +   L +A      +  A+     G+   + 
Sbjct: 403 KAIRMAGSVT------------DITEQKRSQKALKQAKEQNDLLAQAIESCNVGISIADA 450

Query: 274 DNK---KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ 330
             +      L+    +I G   E       ++ +  +  +K   +I  +   K +K    
Sbjct: 451 SVQGFPLVFLNSEFEKITGYSKEEMLGINCSLLQGPNT-DKNAIDI-ITNAIKTLKTQRI 508

Query: 331 IFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
                   G + W  ++   +          +GI  D+TE+    +   EA     +A
Sbjct: 509 EILNYKKDGTEFWNSLQISPVFNEQQQLTAYVGIQQDITEQKAANQLLIEAKAAAEQA 566



 Score = 41.9 bits (97), Expect = 0.39,   Method: Composition-based stats.
 Identities = 18/179 (10%), Positives = 50/179 (27%), Gaps = 30/179 (16%)

Query: 96  IFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF------ILLAQPNEL---VFASSTK 146
             +      D+  QK+++  L Q   +   L+++       I +A  +     +   +++
Sbjct: 404 AIRMAGSVTDITEQKRSQKALKQAKEQNDLLAQAIESCNVGISIADASVQGFPLVFLNSE 463

Query: 147 NSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLP-----HNSGSILII 201
                G    E++           T + +   +      + +  +       +       
Sbjct: 464 FEKITGYSKEEMLGINCSLLQGPNTDKNAIDIITNAIKTLKTQRIEILNYKKDGTEFWNS 523

Query: 202 NSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETA 260
               P+    ++                        +   + K  + +L+EA    E A
Sbjct: 524 LQISPVFNEQQQLTAY----------------VGIQQDITEQKAANQLLIEAKAAAEQA 566


>gi|329850157|ref|ZP_08265003.1| mmoS [Asticcacaulis biprosthecum C19]
 gi|328842068|gb|EGF91638.1| mmoS [Asticcacaulis biprosthecum C19]
          Length = 757

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 125/646 (19%), Positives = 236/646 (36%), Gaps = 53/646 (8%)

Query: 126 LSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPE---LSRSRSRSKTVQMSEASLDQQ 182
           L+   +++   +  + A++       G   G           S+       + E +L  +
Sbjct: 8   LAPCGLVVCDNDGTIVAANRYFRAMSGYDGGPKTFGRCLTRPSQFILSAKLLPELNLTGE 67

Query: 183 PYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKK 242
              +       +  S+ I+ +       +                  +F          +
Sbjct: 68  ASEIALSLTGPDGDSVPILLNARRDGDHFH---------------YAVFPAKERREYETE 112

Query: 243 NKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAI 302
                  L + +  +  A      G W+ N   K+ + S   Y I G   E  T  F   
Sbjct: 113 YLNAKKKLTQYSDYLRMAERLAHLGHWHGNMVTKETYWSPETYAIFGCDPETFTPRFGET 172

Query: 303 ARLIHYDNKKICEIARSVTGKHVKQLDQIFH-MRHASGADIWIQVRAQMMRTISG-GMNI 360
             L H D+++              +       +RH SG    I+      R  SG  + +
Sbjct: 173 MALYHPDDREEIRAIVEAAIAGNGEFSFRARCIRHDSGEIRHIETNGVCERDESGKAIGL 232

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
            G+  DL++    ++    ++ R     + +++ + ++  +  +   +   +K  G    
Sbjct: 233 FGVVHDLSDILSAQEATEASEARYRLLADSSNDIISVFGLDGAIEYLSPAVEKLLGFTPA 292

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV 480
            L   N R I+                              +R    +     D   +  
Sbjct: 293 ELTGRNVRDIVLPED-----------------------YPVTRAAFASYVRGGDWSAVPR 329

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
                  K       E+  R     +      Q + R  TE     A  +     A  A 
Sbjct: 330 VQYRARHKQGHIVWLEASPRAMLGPDGKIAKLQDVVRDITERKAVEAALEDAMVDANAAA 389

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
           + KS+FLA MSHELRTPL +I+GFS ++++     + S +   Y+Q I  + Q LL +IN
Sbjct: 390 EAKSQFLATMSHELRTPLTSIIGFSALLRE----VVESEEPRRYSQRIWTASQGLLALIN 445

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN-ADKR 659
           +IL+ SK+E  ++ +D        ++ E   L+   A +K + +      ++     D+ 
Sbjct: 446 DILDHSKLEAGQLELDLAPCSANELMQEVADLLEVQAHAKGLFLTVDTDDDMPLMLLDEV 505

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
            +++IL  +  N++KFT + G + I     G  + +T+ DTG GI     +++ + F  +
Sbjct: 506 RMRQILINLAGNAVKFTGDGG-VTIALHWRGDRLQVTVTDTGPGISPEGHKRLFKRFSQV 564

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            +  +    G GLGL I   L  L GGR+ + S  G G++    +P
Sbjct: 565 DHTTN----GTGLGLMICKQLVELMGGRIGVESSPGNGSMFWFDIP 606



 Score = 46.5 bits (109), Expect = 0.018,   Method: Composition-based stats.
 Identities = 30/243 (12%), Positives = 60/243 (24%), Gaps = 19/243 (7%)

Query: 258 ETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIA 317
           E A     CGL   + D      +R    + G        +F             +    
Sbjct: 3   EAAFELAPCGLVVCDNDGTIVAANRYFRAMSGYDGG--PKTFGRCLTR--PSQFILSAKL 58

Query: 318 RSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDL----TEKYHL 373
                   +  +    +    G  + I + A+  R        +  A +     TE  + 
Sbjct: 59  LPELNLTGEASEIALSLTGPDGDSVPILLNAR--RDGDHFHYAVFPAKERREYETEYLNA 116

Query: 374 EKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP--GNARSII 431
           +K+  +    L  A           +   +    +      +G       P  G   ++ 
Sbjct: 117 KKKLTQYSDYLRMAERLAHLGHWHGNMVTKETYWSPETYAIFGCDPETFTPRFGETMALY 176

Query: 432 QDAQT---RPIIEYRTSDPERSQDMSKEIKLADSRWLQINEW----CTHDGGTISVGTDI 484
                   R I+E   +        ++ I+        I           G  I +   +
Sbjct: 177 HPDDREEIRAIVEAAIAGNGEFSFRARCIRHDSGEIRHIETNGVCERDESGKAIGLFGVV 236

Query: 485 TLL 487
             L
Sbjct: 237 HDL 239


>gi|108804107|ref|YP_644044.1| multi-sensor hybrid histidine kinase [Rubrobacter xylanophilus DSM
           9941]
 gi|108765350|gb|ABG04232.1| multi-sensor hybrid histidine kinase [Rubrobacter xylanophilus DSM
           9941]
          Length = 1069

 Score =  396 bits (1017), Expect = e-107,   Method: Composition-based stats.
 Identities = 109/560 (19%), Positives = 219/560 (39%), Gaps = 41/560 (7%)

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
               + +A ++ +        +     +     A     +       G++    + +   
Sbjct: 25  GVLIMTAANVIVVSAIMLWGVRALGRLERGRAAAEEGYRSVFENASEGIFRSTPEGRLLA 84

Query: 280 LSRSMYEIMGI-PYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS 338
            + +M  + G    E        + R +    ++  E       +          MR   
Sbjct: 85  ANPAMARMFGYRSPEELVSEVSDLGRQLWESPQER-ERFVRRVLEEGSVSGFEARMRRRD 143

Query: 339 GADIWIQVRAQMMRTISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL 397
           G+ +W  +    +    G +  + G  +D+T +   ++   E+ ++     E + +AL++
Sbjct: 144 GSLLWASLNGHRVTGRDGRLVCLEGTILDITWRRRQQEALEESQRQFRDLFERSVDALLV 203

Query: 398 WDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEI 457
            D    +V CNA   ++ G     L+  N R    +   R                 +  
Sbjct: 204 HDGEGNIVDCNAEACRSLGYTRQELLRMNVRDFATNLLRREDRTPGEPTLWERALSGEPG 263

Query: 458 KLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILER 517
            +A    + + E    DG T  V   +  + +   ++                      R
Sbjct: 264 VVAG---VHLGEHRRRDGTTFPVEVRVGPVVYGGRRMI-----------------LAAAR 303

Query: 518 QKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELG 577
             TE      + +  KE+AE A++ KSEF+A MSHE+RTP+N ++G +E++         
Sbjct: 304 DITERKRIEEELREAKEQAEAASRAKSEFVANMSHEIRTPMNGVIGMAELLLDTPLTP-- 361

Query: 578 SVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSA 637
             +  EYA+ I  SG+ LL ++N+IL+ SKIE  ++S+++   ++   + E + L+   A
Sbjct: 362 --EQREYARTIRSSGEALLAILNDILDFSKIEAGRLSLERIPFEIHKEVEEVVSLLAPRA 419

Query: 638 QSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKM-MIRTSKIGQ--- 691
            +K +++   I   +      D   ++++L  ++ N+IKFT     +  +  SK  +   
Sbjct: 420 HAKGLELICFIEPGVPPLIKGDPFRLRQVLTNLIGNAIKFTEEGEVVVSVSLSKEEKSAP 479

Query: 692 --------CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNL 743
                    +   + D+GIGI +   + + + F        +  GG GLGLAIS  L  +
Sbjct: 480 AGERGGEIELRFEVKDSGIGIQEEQQKHLFEAFSQADASTTRRYGGTGLGLAISRQLVEM 539

Query: 744 HGGRLKIISQEGKGTIVTIC 763
            GG + + S   +G+     
Sbjct: 540 MGGEIGLKSSPKEGSTFHFS 559



 Score = 98.9 bits (245), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 48/351 (13%), Positives = 98/351 (27%), Gaps = 21/351 (5%)

Query: 63  IATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAK 122
            A+  I  +     +       T +++  A  +I  +  + + + +  + E         
Sbjct: 2   AASVLIGWLRLEGERAGLYDTATGVLIMTAANVIVVSAIMLWGVRALGRLERGRAAAEEG 61

Query: 123 TR---FLSESFILLAQPNELVFASSTKNSHYIGK-KIGEIIPELSRSRSRSKTVQMSEAS 178
            R     +   I  + P   + A++   +   G     E++ E+S    +          
Sbjct: 62  YRSVFENASEGIFRSTPEGRLLAANPAMARMFGYRSPEELVSEVSDLGRQLWESPQERE- 120

Query: 179 LDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYR 238
                  V  V    +         R     LW       V          L  L     
Sbjct: 121 -----RFVRRVLEEGSVSGFEARMRRRDGSLLWASLNGHRVTGRDGR----LVCLEGTIL 171

Query: 239 QAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT-L 297
                +     L E+         R    L   + +      +      +G   +    +
Sbjct: 172 DITWRRRQQEALEESQRQFRDLFERSVDALLVHDGEGNIVDCNAEACRSLGYTRQELLRM 231

Query: 298 SFRAIA-RLIHYDNK-KICEIARSVTGKHVKQLDQIFHM---RHASGADIWIQVRAQMMR 352
           + R  A  L+  +++                 +    H+   R   G    ++VR   + 
Sbjct: 232 NVRDFATNLLRREDRTPGEPTLWERALSGEPGVVAGVHLGEHRRRDGTTFPVEVRVGPV- 290

Query: 353 TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDR 403
              G   I+  A D+TE+  +E+   EA ++   A    SE +       R
Sbjct: 291 VYGGRRMILAAARDITERKRIEEELREAKEQAEAASRAKSEFVANMSHEIR 341


>gi|254412809|ref|ZP_05026582.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
 gi|196180544|gb|EDX75535.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
          Length = 622

 Score =  395 bits (1016), Expect = e-107,   Method: Composition-based stats.
 Identities = 107/573 (18%), Positives = 217/573 (37%), Gaps = 38/573 (6%)

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI 255
           G I  I + + +         L           +  I      Q  + K+ +T L E   
Sbjct: 83  GFIKAITAIISIYTALVIIPMLPQALSLPSPTKMNQINDDLAAQIVQRKDIETSLRETQE 142

Query: 256 CVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE 315
               A+     GLW++N    + + S    +I+G   +     +      +H +++    
Sbjct: 143 RFILAVRGSGDGLWDWNISTGEVYFSPRFKQILGYEEQEGENHYNFWESKVHPEDRDRVM 202

Query: 316 IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLE 374
            A     ++       + +    G   WI  RAQ +   +G    + G   D+T++   E
Sbjct: 203 AAMQNHLENHVPYAIEYRLCQKYGDYCWIYARAQAIWDETGKPTRMAGSISDITDRKRAE 262

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLP-DHVLVPGNARSIIQD 433
           +   +++ +    I+ T    V+ D+   ++  N  Y +  G      ++       I  
Sbjct: 263 EALQQSEAKYRALIDTTQTGYVVLDRQGIVLDANQEYVRVTGQSNVSDILGKPVLDWIAP 322

Query: 434 AQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
                 +             + E            ++C  +G  I +  +  ++  ++  
Sbjct: 323 YDLERNVAEIQKALVERSVQNLE-----------TDYCHANGTIIPIEINARVIDTDEGC 371

Query: 494 LRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
                                L R  TE   A  + +        +N+   +F    SH+
Sbjct: 372 RI-----------------LALCRDITERKQARQELKAAIADLARSNQDLEQFAYVASHD 414

Query: 554 LRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKI 613
           LR PL  I  +S+++ K   G+L   +  +Y   I  + Q + ++I+++L  S++   K 
Sbjct: 415 LREPLRKIRSYSDLLVKRYRGKLD-ERADKYIAYITDATQRMQSLISDLLTYSRV--SKP 471

Query: 614 SIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSI 673
            +  +  DL  I+ + +  +    +     I      +   NA+   + ++L  +++N I
Sbjct: 472 ELIPEPTDLGHILKKTLADLSPLIKENKAIITTDSLPQ--VNANPTQMAQLLQNLITNGI 529

Query: 674 KF-TNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGL 732
           KF T    ++ I  ++ GQ   I + D GIG+     ++I   F+ LH  Y +   G G+
Sbjct: 530 KFRTQQPPRIHITATREGQFWQIAVQDNGIGMDTQYCDRIFVIFQRLH--YREEYPGTGI 587

Query: 733 GLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GLA+S  +   HGG++ + S+ G+GT     +P
Sbjct: 588 GLAVSKKIVERHGGQIWVESELGQGTTFYFTLP 620



 Score =  101 bits (251), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/308 (11%), Positives = 89/308 (28%), Gaps = 14/308 (4%)

Query: 99  NNNIKFDLASQKKAESMLGQLLAKTRFL---SESFILLAQPNELVFASSTKNSHYIGKKI 155
           N+++   +  +K  E+ L +   +       S   +     +      S +    +G + 
Sbjct: 120 NDDLAAQIVQRKDIETSLRETQERFILAVRGSGDGLWDWNISTGEVYFSPRFKQILGYEE 179

Query: 156 GEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEV 215
            E   E   +   SK        +     + L  ++P       I          +    
Sbjct: 180 QE--GENHYNFWESKVHPEDRDRVMAAMQNHLENHVP-----YAIEYRLCQKYGDYCWIY 232

Query: 216 TLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDN 275
                 +          +          K  +  L ++       +   + G    +   
Sbjct: 233 ARAQAIWDETGKPT--RMAGSISDITDRKRAEEALQQSEAKYRALIDTTQTGYVVLDRQG 290

Query: 276 KKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMR 335
                ++    + G    +  L  + +   I   + +                +      
Sbjct: 291 IVLDANQEYVRVTGQSNVSDILG-KPVLDWIAPYDLERNVAEIQKALVERSVQNLETDYC 349

Query: 336 HASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
           HA+G  I I++ A+++ T  G   I+ +  D+TE+    +    A   L+++ +   +  
Sbjct: 350 HANGTIIPIEINARVIDTDEG-CRILALCRDITERKQARQELKAAIADLARSNQDLEQFA 408

Query: 396 VLWDKNDR 403
            +   + R
Sbjct: 409 YVASHDLR 416


>gi|298675480|ref|YP_003727230.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanohalobium evestigatum Z-7303]
 gi|298288468|gb|ADI74434.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanohalobium evestigatum Z-7303]
          Length = 754

 Score =  395 bits (1016), Expect = e-107,   Method: Composition-based stats.
 Identities = 124/689 (17%), Positives = 267/689 (38%), Gaps = 59/689 (8%)

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
           +   IE I +    K     + +AE+ L  +   +  ++  F+  A+ +  V   S    
Sbjct: 111 MACIIEDITEQKLSKKTQRDEWEAENKLESIYKSSPVIA--FLWRAEKDWPVEFVSDNII 168

Query: 149 HYIGKKIGEIIPE-------LSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILII 201
              G    +           +     +     +S+  +    Y      +   SG    +
Sbjct: 169 Q-FGYTSEDFTSGRLIFGDIVHPDDLQKVRDAVSQVEIGGYTYFTKEYRILTKSGEARWV 227

Query: 202 NSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETAL 261
             R  L R +                              + K+ +  L ++        
Sbjct: 228 TERSMLGRKYNGVPAYYQGII---------------IDVTERKKAEEALRKSERKYRLIF 272

Query: 262 SRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVT 321
                G+++F+ +      + +M +I+ +  +   + F     L   +++ + +    V 
Sbjct: 273 ENSPLGIFDFDENGVVTSGNENMLKILDLTRDE-LIGFDMPKSL---EDEDMKKALYQVF 328

Query: 322 GKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI-IGIAMDLTEKYHLEKRYAEA 380
            K     +  +    ++   + ++V    + +  G +   +GI  D+TE+   E+   E+
Sbjct: 329 QKKTGHYEGYYRSPTSN-KTVPLKVDFSPIISEEGTIQGGVGIVEDITERKQAEEALKES 387

Query: 381 DQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII 440
           +++     E  ++A+ + D    ++  N    +  G     L    +  +I        +
Sbjct: 388 EKKFRSLFENANDAIFIHDLKGNILEVNQLASQRLGYSKDELTNIKSMDLISPFYAD-NM 446

Query: 441 EYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRR 500
           + R +  ++      E               T +G +I V     ++++       +   
Sbjct: 447 KNRLNTIQKKGHGIFE-----------TVQITKNGSSIPVELSSRIIEYEGKTAILA--- 492

Query: 501 LKATINDLSTSRQILERQKTE--LSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
                     +R I ER++ E  L+    +     E  ++ +K K EFL+ +SHEL+TPL
Sbjct: 493 ---------LARDITERKRAERKLNEYANELAKANEELKSLDKMKDEFLSNVSHELKTPL 543

Query: 559 NAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQ 618
            +I G+S +I +E  G+L      +    I  + + L  ++++++ MS  +  KI    +
Sbjct: 544 TSIKGYSNIIYEETLGKLNDE-QKKTMNTIVRNSERLRRLVDSLIYMSMSQAGKIEYSFE 602

Query: 619 NADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTN 677
              +  +I++ I         K + + K +   +   N DK  +  +L  +L N+ KFT+
Sbjct: 603 PVQISKVIDDAIEDTNFEINKKGLILNKNVSENIPQINGDKAKLTDMLTNLLDNATKFTS 662

Query: 678 NNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAIS 737
           + G++ +   +  + + I + DTG+GIP+  +  + Q F  + +   +  GG GLGL I 
Sbjct: 663 SGGEITVEAFEEDEHIHIKVTDTGVGIPEDLIPYLFQRFYQIDSSIRRKYGGTGLGLYIC 722

Query: 738 DALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             + + H G + I S EGKGT V + +P+
Sbjct: 723 KLIVDAHYGNIWIDSIEGKGTTVHVKLPE 751



 Score =  144 bits (364), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 60/465 (12%), Positives = 143/465 (30%), Gaps = 29/465 (6%)

Query: 116 LGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMS 175
           + +   +        I +    +     S   +   G    ++I +   S    +T+   
Sbjct: 1   MNEFYEQILENISQGIWVVDKFDKFIYFSQNMADITGISKEDVIGKYLMSYMPERTIGN- 59

Query: 176 EASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFS 235
               D     +                           +    V      S         
Sbjct: 60  ----DVHFRELFLRVKNTLQPEHFKSIPLRNKKGNITYQSGRLVPISDTDSNYNGMACI- 114

Query: 236 YYRQAKKNKENDTILL---EANICVETALSRGRCGLWNFNFDNKK--FHLSRSMYEIMGI 290
                 + K +        EA   +E+         + +  +       +S ++ +  G 
Sbjct: 115 -IEDITEQKLSKKTQRDEWEAENKLESIYKSSPVIAFLWRAEKDWPVEFVSDNIIQ-FGY 172

Query: 291 PYENKTLSFRAIARLIHYDNKKICEIAR-SVTGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
             E+ T        ++H D+ +    A   V         + + +   SG   W+  R+ 
Sbjct: 173 TSEDFTSGRLIFGDIVHPDDLQKVRDAVSQVEIGGYTYFTKEYRILTKSGEARWVTERSM 232

Query: 350 MMRTISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCN 408
           + R  +G      GI +D+TE+   E+   +++++     E +   +  +D+N  +   N
Sbjct: 233 LGRKYNGVPAYYQGIIIDVTERKKAEEALRKSERKYRLIFENSPLGIFDFDENGVVTSGN 292

Query: 409 ANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRW---L 465
            N  K   L    L+  +    ++D   +  +           +       ++      +
Sbjct: 293 ENMLKILDLTRDELIGFDMPKSLEDEDMKKALYQVFQKKTGHYEGYYRSPTSNKTVPLKV 352

Query: 466 QINEWCTHDG---GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS--RQILERQKT 520
             +   + +G   G + +  DIT  K  +  L+ES+++ ++   + + +     L+    
Sbjct: 353 DFSPIISEEGTIQGGVGIVEDITERKQAEEALKESEKKFRSLFENANDAIFIHDLKGNIL 412

Query: 521 ELSIAN-AKYQVEKERAE--TANKTKSEFLAKMSHELRTPLNAIL 562
           E++     +    K+      +    S F A     ++  LN I 
Sbjct: 413 EVNQLASQRLGYSKDELTNIKSMDLISPFYAD---NMKNRLNTIQ 454


>gi|75910023|ref|YP_324319.1| PAS/PAC sensor hybrid histidine kinase [Anabaena variabilis ATCC
            29413]
 gi|75703748|gb|ABA23424.1| PAS/PAC sensor hybrid histidine kinase [Anabaena variabilis ATCC
            29413]
          Length = 1297

 Score =  395 bits (1015), Expect = e-107,   Method: Composition-based stats.
 Identities = 115/674 (17%), Positives = 241/674 (35%), Gaps = 53/674 (7%)

Query: 105  DLASQKKAESMLGQLLA-KTRFLSESFILLAQ--PNELVFASSTKNSHYIGKKIGEIIPE 161
            D+  +++  S+L Q             I          +   S +     G + GE    
Sbjct: 510  DVTERQQLMSLLQQKQEWLDLAQKSGKIGSFDWKLASNINIWSQELEEIYGLQPGEFGGT 569

Query: 162  LS--RSRSRSKTVQMSEASLDQ------QPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
                  R     +   +  L +      + +      +  +     + +          +
Sbjct: 570  FEDWAKRVHPDDLARVKVELQELLNTGSKEFFSDFRIIRQDGSLCWLQSRARVFYDDHGQ 629

Query: 214  EVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF 273
             + +                        + K+ +  L ++   ++  L     G+   + 
Sbjct: 630  PLRM----------------VGVNIDVTERKQAEAALQQSEARLKQLLQSSIIGIIEAD- 672

Query: 274  DNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFH 333
              +    + +  +I+G   E+          +   +  ++ +            +     
Sbjct: 673  SERINFANDAFLKIVGYTQEDLLTGKLRWQDMTPLEYSELDQAKVQEVINAGFCIPFEKE 732

Query: 334  MRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
                 G+ + I + A   R  S  +  +   +DLT +   E    +++       +   +
Sbjct: 733  YIRKDGSRVPILLGAA--RLSSSPLTWVCFILDLTARKQAEAALQQSELMFRTLADTMPQ 790

Query: 394  ALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDM 453
               +   N      N  +    G           + I+     +  IE      +  +D 
Sbjct: 791  MFWITQPNGYHEYFNQRWYDYTGTTLEQTQGEGWQKILHPDDVQRTIEQWQDSLDTGKDY 850

Query: 454  SKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQ 513
              E +L              DG           L+    Q+ +         +       
Sbjct: 851  DIEYRL----------RRAADGEYRWHLGRAFPLRDENGQMVKWFGSCTDIHDQKLA--- 897

Query: 514  ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
                   E + A  + +  +   E AN+ K +FLA +SHELR+PLN ILG+++++K    
Sbjct: 898  -----IEERAQAWEQERAARIELERANRMKDDFLAIVSHELRSPLNPILGWAKLLKSRKL 952

Query: 574  GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
              L   K  +  + I  + +    +I+++L++S+I   K+S++    DL+  I   +  +
Sbjct: 953  DAL---KTNQALEVIERNAKLQAGLIDDLLDVSRILRGKLSLNVCTVDLVTTIEAALETV 1009

Query: 634  GSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
              +A+SK+I I+  + + +     D   ++++++ +LSN++KFT   G++ ++  ++G  
Sbjct: 1010 RLTAESKSIHIQTDLTASVCRVEGDPNRLQQVVWNLLSNAVKFTPEGGEIEVKLERVGSL 1069

Query: 693  VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
              I + DTG GI    L  + + F        +  GG GLGLAI   L  LHGG +++ S
Sbjct: 1070 AHIQVRDTGKGISLDFLPYVFERFRQADEVTTRKFGGLGLGLAIVRHLVELHGGSVQVTS 1129

Query: 753  Q-EGKGTIVTICMP 765
              EG GT  T+ +P
Sbjct: 1130 PGEGLGTTFTVKLP 1143



 Score =  185 bits (471), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/393 (14%), Positives = 130/393 (33%), Gaps = 25/393 (6%)

Query: 101 NIKFDLASQKKAESMLGQLLAKTRFLSE----------SFILLA-QPNELVFASSTKNSH 149
            +  D+  +K+ E+ L Q  A  +  +E          + + +A  P+    + +     
Sbjct: 363 TVNVDITERKRVEAALRQSEALAKARAEELETIMETVPAAVWIAHDPHCHSMSVNRAAYE 422

Query: 150 YIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLR 209
            +    G ++     S       ++ +   D     +           +      V    
Sbjct: 423 MMRVPAGSVMTATPASGGYPFPFKIQKNGQDVPLNELAMQQAGLTGQEVEAEVEFVFSSE 482

Query: 210 LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLW 269
             R               +   I         + ++  ++L +    ++ A   G+ G +
Sbjct: 483 DVRHIYGKATPLCDPDGNVRGVIGAFL--DVTERQQLMSLLQQKQEWLDLAQKSGKIGSF 540

Query: 270 NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHV-KQL 328
           ++   +     S+ + EI G+       +F   A+ +H D+    ++          K+ 
Sbjct: 541 DWKLASNINIWSQELEEIYGLQPGEFGGTFEDWAKRVHPDDLARVKVELQELLNTGSKEF 600

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
              F +    G+  W+Q RA++     G    ++G+ +D+TE+   E    +++ RL + 
Sbjct: 601 FSDFRIIRQDGSLCWLQSRARVFYDDHGQPLRMVGVNIDVTERKQAEAALQQSEARLKQL 660

Query: 388 IECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDP 447
           ++ +   ++  D   R+   N  + K  G     L+ G           R          
Sbjct: 661 LQSSIIGIIEADSE-RINFANDAFLKIVGYTQEDLLTGK---------LRWQDMTPLEYS 710

Query: 448 ERSQDMSKEIKLADSRWLQINEWCTHDGGTISV 480
           E  Q   +E+  A        E+   DG  + +
Sbjct: 711 ELDQAKVQEVINAGFCIPFEKEYIRKDGSRVPI 743



 Score =  130 bits (326), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/300 (13%), Positives = 94/300 (31%), Gaps = 33/300 (11%)

Query: 102 IKFDLASQKKAESMLGQLLAKTR-FLSESFILLAQPN-ELVFASSTKNSHYIGKKIGEII 159
           +  D+  +K+AE+ L Q  A+ +  L  S I + + + E +  ++      +G    +++
Sbjct: 636 VNIDVTERKQAEAALQQSEARLKQLLQSSIIGIIEADSERINFANDAFLKIVGYTQEDLL 695

Query: 160 PE-------LSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
                         S     ++ E              +  +   +              
Sbjct: 696 TGKLRWQDMTPLEYSELDQAKVQEVINAGFCIPFEKEYIRKDGSRV-------------- 741

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
                 ++  +   +        +       K+ +  L ++ +   T         W   
Sbjct: 742 -----PILLGAARLSSSPLTWVCFILDLTARKQAEAALQQSELMFRTLADTMPQMFWITQ 796

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
            +    + ++  Y+  G   E          +++H D+ +        +    K  D  +
Sbjct: 797 PNGYHEYFNQRWYDYTGTTLEQTQG--EGWQKILHPDDVQRTIEQWQDSLDTGKDYDIEY 854

Query: 333 HMRH-ASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHL-EKRYAEADQRLSKAIE 389
            +R  A G   W   RA  +R  +G M    G   D+ ++    E+R    +Q  +  IE
Sbjct: 855 RLRRAADGEYRWHLGRAFPLRDENGQMVKWFGSCTDIHDQKLAIEERAQAWEQERAARIE 914



 Score =  108 bits (270), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 59/515 (11%), Positives = 148/515 (28%), Gaps = 69/515 (13%)

Query: 33  AYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEA 92
             + +      F S +   +P +    L  +  +      T +           L L   
Sbjct: 35  EISPLFFASVVFSSWYGGLVPGLVATVLALLVKNHFFN--TPFNSIAVSQGNDLLNLIVF 92

Query: 93  IEIIFQNNNIKFDL-ASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNS 148
             +    +++   +  +++ +E  L +L    R L E+    I +          + + +
Sbjct: 93  ASVAVLISSLNLQVRTAREASEVQLAKLKVNYRHLLETANEGIWIFDSEGKTEYVNHQLA 152

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLS-------VNLPHNSGSILII 201
             +G  + +I      +    +     E  L+QQ  +              H+  S+ +I
Sbjct: 153 QMLGYSVEQISKCSIFNFLEPQARVEIEQWLEQQHKYHQQTKQQFDLRLQRHDGASLWVI 212

Query: 202 NSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETAL 261
            S   +L    +  +                  +      ++K+           +   L
Sbjct: 213 VSLSSILDKHGQFSS----------------AIAMLTDITEHKQEPAKPDLERQRLRAIL 256

Query: 262 SRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR------AIARLIHYDNKKICE 315
                G+   +   +   ++     I G        + +                 +   
Sbjct: 257 DILPMGVVISDAKGQLLEINPGAKAIWGEDAPLLDNTSQYHQYKGWWPDTGQPLTAEEWT 316

Query: 316 IARSVTGKH---VKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKY 371
           +AR++        +++D        +G    I   A  +   +G + N I + +D+TE+ 
Sbjct: 317 LARTLATGEAIIGEEIDIE----TFNGERKTILNSAVPICDATGTIVNAITVNVDITERK 372

Query: 372 HLEKRYAEAD-------QRLSKAIECTSEALVL-WDKNDRLVMCNANYQKAYGLPDHVLV 423
            +E    +++       + L   +E    A+ +  D +   +  N    +   +P   ++
Sbjct: 373 RVEAALRQSEALAKARAEELETIMETVPAAVWIAHDPHCHSMSVNRAAYEMMRVPAGSVM 432

Query: 424 PGNARS-------------IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEW 470
                S                      + +   +  E   ++       D R +     
Sbjct: 433 TATPASGGYPFPFKIQKNGQDVPLNELAMQQAGLTGQEVEAEVEFVFSSEDVRHIYGKAT 492

Query: 471 CTHD-----GGTISVGTDITLLKHNQAQLRESKRR 500
              D      G I    D+T  +   + L++ +  
Sbjct: 493 PLCDPDGNVRGVIGAFLDVTERQQLMSLLQQKQEW 527



 Score = 96.6 bits (239), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 57/340 (16%), Positives = 119/340 (35%), Gaps = 23/340 (6%)

Query: 220 VFFSIISALLLFILFSYYRQAKKNKEN-DTILLEANICVETALSRGRCGLWNFNFDNKKF 278
           +   I+ A +  ++ S   Q +  +E  +  L +  +     L     G+W F+ + K  
Sbjct: 86  LLNLIVFASVAVLISSLNLQVRTAREASEVQLAKLKVNYRHLLETANEGIWIFDSEGKTE 145

Query: 279 HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF--HMRH 336
           +++  + +++G   E   +S  +I   +    +   E       K+ +Q  Q F   ++ 
Sbjct: 146 YVNHQLAQMLGYSVEQ--ISKCSIFNFLEPQARVEIEQWLEQQHKYHQQTKQQFDLRLQR 203

Query: 337 ASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
             GA +W+ V    +    G   + I +  D+TE      +     QRL   ++     +
Sbjct: 204 HDGASLWVIVSLSSILDKHGQFSSAIAMLTDITEHKQEPAKPDLERQRLRAILDILPMGV 263

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           V+ D   +L+  N   +  +G    +L   +                 T  P  +++ + 
Sbjct: 264 VISDAKGQLLEINPGAKAIWGEDAPLLDNTSQY------HQYKGWWPDTGQPLTAEEWTL 317

Query: 456 EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
              LA    +         G  I + T     K                +N ++ +  I 
Sbjct: 318 ARTLATGEAII--------GEEIDIETFNGERKTILNSAVPICDATGTIVNAITVNVDIT 369

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAK--MSHE 553
           ER++ E +       + K RAE          A   ++H+
Sbjct: 370 ERKRVE-AALRQSEALAKARAEELETIMETVPAAVWIAHD 408



 Score = 53.1 bits (126), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/202 (13%), Positives = 51/202 (25%), Gaps = 13/202 (6%)

Query: 62  FIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLA 121
            I     I     Y +++       L                 DL ++K+AE+ L Q   
Sbjct: 720 VINAGFCIPFEKEYIRKDGSRVPILLGAARLSSSPLTWVCFILDLTARKQAEAALQQSEL 779

Query: 122 KTRFLSES---FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEAS 178
             R L+++      + QPN      + +   Y G  + +   E  +       VQ +   
Sbjct: 780 MFRTLADTMPQMFWITQPNGYHEYFNQRWYDYTGTTLEQTQGEGWQKILHPDDVQRTIEQ 839

Query: 179 LDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYR 238
                      +L       +    R      +R  +              +   F    
Sbjct: 840 WQD--------SLDTGKDYDIEYRLRRAADGEYRWHLGRAFPLRDENGQ--MVKWFGSCT 889

Query: 239 QAKKNKENDTILLEANICVETA 260
                K       +A      A
Sbjct: 890 DIHDQKLAIEERAQAWEQERAA 911


>gi|302382337|ref|YP_003818160.1| multi-sensor hybrid histidine kinase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192965|gb|ADL00537.1| multi-sensor hybrid histidine kinase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 915

 Score =  395 bits (1015), Expect = e-107,   Method: Composition-based stats.
 Identities = 127/690 (18%), Positives = 249/690 (36%), Gaps = 44/690 (6%)

Query: 79  EKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNE 138
           +  T      L     +  Q  +    L  Q K   ML    A    ++           
Sbjct: 115 DAPTPAQMESLRLLARLAGQEIDRTRTLRQQAKHTDMLEMSEA----MAGVGHWHCDLTT 170

Query: 139 LVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSI 198
            V   S +     G     + P        S + Q                         
Sbjct: 171 GVITWSDEVFRIHG-----LEPGSVNPTFHSLSAQYHPEDQAAGWALAQRARETGEGYDR 225

Query: 199 LIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE 258
           L+  +R    R+ R +  +E        A+    LF  ++   +         E    + 
Sbjct: 226 LMRLTRHGEERVTRTQARVER---DETGAV--VALFGVFQDVTEAARATRAQTELVETLG 280

Query: 259 TALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIAR 318
            A +    G W  +    +   S  +Y I G   E    S        H D++     + 
Sbjct: 281 MAEALAGVGCWRLDVATGRVTWSDEVYRIHGKTRETFDPSLHDAVSCYHPDDRAAVAASC 340

Query: 319 SVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRY 377
               +     +    +    G +  ++ R +  R  +G    + G+  D+T+    +KR 
Sbjct: 341 DEAIRTGDAKEFQLRIVREDGEERIVRSRCRPERDDAGVTTALFGVFQDVTDSVRSQKRI 400

Query: 378 AEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTR 437
             ++ R     +  S+ +V +  +  +   + + + A G+    LV G   + +   +  
Sbjct: 401 EASEARYRLLADRASDVIVTYGVDGLIQYISPSVEAATGIAPGDLV-GRPVTHLILDEDV 459

Query: 438 PIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRES 497
           P +  R  +  R+   + +          +       G    +    TL++ +  ++ + 
Sbjct: 460 PALSQRFREMVRAGPGTVQ-------PGVVYRARMASGEIRWMEARTTLIRDDHGRVVQF 512

Query: 498 KRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTP 557
                            + R   E      +    ++ AE A ++KSEFLA MSHELRTP
Sbjct: 513 H---------------DVVRDINETKRLEDELIAARDVAEAAARSKSEFLANMSHELRTP 557

Query: 558 LNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDK 617
           L +++GFS +++              YA  I  S + LL++IN+IL+ SK+E + + +D 
Sbjct: 558 LTSVIGFSGLLQSSEALPAAE---RRYADRIATSSEALLSVINDILDYSKLEADAVGLDP 614

Query: 618 QNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKF 675
              D   +      ++ +  ++K + +      +L      D+  ++++    LSN++KF
Sbjct: 615 VAFDPTAMARATASIVETQCEAKGLSLVITTADDLPGAIMGDEGRLRQVTLNFLSNAVKF 674

Query: 676 TNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLA 735
           TN  G++ +    +   + + + D+GIG+    ++ + + F        +  GG GLGLA
Sbjct: 675 TNT-GEIRLDVGSVDGRMRVAVTDSGIGVAADKIDALFERFTQADASTTRVYGGTGLGLA 733

Query: 736 ISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           I   L  + GG +   S+ G G+     +P
Sbjct: 734 ICRRLIEMMGGEIGATSRPGHGSTFWFEVP 763


>gi|312880876|ref|ZP_07740676.1| multi-sensor hybrid histidine kinase [Aminomonas paucivorans DSM
            12260]
 gi|310784167|gb|EFQ24565.1| multi-sensor hybrid histidine kinase [Aminomonas paucivorans DSM
            12260]
          Length = 1513

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 116/619 (18%), Positives = 234/619 (37%), Gaps = 51/619 (8%)

Query: 171  TVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLL 230
               + +      P    +  +P  +     +    P    W + ++           L+ 
Sbjct: 493  AASVPQGRSRPLPPSWEAYQIPLFAFGKTFVLRPAPGEAFWGQHLSWVRWLVLGAGLLIT 552

Query: 231  FILFSYYRQAKKNK---------ENDTILL--EANICVETALSRGRCGLWNF--NFDNKK 277
                 +       +           + +    E         S G   ++ +  +     
Sbjct: 553  LAGAVFAGYLANRRLLLAREVGTRTEELRRVLETIRRERDLFSGGPVVVFLWGTDETGTV 612

Query: 278  FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC-EIARSVTGKHVKQLDQIFHMRH 336
             ++S ++  + G   E  T        L+H +++       R    +     +Q + +R 
Sbjct: 613  EYVSGNVEAVWGYTPEEMTRKGFLFMELVHPEDRDRVVREIRDHADQGRSHFEQSYRLRR 672

Query: 337  ASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
              G   W+     + +  +G    + G  +D T     EK      + L +    + + L
Sbjct: 673  RDGEYRWVADFTVLEKDEAGEVERLRGYLVDQTVLKEAEKALRATGEELDRYFTLSLDLL 732

Query: 396  VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY--RTSDPERSQDM 453
             +     R V  N  + +  G     L   +   ++        +E   R    E   D 
Sbjct: 733  CIATTEGRFVRLNPEWTRVLGYAMGELEGRSFLDLVHPEDLPATLEALGRLGGQEEVLDF 792

Query: 454  SKEIKLADSRWLQINEWCTHDGGTIS-VGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
                +  D  +  I       G  I  V  DI+                         + 
Sbjct: 793  VNRYRCKDGTYRWIEWRSRPFGTLIYAVARDISDRV---------------------ETE 831

Query: 513  QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
              L+     L    A  +    +A+ AN+ KS+FLA MSHE+RTP+N ILG + ++    
Sbjct: 832  ARLQEANRRLEEQTALARSMALQADQANRAKSDFLANMSHEIRTPMNGILGMAALLLDTD 891

Query: 573  FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
                   +   + + +  S ++LL ++N+IL++SKIE  ++++++ + DL  + ++    
Sbjct: 892  LTP----EQRHFGEIVQASAENLLGLLNDILDLSKIEAGRLALEEVDFDLRSLFDDVGAA 947

Query: 633  IGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
            + + AQ+K ++    +  ++      D   ++++L  +L N++KFT+  G++++R  ++ 
Sbjct: 948  LAAQAQAKGLEFLGSVEPDVPSALRGDPGRLRQVLTNLLGNAVKFTHR-GEVVVRARRVS 1006

Query: 691  Q-----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
            +      V  ++ DTGIGIP   ++ + Q F        +  GG GLGLAIS  L  L G
Sbjct: 1007 ESPERVQVRFSVRDTGIGIPADKVDLLFQKFTQADASTTRHYGGTGLGLAISKNLVELMG 1066

Query: 746  GRLKIISQEGKGTIVTICM 764
            G + + S+EG G+     +
Sbjct: 1067 GEIGVHSREGVGSEFWFTL 1085



 Score = 58.8 bits (141), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/196 (12%), Positives = 56/196 (28%), Gaps = 23/196 (11%)

Query: 76  AQQEKMTN---QTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLG---QLLAKTRFLSES 129
            +++         +++  +    + +      D    K+AE  L    + L +   LS  
Sbjct: 671 RRRDGEYRWVADFTVLEKDEAGEVERLRGYLVDQTVLKEAEKALRATGEELDRYFTLSLD 730

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSV 189
            + +A         + + +  +G  +GE+           + +                 
Sbjct: 731 LLCIATTEGRFVRLNPEWTRVLGYAMGELEGRSFLDLVHPEDLP---------ATLEALG 781

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
            L      +  +N        +R        F          ++++  R      E +  
Sbjct: 782 RLGGQEEVLDFVNRYRCKDGTYRWIEWRSRPF--------GTLIYAVARDISDRVETEAR 833

Query: 250 LLEANICVETALSRGR 265
           L EAN  +E   +  R
Sbjct: 834 LQEANRRLEEQTALAR 849


>gi|254410199|ref|ZP_05023979.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
 gi|196183235|gb|EDX78219.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
          Length = 1855

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 140/786 (17%), Positives = 272/786 (34%), Gaps = 116/786 (14%)

Query: 75   YAQQEKMTNQTSLMLT-----EAIEIIFQNNNIKFDLASQKKAESMLGQL---LAKTRFL 126
              Q E+     +  L          +     ++  ++  +++ E  L      +      
Sbjct: 936  RKQAEESLKHLNEALEKRVQERTTALEQTVEHLHREIKERQQTELALQDSHRKINNILES 995

Query: 127  SESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHV 186
                      +      ++  +  I + + ++I                    +      
Sbjct: 996  ITEGFFALDQDWRFTHFNSLLAPLINRPVSDMIGRCIWDEFPDA----MGTKFETIYRQA 1051

Query: 187  LSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKEN 246
                 P     +   N+    +R++  E  L V                Y+R     K+ 
Sbjct: 1052 AREQKPMAFEELYASNNTWYEVRVYPSEDGLSV----------------YFRDISDRKKA 1095

Query: 247  DTILLEANICVETALSRGRCGLWNFNFDNKK-FHLSRSMYEIMGIPYENK-TLSFRAIAR 304
            +  L E+   ++         L+ ++   ++  +++RS+ +++G   E    +  +    
Sbjct: 1096 ELALQESQRFIQRIADTNPNVLYIYDIAEQRNIYINRSVAQVLGYSPEQIQQMESKLFES 1155

Query: 305  LIHYDNKKICEIARSV--TGKHVKQLDQIFHMRHASGADIWIQVRAQMMRT--ISGGMNI 360
            L+H D+            T K    ++  + MRHA+G   W+     +           I
Sbjct: 1156 LMHPDDLAQVLRQHQRFDTAKDGDIIECEYRMRHANGQWRWLYSWDTIFTRTSEGKPKQI 1215

Query: 361  IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
            +G A D+T +  +E+   +  +R       +       D    L       Q+       
Sbjct: 1216 LGTASDITSRKQVEETLRQQVERERLISAMSRRIRQSLDLETILTTTVEEIQQLLMADRV 1275

Query: 421  VLVPG--NARSIIQDAQTRPIIEYRTSD--PERSQDMSKEIKLADSRWLQINEWCTHD-- 474
            ++     + R  +             +   P  +   +        +   + +    D  
Sbjct: 1276 LVYQLFEDNRGRVIAEGVASGFPQLLNSIFPAEAFPPTCYQNYVQGKVYTLADRDREDVL 1335

Query: 475  ---------------------GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQ 513
                                    I  G  I     +  + +  +  L  ++        
Sbjct: 1336 PCMVDFMREYAIRAKLVVPIVQQDILWGLLIVHQCSHPREWQTWEIELLVSLATQLAIAI 1395

Query: 514  ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
               +   +L   N            A + K EFLA MSHELRTPLNAILG SE +++E++
Sbjct: 1396 KQSQLYEQLRHNNDILATTNAELAHATRLKDEFLANMSHELRTPLNAILGLSESLQEEVY 1455

Query: 574  GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
            GE+ + K  +    I  SG+HLL +IN+IL+++KIE+ K+ ++     +  + +  + LI
Sbjct: 1456 GEI-TEKQRKSLATIEKSGRHLLELINDILDLAKIESGKLELNLTAVRISQLCDASLSLI 1514

Query: 634  GSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ- 691
               A  KNI +   I + L     D+R ++++L  +LSN++KFT   G++ +   K    
Sbjct: 1515 KPLALEKNITLSGNIAAGLGTILGDERRLQQVLINLLSNAVKFTPEGGQVTVEIRKQDGG 1574

Query: 692  ----------------------------------------------------CVIITIAD 699
                                                                 + I+++D
Sbjct: 1575 DERDKEVNATFSQGGFCSNVTISSQKKIPKPAPTNHTLEGEEELTFNTSPNEMLYISVSD 1634

Query: 700  TGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTI 759
            TGIGI K   EK+ Q F  + +   +   G GLGLA+   +  LHGG + + S+ GKG+ 
Sbjct: 1635 TGIGIAKEHREKLFQSFVQIDSSLSRRHQGTGLGLALVRRIVELHGGWVTVESEIGKGSC 1694

Query: 760  VTICMP 765
             T+ +P
Sbjct: 1695 FTVRLP 1700



 Score =  109 bits (272), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 65/494 (13%), Positives = 143/494 (28%), Gaps = 41/494 (8%)

Query: 74  RYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFL---SESF 130
              Q+  +  Q S+ +  AI+     + ++ +LA ++KAE +      +  +L   S + 
Sbjct: 538 WEPQELDLLEQLSVQIAIAIQQANAFSQLQTELAERQKAEQLAKATQERLHYLLSASPTA 597

Query: 131 ILLAQ--PNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLS 188
           I   Q  P       S   +  IG   GEI+ +     +     Q     L         
Sbjct: 598 IYSRQFIPPYQTTFISDNITALIGYTPGEILEQPDFWLNH-IHPQDLPTVLTGFAQLFQQ 656

Query: 189 VNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDT 248
                           + L   W+                +   +   +       +   
Sbjct: 657 GYSIQEYRFKQKNGEYLWLQDDWK---------LIRNDQGIPQEIIGAWLDISHRVQAQE 707

Query: 249 ILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHY 308
               +   +E        GL   +   +   ++ +  ++   P +      R++   +  
Sbjct: 708 HAQTSEKLLELFYESAPVGLCITDEQWRLVRVNPAFCQLFAYPRDYLLG--RSLTEFLDP 765

Query: 309 DNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLT 368
            +                     + +R   G  I IQV    +         +    D+T
Sbjct: 766 HH------------------SGEWQVRRHDGKFIDIQVTTGPIMQQGERCLRVTTVTDIT 807

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR 428
           E+   E+       +LS  I+   E + L +   +  + N   Q+  G            
Sbjct: 808 ERKKAEQAIQSMAGQLSTVIDTVGEGITLSNSQGKFRIFNHQMQQITGYTRQEANRCENF 867

Query: 429 SIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
                    P++  +    ++S    ++++  ++ +   N         +S        +
Sbjct: 868 MAKLYPD--PLLYQQVKQWQKSPSKKRKLRTFETTFCDKNG--VQKTLLVSHSIIHQDNQ 923

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLA 548
                        K     L    + LE++  E + A  +      R E   + ++E   
Sbjct: 924 LLFLSAYRDISDRKQAEESLKHLNEALEKRVQERTTALEQTVEHLHR-EIKERQQTELAL 982

Query: 549 KMSHE-LRTPLNAI 561
           + SH  +   L +I
Sbjct: 983 QDSHRKINNILESI 996


>gi|170748185|ref|YP_001754445.1| multi-sensor hybrid histidine kinase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654707|gb|ACB23762.1| multi-sensor hybrid histidine kinase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 1157

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 120/681 (17%), Positives = 232/681 (34%), Gaps = 58/681 (8%)

Query: 104 FDLASQKKAESMLGQLLAKTRFLSE---SFILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
            D+   + AE  L +   + R L+E     I+ +         S      +G    ++I 
Sbjct: 260 GDVTQNRIAERALEESERRYRLLAENATDIIIWSDLTARRRYVSPAVRAVLGYDPQDLIG 319

Query: 161 ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
                      V      LD+      S  L                  +W   + +   
Sbjct: 320 THPLDFVHPDEVGAYRRVLDELTGGRASRALTSQ------RYRHRDGHWVW---LEISFS 370

Query: 221 FFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF-H 279
                +        +  R     K  +  L  +              +W  + +     +
Sbjct: 371 LTHDRATGAPDGYVATLRDVSARKAAEDALRLSEARYRALADALPQLVWIASIETGDASY 430

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASG 339
           ++R   +  G        +  A     H D+ +  E   S         +    ++   G
Sbjct: 431 VNRRFEDYYG----PIGPTRAARIARTHPDDAERMERLWSEAPTRRAPYEVEGRLQRHDG 486

Query: 340 ADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWD 399
              W ++    +      + ++G A+D+ E     +    A   L  A +         D
Sbjct: 487 PYRWHKIVLLPIWQGETMVGMLGTALDIDEIVTARREVEAASSLLHLAQQAAHAGTWHLD 546

Query: 400 KNDRLVMCNANYQKAYGLPDHV---LVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKE 456
            +   +  +    + +G+       L   +  ++I        +E   +     +  S E
Sbjct: 547 LDSGRIEWSPESARLHGIETDRNHVLDTRDWLALIDRGDGERAMEIAAAAAAAGETFSIE 606

Query: 457 IKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
            +             T DGG   +            ++      + A     +       
Sbjct: 607 FR-----------VPTPDGGVRWINGVGRGAPGQARRMIGLNIDVTARKAAEAALLDAKA 655

Query: 517 RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGEL 576
                             +AE A+  KSEFLA MSHE+RTPLN ++G+++++     G  
Sbjct: 656 AADA-----------ACLQAERASAAKSEFLAAMSHEIRTPLNGVIGYADLLLD---GTD 701

Query: 577 GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSS 636
                   A  I  +G  LL ++N++L+ SK+E  +I I  +   +  +I+  + ++  S
Sbjct: 702 LGPAARRNADRIRTAGAALLTVVNDVLDFSKVEAGQIEIVPRPFAVEALIDNAVSIVRPS 761

Query: 637 AQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ--- 691
           A+ K + +   +   L      D+  +++IL  +L+N++KFT + G + +          
Sbjct: 762 AERKGLALTVALGPGLPDWIEGDEDRLRQILLNLLNNAMKFTASGG-IDLSVRVSPDAAS 820

Query: 692 -----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                 +   + DTGIGIP    +++ + F  +     +  GG GLGLAIS +L  L GG
Sbjct: 821 ATGGTRLRFAVRDTGIGIPTDKCDRLFRRFSQVDGSISREYGGTGLGLAISKSLVTLMGG 880

Query: 747 RLKIISQEGKGTIVTIC--MP 765
            + + S  G G+       +P
Sbjct: 881 TIGVASTVGHGSTFWFEADLP 901



 Score =  133 bits (334), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/382 (10%), Positives = 103/382 (26%), Gaps = 22/382 (5%)

Query: 94  EIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVFASSTKNSHY 150
             +   + +  D+    ++E    +     R      E  +++      V A +   +  
Sbjct: 124 GALVALHGLILDVTDLVQSERRARETDMILRGTLDSMEQGLVVLDAGRRVRAFNRSAADL 183

Query: 151 IGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRL 210
           +                    +    A    +     + + P  + +        PL   
Sbjct: 184 L--------DLPDDILRAGVALPDIHAYQRARGDFAEAGSDPGFATAGRGRGPLPPLFD- 234

Query: 211 WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRG-RCGLW 269
           WR    L        SAL        +    +N+  +  L E+               +W
Sbjct: 235 WRLPSGLI--LEVRCSALPDGGTVLTFGDVTQNRIAERALEESERRYRLLAENATDIIIW 292

Query: 270 NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD 329
           + +   ++ ++S ++  ++G   ++   +       +H D                    
Sbjct: 293 S-DLTARRRYVSPAVRAVLGYDPQDLIGTHP--LDFVHPDEVGAYRRVLDELTGGRASRA 349

Query: 330 QI-FHMRHASGADIWIQVRAQMMRT--ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
                 RH  G  +W+++   +            +    D++ +   E     ++ R   
Sbjct: 350 LTSQRYRHRDGHWVWLEISFSLTHDRATGAPDGYVATLRDVSARKAAEDALRLSEARYRA 409

Query: 387 AIECTSEALVLWDKN-DRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTS 445
             +   + + +           N  ++  YG          AR+   DA+    +     
Sbjct: 410 LADALPQLVWIASIETGDASYVNRRFEDYYGPIGPTRAARIARTHPDDAERMERLWSEAP 469

Query: 446 DPERSQDMSKEIKLADSRWLQI 467
                 ++   ++  D  +   
Sbjct: 470 TRRAPYEVEGRLQRHDGPYRWH 491



 Score = 95.4 bits (236), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/248 (17%), Positives = 81/248 (32%), Gaps = 14/248 (5%)

Query: 267 GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK 326
           G W  +   ++   S ++  ++G       L         H D++           +  +
Sbjct: 33  GQWRLDPCTRRVTRSANLARLLG-TPGACDLPLAEHVACYHPDDRAALVARLEGILEGSR 91

Query: 327 ---QLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQ 382
                     +    G  +   ++        G  + + G+ +D+T+    E+R  E D 
Sbjct: 92  PAIPYQARARVVRPDGTVLDAIIQGLPESGPDGALVALHGLILDVTDLVQSERRARETDM 151

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
            L   ++   + LV+ D   R+   N +      LPD +L  G A   I   Q       
Sbjct: 152 ILRGTLDSMEQGLVVLDAGRRVRAFNRSAADLLDLPDDILRAGVALPDIHAYQRARGDFA 211

Query: 443 RTSDP---------ERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
                                 + +L     L++      DGGT+    D+T  +  +  
Sbjct: 212 EAGSDPGFATAGRGRGPLPPLFDWRLPSGLILEVRCSALPDGGTVLTFGDVTQNRIAERA 271

Query: 494 LRESKRRL 501
           L ES+RR 
Sbjct: 272 LEESERRY 279


>gi|126175702|ref|YP_001051851.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS155]
 gi|125998907|gb|ABN62982.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS155]
          Length = 1784

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 140/701 (19%), Positives = 275/701 (39%), Gaps = 68/701 (9%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNEL--V 140
              +L  A +   Q      D+  +   E  +     + R         +   +  ++  +
Sbjct: 610  LSILPTAFDGQRQVAASIRDMTQKLAVEQKIRDSEQRFRGLVTNIPGAVYRTRIGDVWFM 669

Query: 141  FASSTKNSHYIGKKIGEIIPELSRSRS-------RSKTVQMSEASLDQQPYHVLSVNLPH 193
               S   +   G    + I    R+ +       R       + +L QQ    +   + H
Sbjct: 670  EYISDNIAEITGYAASQFIENRQRTFASLILEEDRPTCHLHIDRALAQQETFEVEYRIRH 729

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GSI  ++ +      + EE     ++F                   ++K     L ++
Sbjct: 730  RDGSIRWVHEKG--KASYTEE--GIPLWFDGSID-----------DITESKLALVQLEQS 774

Query: 254  NICVETALSRGRCGL----WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +        C +    W+   D +   LS +  +++G+  ++   +F  IA  I  +
Sbjct: 775  RQQMTNITESIPCTVYQLQWHSPIDRRFTFLSGAAMKMLGLHRDDLMSNFDIIAERIFDE 834

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A S   +   Q  + F  RH +G+  W++  A       G +   G  MD+T+
Sbjct: 835  ERPDVVRALSGQSEDRLQWIREFRYRHPNGSIRWMEAGASGHLGEEGAITWNGYVMDITQ 894

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       +  +  +V  D    ++ CN  +     L  + L    A  
Sbjct: 895  RKTIEQELALSEAHFKALFDGATIGIVNVDIKGVILDCNDQFCADMALSRNHLRN-TAIF 953

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
             +   Q +PI + +  +    +      + +         +    G  + +  +++ L  
Sbjct: 954  EVLSEQDQPIAKAQFQELVEGKIDHYRGERS---------FIRPSGAPLWMTVNVSALLD 1004

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
             Q Q   +   +                  TEL + + +  + KE+A+ A+K K +FLA 
Sbjct: 1005 AQGQFESAVISMVDM---------------TELKLLSDELLLAKEQADAASKAKGDFLAN 1049

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            MSHE+RTP+NAI+G S++  +    +    K   Y + I  + Q LL++IN+IL+ SKIE
Sbjct: 1050 MSHEIRTPMNAIIGMSQLCLQTELDK----KQKNYVEKIERASQSLLSIINDILDFSKIE 1105

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFP 667
              K+ ID     L  ++ +   +    A  K I++   +   +      D   + ++L  
Sbjct: 1106 AGKLDIDSVPFQLDTMLEDLSDMFSEKAAHKQIELLFAVAPNVPRYLLGDSLRLGQVLIN 1165

Query: 668  ILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
            +++N+IKFT   G++++  S + Q      +  ++ D+GIG+ +    K+ + F      
Sbjct: 1166 LMNNAIKFT-ERGEVLLSLSLVEQQDDDVVLRFSVRDSGIGLTEQQQAKLFKSFTQADTS 1224

Query: 723  YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
              +  GG GLGLAI   L  L GG++ + SQ G G+     
Sbjct: 1225 TTRKYGGTGLGLAICKQLVELMGGKIGVESQFGHGSTFYFT 1265



 Score =  131 bits (330), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 58/457 (12%), Positives = 131/457 (28%), Gaps = 49/457 (10%)

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
           L      +     +  D+      +             +   +L+      +  ++++  
Sbjct: 490 LMSDTGELMSVEMLFTDVTE----QFSAAVWSNAVLEAAPEAMLIVDELGQIVFTNSRCL 545

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
              G + G ++  L       +                 +        S+        L 
Sbjct: 546 QLFGYETGAMLG-LQVEALLPQEYGERHVLER------QTFLREGRDRSMANARHVRALK 598

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE-------TAL 261
               E +    +     +      + +  R   +    +  + ++             A+
Sbjct: 599 ADGNEFIAEIALSILPTAFDGQRQVAASIRDMTQKLAVEQKIRDSEQRFRGLVTNIPGAV 658

Query: 262 SRGRCG-LWNFNFDNKKFHLSRSMYEIMGIPYENK-TLSFRAIARLIHYDNKKICEIARS 319
            R R G +W         ++S ++ EI G           R  A LI  +++  C +   
Sbjct: 659 YRTRIGDVWFME------YISDNIAEITGYAASQFIENRQRTFASLILEEDRPTCHLHID 712

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNII-GIAMDLTEKYHLEKRYA 378
                 +  +  + +RH  G+  W+  + +   T  G      G   D+TE      +  
Sbjct: 713 RALAQQETFEVEYRIRHRDGSIRWVHEKGKASYTEEGIPLWFDGSIDDITESKLALVQLE 772

Query: 379 EADQRLSKAIECT----SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA 434
           ++ Q+++   E       +       + R    +    K  GL    L   +   II   
Sbjct: 773 QSRQQMTNITESIPCTVYQLQWHSPIDRRFTFLSGAAMKMLGLHRDDL--MSNFDII--- 827

Query: 435 QTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
               I +    D  R+     E +L    W++   +   +G    +             L
Sbjct: 828 -AERIFDEERPDVVRALSGQSEDRLQ---WIREFRYRHPNGSIRWMEA------GASGHL 877

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQV 531
            E             T R+ +E+   EL+++ A ++ 
Sbjct: 878 GEEGAITWNGYVMDITQRKTIEQ---ELALSEAHFKA 911



 Score = 51.1 bits (121), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 45/399 (11%), Positives = 133/399 (33%), Gaps = 27/399 (6%)

Query: 61  VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL 120
           + IA + ++ +  +      +  +  L                  L   K   +    L 
Sbjct: 213 LGIAPNRLVVLDDQGRLIYHVDREKVLA-----------TTSTQWLDKNKYRNADFWALQ 261

Query: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
           AK       F+      ++V+ +S      +  ++  + PE     S    +     +L 
Sbjct: 262 AKGLDGQARFV---DDKDVVYLASIATVPQLKWRVIVLAPEQELFSSLLDDMASIILNLS 318

Query: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
                +L             +      +  + +  T +++      + ++ +  ++ + A
Sbjct: 319 LLTLLLLLTCYLAAKRLTRPLELLESGILSFGQGKTQQLIVPKGAVSEIVTLSNTFNQMA 378

Query: 241 KKNKENDTILLEAN-ICVETALSRGRCGLW--NFNFDNKKFHLSRSMYEIMGIPYENKTL 297
           +   E +  +L++        +       +  + + D +   +S  + +++GI  +    
Sbjct: 379 ELLAEREQAILDSRGNRFARLIDGMSDKSFYCSLDPDGQLAQVSEGVTKVLGISPDLLKR 438

Query: 298 SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG 357
            ++ +      + K       ++ G++V        M    G    + V  Q + + +G 
Sbjct: 439 KYQRLFSANPLNEKNWQYTDFALKGQNVPSHQVE--MLDDQGHLRRLDVFMQPLMSDTGE 496

Query: 358 MNIIGI-AMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYG 416
           +  + +   D+TE++             +  +E   EA+++ D+  ++V  N+   + +G
Sbjct: 497 LMSVEMLFTDVTEQFSAA-------VWSNAVLEAAPEAMLIVDELGQIVFTNSRCLQLFG 549

Query: 417 LPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
                ++     +++        +  R +     +D S 
Sbjct: 550 YETGAMLGLQVEALLPQEYGERHVLERQTFLREGRDRSM 588


>gi|209526710|ref|ZP_03275233.1| multi-sensor signal transduction histidine kinase [Arthrospira
           maxima CS-328]
 gi|209492842|gb|EDZ93174.1| multi-sensor signal transduction histidine kinase [Arthrospira
           maxima CS-328]
          Length = 856

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 127/618 (20%), Positives = 240/618 (38%), Gaps = 67/618 (10%)

Query: 177 ASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSY 236
           ASL          +L   + ++  +            E        + I  ++       
Sbjct: 269 ASLRFGQRGTAIAHLLTATFAVWGVLRGSGPFMNNLNENPQVFSLQAFI-LVMTVTGLFL 327

Query: 237 YRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT 296
               ++ +  +  L      + TA    + G W  +        S  +Y I G+  +  T
Sbjct: 328 AGAVEERQTVEASLRSGEASLATAQRIAKLGHWELDIPQLTCTWSDQLYRIFGVNPQQVT 387

Query: 297 LSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG 356
            S  ++ + IH+ ++   E A S            + +    G + ++  +A +      
Sbjct: 388 PSIDSLMQYIHHQDRPRVENAISQAISEQIPYSIDYRIARPDGQERFVVEQAIVT----- 442

Query: 357 GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWD-KNDRLVMCNANYQKAY 415
             +I     D+TE+   E     +++R S+  + +   + +   +  R V  N ++ +  
Sbjct: 443 PTHITSTVQDITERKRAEIALRASEERFSRVFKASPIGISITTVEEGRFVDVNDSFLQQL 502

Query: 416 GLPDHVLVPGNARS-IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHD 474
           G     ++        + DA+    I  R ++ +R  +++ +++                
Sbjct: 503 GWSREQVIDRTFEDLEMWDAEQINPILQRITNGDRLSNLTVQVRH-------------KS 549

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           G        I  ++                         IL    TE      + +  KE
Sbjct: 550 GAIRDWLIAIEPIQLENTPCL-----------------LILASDITE-HKQAEELRRAKE 591

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
            AE AN+ KS FLA MSHELRTPLNAILG+SE+++++   +LG   +    ++IH +GQH
Sbjct: 592 AAEQANQAKSLFLANMSHELRTPLNAILGYSELLQEDA-EDLGQDDWVADLKNIHVAGQH 650

Query: 595 LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-F 653
           LL +I++IL+ SKIE  +++   +   +  ++ E    I   A   + +   ++   L  
Sbjct: 651 LLTLISDILDFSKIEAGRMNFHLEKCQINTLLWEVETTIAPLADKNHNQFTLEVAPGLDL 710

Query: 654 FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI-------GQ--------------- 691
              D   +++ L  +LSN+ KFT   G++ +R  K                         
Sbjct: 711 MYTDLTKVRQSLLNLLSNACKFT-EQGQVTLRVWKQLIPATDLPDLPVYHSLESPEEELS 769

Query: 692 ---CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
               +   + D GIG+ +  +  +  PF        +  GG GLGL+I+  L  + GG L
Sbjct: 770 EIPFIFFQVQDHGIGMNERQIATVFSPFTQADESTTRKYGGTGLGLSITHKLCQMMGGDL 829

Query: 749 KIISQEGKGTIVTICMPQ 766
            + S+  KG+  T+ +PQ
Sbjct: 830 WVESELNKGSTFTMRLPQ 847



 Score = 48.4 bits (114), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/188 (10%), Positives = 49/188 (26%), Gaps = 18/188 (9%)

Query: 72  TTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSE 128
            +   +  +   Q   ++ +AI       +   D+  +K+AE  L     +       S 
Sbjct: 419 YSIDYRIARPDGQERFVVEQAIVTPTHITSTVQDITERKRAEIALRASEERFSRVFKASP 478

Query: 129 SFILLAQ-PNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVL 187
             I +           +      +G    ++I             +     L +      
Sbjct: 479 IGISITTVEEGRFVDVNDSFLQQLGWSREQVIDRT-FEDLEMWDAEQINPILQRITNGDR 537

Query: 188 SVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKEND 247
             NL         +  +   +R W   +          +  LL +         ++K+ +
Sbjct: 538 LSNLTVQ------VRHKSGAIRDW---LIAIEPIQLENTPCLLILA----SDITEHKQAE 584

Query: 248 TILLEANI 255
            +      
Sbjct: 585 ELRRAKEA 592


>gi|160873991|ref|YP_001553307.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS195]
 gi|160859513|gb|ABX48047.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS195]
 gi|315266220|gb|ADT93073.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS678]
          Length = 1786

 Score =  393 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 139/701 (19%), Positives = 276/701 (39%), Gaps = 68/701 (9%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNEL--V 140
              +L  A +   Q      D+  +   E  +     + R         +   +  ++  +
Sbjct: 610  LSILPTAFDGQRQVAASIRDMTQKLAVEQKIRDSEQRFRGLVTNIPGAVYRTRIGDVWFM 669

Query: 141  FASSTKNSHYIGKKIGEIIPELSRSRS-------RSKTVQMSEASLDQQPYHVLSVNLPH 193
               S   +   G    + I    R+ +       R       + +L QQ    +   + H
Sbjct: 670  EYISDNIAEITGYAASQFIENRQRTFASLILEEDRPTCHLHIDRALAQQETFEVEYRIRH 729

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GSI  ++ +      + EE     ++F                   ++K     L ++
Sbjct: 730  RDGSIRWVHEKG--KASYTEE--GIPLWFDGSID-----------DITESKLALVQLEQS 774

Query: 254  NICVETALSRGRCGLWN--FNFDNKK--FHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +        C ++   ++    +    LS +  +++G+  ++   +F  IA  I  +
Sbjct: 775  RQQMTNITESIPCTVYQLQWHSPTDRRFTFLSGAAMKMLGLHRDDLMSNFDIIAERIFDE 834

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A S   +   Q  + F  RH +G+  W++  A       GG+   G  MD+T+
Sbjct: 835  ERPDVVRALSGQSEDRLQWIREFRYRHPNGSIRWMEAGASGHLGEEGGITWNGYVMDITQ 894

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       +  +  +V  D    ++ CN  +     L  + L    A  
Sbjct: 895  RKTIEQELALSEAHFKALFDGATIGIVNVDIKGVILDCNDQFCADMALSRNHLRN-TAIF 953

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
             +   Q +PI + +  +    +      + +         +    G  + +  +++ L  
Sbjct: 954  EVLSEQDQPIAKAQFQELVEGKIDHYRGERS---------FIRPSGAPLWMTVNVSALLD 1004

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
             Q Q   +   +                  TEL + + +  + KE+A+ A+K K +FLA 
Sbjct: 1005 AQGQFESAVISMVDM---------------TELKLLSDELLLAKEQADAASKAKGDFLAN 1049

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            MSHE+RTP+NAI+G S++  +    +    K   Y + I  + Q LL++IN+IL+ SKIE
Sbjct: 1050 MSHEIRTPMNAIIGMSQLCLQTELDK----KQKNYVEKIERASQSLLSIINDILDFSKIE 1105

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFP 667
              K+ ID     L  ++ +   +    A  K I++   +   +      D   + ++L  
Sbjct: 1106 AGKLDIDSVPFQLDTMLEDLSDMFSEKAAHKQIELLFAVAPNVPRYLLGDSLRLGQVLIN 1165

Query: 668  ILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
            +++N+IKFT   G++++  S + Q      +  ++ D+GIG+ +    K+ + F      
Sbjct: 1166 LMNNAIKFT-ERGEVLLSLSLVEQQDDDVVLRFSVRDSGIGLTEQQQAKLFKSFTQADTS 1224

Query: 723  YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
              +  GG GLGLAI   L  L GG++ + SQ G G+     
Sbjct: 1225 TTRKYGGTGLGLAICKQLVELMGGKIGVESQFGHGSTFYFT 1265



 Score =  131 bits (330), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 49/391 (12%), Positives = 114/391 (29%), Gaps = 37/391 (9%)

Query: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
                 +   +L+      +  ++++     G + G ++  L       + +        
Sbjct: 518 NAVLEAAPEAMLIVDELGQIVFTNSRCLQLFGYETGAMLG-LQVEALLPQELGERHVLER 576

Query: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
                  +        S++       L     E +    +     +      + +  R  
Sbjct: 577 ------QTFLREGRDRSMVNARHVRALKADGNEFIAEIALSILPTAFDGQRQVAASIRDM 630

Query: 241 KKNKENDTILLEANICVE-------TALSRGRCG-LWNFNFDNKKFHLSRSMYEIMGIPY 292
            +    +  + ++             A+ R R G +W         ++S ++ EI G   
Sbjct: 631 TQKLAVEQKIRDSEQRFRGLVTNIPGAVYRTRIGDVWFME------YISDNIAEITGYAA 684

Query: 293 ENK-TLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM 351
                   R  A LI  +++  C +         +  +  + +RH  G+  W+  + +  
Sbjct: 685 SQFIENRQRTFASLILEEDRPTCHLHIDRALAQQETFEVEYRIRHRDGSIRWVHEKGKAS 744

Query: 352 RTISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIECT----SEALVLWDKNDRLVM 406
            T  G      G   D+TE      +  ++ Q+++   E       +       + R   
Sbjct: 745 YTEEGIPLWFDGSIDDITESKLALVQLEQSRQQMTNITESIPCTVYQLQWHSPTDRRFTF 804

Query: 407 CNANYQKAYGLPDHVLVPGNAR--SIIQDAQTRPIIEYR--TSDPERSQDMSKEIKLADS 462
            +    K  GL    L+         I D +   ++      S+           +  + 
Sbjct: 805 LSGAAMKMLGLHRDDLMSNFDIIAERIFDEERPDVVRALSGQSEDRLQWIREFRYRHPNG 864

Query: 463 --RWLQ--INEWCTHDGGTIS--VGTDITLL 487
             RW++   +     +GG        DIT  
Sbjct: 865 SIRWMEAGASGHLGEEGGITWNGYVMDITQR 895



 Score = 51.5 bits (122), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 45/403 (11%), Positives = 128/403 (31%), Gaps = 27/403 (6%)

Query: 61  VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL 120
           + IA + ++ +  +      +  +  L                  L   K   +    L 
Sbjct: 213 LGIAPNRLVVLDDQGRLIYHVDREKVLA-----------TTSTQWLDKNKYRNADFWALQ 261

Query: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
           AK       F+      ++V+ +S      +  ++  + PE     S    +     +L 
Sbjct: 262 AKGLDGQARFV---DDKDVVYLASIATVPQLKWRVIVLAPEQELFSSLLDDMASIILNLS 318

Query: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
                +L             +      +  + +  T +++      + ++ +  ++ + A
Sbjct: 319 LLTLLLLLTCYLAAKRLTRPLELLESGILSFGQGKTQQLIVPKGAVSEIVTLSNTFNQMA 378

Query: 241 KKNKENDTILLEAN-ICVETALSRGRCGLW--NFNFDNKKFHLSRSMYEIMGIPYENKTL 297
           +   E +  +L++        +       +  + + D +   +S  + +++GI  +    
Sbjct: 379 ELLAEREQAILDSRGNRFARLIDGMSDKSFYCSLDPDGQLAQVSEGVTKVLGISPDLLKR 438

Query: 298 SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQM-MRTISG 356
            ++ +      + K        +  K          M    G    + V  Q  M   + 
Sbjct: 439 KYQRLFSANPLNEKNW--QYTDLALKGQNVPSHQVEMLDDQGHLRRLDVFMQPLMSDTNE 496

Query: 357 GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYG 416
            M++  +  D+TE++             +  +E   EA+++ D+  ++V  N+   + +G
Sbjct: 497 LMSVEMLFTDVTEQFSAA-------VWSNAVLEAAPEAMLIVDELGQIVFTNSRCLQLFG 549

Query: 417 LPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKL 459
                ++     +++        +  R +     +D S     
Sbjct: 550 YETGAMLGLQVEALLPQELGERHVLERQTFLREGRDRSMVNAR 592


>gi|91216331|ref|ZP_01253298.1| sensory box histidine kinase/response regulator [Psychroflexus
           torquis ATCC 700755]
 gi|91185469|gb|EAS71845.1| sensory box histidine kinase/response regulator [Psychroflexus
           torquis ATCC 700755]
          Length = 1325

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 131/680 (19%), Positives = 247/680 (36%), Gaps = 63/680 (9%)

Query: 102 IKFDLASQKKAESMLG---QLLAKTRFLSESFILLAQPNELVFASST---KNSHYIGKKI 155
           +  ++  +K AE  L     L ++   LS+         +     +    + +     + 
Sbjct: 277 VIREVTDRKNAEKELKLINNLFSEAESLSQIGGWHYDVKKEKLFWTPILKEIAEIESHEQ 336

Query: 156 GEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEV 215
            ++           ++ +     +    ++       H S +            +W    
Sbjct: 337 PDLEG-ALSFFKSGESAKRMTEKVQDCIHN-------HISYTGEFETQTAKGRSIWALVN 388

Query: 216 TLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDN 275
               +            L+  ++     K     L +    +   +     G W +N   
Sbjct: 389 IKPEIV-----DKECVGLYGTFQDITDIKNTKIKLKKERSRLNNIIDATNLGTWEWNVQT 443

Query: 276 KKFHLSRSMYEIMGIPYENKTLS--FRAIARLIHYDNKKICEIA-RSVTGKHVKQLDQIF 332
            +   +    E++G   +  TLS          H  +    + A +              
Sbjct: 444 GEALFNNRFVEMLGYTTKEMTLSNSIDVWNNATHPIDLPESDKALQEHFDGKSDFYKMDL 503

Query: 333 HMRHASGADIWIQVRAQMMR--TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
            ++H  G  IW+  + +++          + G   D+T+K  LEK   +  Q+     E 
Sbjct: 504 RLKHKLGHWIWVLDKGKVISWTEDGQPEWMFGTHHDITDKKVLEKDLKKNVQQFKNIFEL 563

Query: 391 TSEALVLWD-KNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
           +   +++ D K+   +  N   Q   G     ++  N  SI  + +          +   
Sbjct: 564 SPVGIIITDFKSGNFLDVNKAMQDMVGYTKDEILDMNIWSITPEKEVVEKDRQAIQN--- 620

Query: 450 SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
                    L D + +   E          +   I  L H                 D +
Sbjct: 621 ---------LKDLKKIGPLEKVLKAKTGEFIKVMINGLIHF--------------NEDGN 657

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
                  +  TE      K +  K  A  A++ KSEF+A MSHE+RTPLN ++GFS+++ 
Sbjct: 658 RIVISTIQDITEQKRFEKKLEKSKVEAIKASQAKSEFVANMSHEIRTPLNGVIGFSDLLM 717

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
           K       +   ++Y + +  S   LL++IN++L  SKIE+ K+ +D +   LI ++NE 
Sbjct: 718 KTPL----NEVQHKYMKTVFQSANTLLDLINDVLNFSKIESGKLQLDIEKTSLIKLVNEV 773

Query: 630 IRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
           + L    A  K ++    I  ++      D   +K+IL  ++SN+IKFT+  G + ++  
Sbjct: 774 VDLTKYDAHKKGLEFVLVIEDKIPDYIWIDGVRLKQILMNLISNAIKFTHR-GYVKLKVH 832

Query: 688 KIGQ-----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
              +      +  ++ D GIGI K   +KI   F        +  GG GLGL+IS  +  
Sbjct: 833 FKNKTNNLTTISFSVEDKGIGIAKGNQKKIFNAFIQEDASVTKKYGGTGLGLSISGKILG 892

Query: 743 LHGGRLKIISQEGKGTIVTI 762
           L   +LK+ SQ G G+    
Sbjct: 893 LMNSKLKLKSQLGIGSEFYF 912



 Score =  119 bits (298), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 63/537 (11%), Positives = 159/537 (29%), Gaps = 29/537 (5%)

Query: 64  ATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKT 123
           A  ++    +   +           L++ +     ++  + +L    ++ S         
Sbjct: 118 ALGTLSVFDSSPKELSDAQKDILEKLSQEVMDKIISHKKQVELKKLNESISDGKHRFQTL 177

Query: 124 RFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQP 183
              +   + L                + GK+   ++ +     ++       +  L  + 
Sbjct: 178 LNNTGDMVFLLNAELKFL-------EFYGKE-DNLLLKKQTFINKRIDEIDLDHQLVSKL 229

Query: 184 YHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKN 243
              +  +  +NS   +  N      + W       V   +  + +L  I     R+    
Sbjct: 230 KLAVESSKQNNSSIPIEYNLLANKSQKWFNMNVTVVQRKNSETEVLCVI-----REVTDR 284

Query: 244 KENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIA 303
           K  +  L   N     A S  + G W+++   +K   +  + EI  I    +     A++
Sbjct: 285 KNAEKELKLINNLFSEAESLSQIGGWHYDVKKEKLFWTPILKEIAEIESHEQPDLEGALS 344

Query: 304 RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGI 363
                ++ K           +       F  + A G  IW  V  +        + + G 
Sbjct: 345 FFKSGESAKRMTEKVQDCIHNHISYTGEFETQTAKGRSIWALVNIKPEIVDKECVGLYGT 404

Query: 364 AMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLV 423
             D+T+  + + +  +   RL+  I+ T+     W+      + N  + +  G     + 
Sbjct: 405 FQDITDIKNTKIKLKKERSRLNNIIDATNLGTWEWNVQTGEALFNNRFVEMLGYTTKEMT 464

Query: 424 PGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTD 483
             N+  +  +A     +       +   D   +    D R           G  I V   
Sbjct: 465 LSNSIDVWNNATHPIDLPESDKALQEHFDGKSDFYKMDLR------LKHKLGHWIWVLDK 518

Query: 484 ITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTK 543
             ++   +    E        I D     + L++   +                      
Sbjct: 519 GKVISWTEDGQPEWMFGTHHDITDKKVLEKDLKKNVQQFKNIFE--------LSPVGIII 570

Query: 544 SEFLAKMSHELRTPLNAILGFS--EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
           ++F +    ++   +  ++G++  E++   I+      +  E  +    + + L  +
Sbjct: 571 TDFKSGNFLDVNKAMQDMVGYTKDEILDMNIWSITPEKEVVEKDRQAIQNLKDLKKI 627


>gi|78047771|ref|YP_363946.1| two-component system sensor histidine kinase-response regulator
           hybrid protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78036201|emb|CAJ23892.1| two-component system sensor histidine kinase-response regulator
           hybrid protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 1137

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 138/716 (19%), Positives = 255/716 (35%), Gaps = 53/716 (7%)

Query: 83  NQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSES---FILLAQPNEL 139
                 L+  IE++       ++   + KA+  L    A+ R L+++    I +A P+  
Sbjct: 276 RAPRRWLSAEIELVRLVVARCWESMQRAKAQQQLAANEARLRRLADTLPQIIFIADPDGR 335

Query: 140 VFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSIL 199
               + +   Y G     + P  +   +  +        L +Q + +             
Sbjct: 336 PHYFNQRWYEYTG-----LDPSSNEDAAWHRAHTADGLRLSEQAWSLALKGQRALEVECE 390

Query: 200 IINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVET 259
           ++         W     L V          +      Y      +  +  L E+ +    
Sbjct: 391 LLRHDGQ--SRWHLVRALPVRGDDGS----ISEWIGTYTDIHHRRTFEQQLRESEVRFRA 444

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
                   +W  +      + +   Y   G          +    ++H D+      A  
Sbjct: 445 LCETVPAMIWMADAQGDCVYWNPRWYNFTG--QGEDQALDQGWWDVMHPDDAARVRHAFE 502

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYA 378
              +   +    + +R   G   W    A       G     IG   D++E+ H+E   A
Sbjct: 503 QALEQRGEFLAEYRVRRHDGQYRWCIDTASPHFASDGRFLGHIGSLTDISERKHIEDATA 562

Query: 379 EADQRLSKAIECTSEALVL------WDKNDRLVMCNANYQKA------------------ 414
                LS         +VL       +    + +  +   +                   
Sbjct: 563 SDRAILSLITTGAPLPVVLDAIALSVEARGEIPLYCSVMVRDEIRHTLSFGSAPHFPIEY 622

Query: 415 --YGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCT 472
             +  P  +   G   ++      + I     +D   S   +    +             
Sbjct: 623 RGHFEPSPIGPEGPPCALSAHLGRQVICSDLQADASFSSHHAISATM--GIAACCVTPIL 680

Query: 473 HDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE 532
              G +    +I   + +   LRE      A+        +     K +LS+        
Sbjct: 681 ASNGQVLGTLNIYYDRPHLPSLREQAMARSASHLAGIVIERTRVDAKLKLSLQAET--AA 738

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           + +AE AN+ K EFLA +SHELRTPLNAILG+S +++ +I               I  S 
Sbjct: 739 RAQAEHANRVKDEFLATLSHELRTPLNAILGWSRLMQSDIADPAN---LGRGLVIIERSA 795

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK--IPS 650
           +    +I+++L+MS I + KI +  ++ D+  ++   + L+  +A ++ I +E       
Sbjct: 796 RAQTQIIDDLLDMSAILSGKIRLQAEHFDIAGLVRSVLELMQPTALARKIALELDAPCDG 855

Query: 651 ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALE 710
           EL+F  D   ++++L  +LSN++KFT   G + +      + + + + DTGIGI    L 
Sbjct: 856 ELWFFGDAGRLQQVLTNLLSNALKFTPAGGTVRVAMDVEDERLRLCVQDTGIGIAADFLP 915

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ-EGKGTIVTICMP 765
            +   F        + +GG GLGL+IS  L +LHGG L   S  EG+G + TI +P
Sbjct: 916 HVFDRFRQADAGTTRRVGGLGLGLSISRQLVDLHGGSLGASSAGEGQGALFTIVLP 971


>gi|149178788|ref|ZP_01857370.1| probable sensor/response regulator hybrid [Planctomyces maris DSM
            8797]
 gi|148842405|gb|EDL56786.1| probable sensor/response regulator hybrid [Planctomyces maris DSM
            8797]
          Length = 1780

 Score =  392 bits (1008), Expect = e-106,   Method: Composition-based stats.
 Identities = 134/673 (19%), Positives = 251/673 (37%), Gaps = 63/673 (9%)

Query: 108  SQKKAESMLGQ---LLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSR 164
            S+ + +  L +           +   I+       +   +       G    E+I +   
Sbjct: 996  SRCRIQDQLYEEVARKNAILSSAIDCIITTDAAGNIVDFNPAAERTFGYTAQEVIGKTLC 1055

Query: 165  SRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV-FFS 223
                 +       +  +Q       +L      + +++       +   E+ + V     
Sbjct: 1056 DLLLLEEYHERYHTALEQFLKTGESDLIGRHIELPVMHQDGSHFPV---ELAISVTHLED 1112

Query: 224  IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRS 283
                  L +     R     K+ +  L ++    +  +      +W    D +    S +
Sbjct: 1113 GHPFFTLCL-----RDISLRKQQEEALRDSEGRSKALVEASAHMVWTMTPDARTVEDSPT 1167

Query: 284  MYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIW 343
              E  G  YE            IH D+++          + V  LD  + + +  G   W
Sbjct: 1168 WREFTGQTYEEWKDKG--WIDGIHPDDREQTLRNWQTAFESVTPLDCEYRLCNREGEWCW 1225

Query: 344  IQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
              VRA       G  +  +G+ +D+T + HL++     ++RL  A++    A   W  + 
Sbjct: 1226 TSVRAVPQINSEGTVLRWVGMNLDITRQKHLQQEVEANEKRLFMALKAAGMAAWEWQPHA 1285

Query: 403  RLVMCNANYQKAYGLPDHV-LVPGNARSIIQDAQTRPIIEYRTS--DPERSQDMSKEIKL 459
                 +    +  G+P+     P    S +       +I+        E+  D    I  
Sbjct: 1286 SF--WSNELYELLGIPNTTSASPETLFSCVYKEDLPGLIKAWDEAVQGEKEYDQIFRIVR 1343

Query: 460  ADS--RWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILER 517
             D   RWL        D                                   T    L  
Sbjct: 1344 PDGEIRWLAGVGEIVRD------------------------------PQGNVTQIFGLNW 1373

Query: 518  QKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELG 577
              T+        +  +++A+ AN  KS FLA MSHE+RTP+ A+LG+++++     G   
Sbjct: 1374 DFTQEREGEEALRRSEKQAKQANVAKSAFLANMSHEIRTPMTAVLGYTDLL----IGMEQ 1429

Query: 578  SVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSA 637
              +  EY Q+I  +G  LL +IN+IL++SKIE  K+ I +++  L  ++ +   ++   A
Sbjct: 1430 EQEKAEYLQNIKRNGNFLLEIINDILDLSKIEAGKLEISQESFSLNEMLADLQSMMRVRA 1489

Query: 638  QSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT----SKIGQ 691
            + KN++   +  S+L      D + +++IL  ++SN+IKFT   G + +       K   
Sbjct: 1490 EEKNLEFGIEFISDLPERIETDPKRLRQILLNLISNAIKFT-ETGSVKVVINFLREKADA 1548

Query: 692  CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
             +   + DTGIGI      ++ Q F        ++ GG GLGLAIS  L  +  G + + 
Sbjct: 1549 VLKFDVIDTGIGITPKQQSRLFQSFSQGDASVTRNYGGTGLGLAISQRLAGMLNGNISVS 1608

Query: 752  SQEGKGTIVTICM 764
            S+ G+G+  +  +
Sbjct: 1609 SKPGEGSTFSCTI 1621



 Score = 37.7 bits (86), Expect = 8.5,   Method: Composition-based stats.
 Identities = 22/149 (14%), Positives = 42/149 (28%), Gaps = 7/149 (4%)

Query: 242 KNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRA 301
           + + +   L  A   +E  L+  +      +        + S   I  +   +       
Sbjct: 708 EIQASMEALTRAQSDLENLLNGTKIATIYLDRQMLIKSFTTSAKTIYNLNATDVGRPLSD 767

Query: 302 IARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNII 361
           I    H   +     +   T K   Q +    M+  +G   W+  R     +      +I
Sbjct: 768 I---THNVKRMPKIPSLENTRKQNGQFEDE--MQLKNGT--WLLRRILPYESDGEFDGMI 820

Query: 362 GIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
              +D+TE    E R            E 
Sbjct: 821 LTFLDVTEFKLAEIRLETEHAITQLLAEA 849


>gi|304411121|ref|ZP_07392737.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS183]
 gi|307301756|ref|ZP_07581514.1| multi-sensor hybrid histidine kinase [Shewanella baltica BA175]
 gi|304350656|gb|EFM15058.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS183]
 gi|306913794|gb|EFN44215.1| multi-sensor hybrid histidine kinase [Shewanella baltica BA175]
          Length = 1784

 Score =  392 bits (1008), Expect = e-106,   Method: Composition-based stats.
 Identities = 138/701 (19%), Positives = 275/701 (39%), Gaps = 68/701 (9%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNEL--V 140
              +L  A +   Q      D+  +   E  +     + R         +   +  ++  +
Sbjct: 610  LSILPTAFDGQRQVAASIRDMTQKLAVEQKIRDSEQRFRGLVTNIPGAVYRTRIGDVWFM 669

Query: 141  FASSTKNSHYIGKKIGEIIPELSRSRS-------RSKTVQMSEASLDQQPYHVLSVNLPH 193
               S   +   G    + I    R+ +       R       + +L QQ    +   + H
Sbjct: 670  EYISDNIAEITGYAASQFIENRQRTFASLILEEDRPTCHLHIDRALAQQETFEVEYRIRH 729

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GSI  ++ +      + EE     ++F                   ++K     L ++
Sbjct: 730  RDGSIRWVHEKG--KASYTEE--GIPLWFDGSID-----------DITESKLALVQLEQS 774

Query: 254  NICVETALSRGRCGLWN--FNFDNKK--FHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +        C ++   ++    +    LS +  +++G+  ++   +F  IA  I  +
Sbjct: 775  RQQMTNITESIPCTVYQLQWHSPTDRRFTFLSGAAMKMLGLHRDDLMSNFDIIAERIFDE 834

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A S   +   Q  + F  RH +G+  W++  A       G +   G  MD+T+
Sbjct: 835  ERPDVVRALSGQSEDRLQWIREFRYRHPNGSIRWMEAGASGHLGEEGAITWNGYVMDITQ 894

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       +  +  +V  D    ++ CN  +     L  + L    A  
Sbjct: 895  RKTIEQELALSEAHFKALFDGATIGIVNVDIKGVILDCNDQFCADMALSRNHLRN-TAIF 953

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
             +   Q +PI + +  +    +      + +         +    G  + +  +++ L  
Sbjct: 954  EVLSEQDQPIAKAQFQELVEGKIDHYRGERS---------FIRPSGAPLWMTVNVSALLD 1004

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
             Q Q   +   +                  TEL + + +  + KE+A+ A+K K +FLA 
Sbjct: 1005 AQGQFESAVISMVDM---------------TELKLLSDELLLAKEQADAASKAKGDFLAN 1049

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            MSHE+RTP+NAI+G S++  +    +    K   Y + I  + Q LL++IN+IL+ SKIE
Sbjct: 1050 MSHEIRTPMNAIIGMSQLCLQTELDK----KQKNYVEKIERASQSLLSIINDILDFSKIE 1105

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFP 667
              K+ ID     L  ++ +   +    A  K I++   +   +      D   + ++L  
Sbjct: 1106 AGKLDIDSVPFQLDTMLEDLSDMFSEKAAHKQIELLFAVAPNVPRYLLGDSLRLGQVLIN 1165

Query: 668  ILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
            +++N+IKFT   G++++  S + Q      +  ++ D+GIG+ +    K+ + F      
Sbjct: 1166 LMNNAIKFT-ERGEVLLSLSLVEQQDDDVVLRFSVRDSGIGLTEQQQAKLFKSFTQADTS 1224

Query: 723  YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
              +  GG GLGLAI   L  L GG++ + SQ G G+     
Sbjct: 1225 TTRKYGGTGLGLAICKQLVELMGGKIGVESQFGHGSTFYFT 1265



 Score =  131 bits (329), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 58/457 (12%), Positives = 132/457 (28%), Gaps = 49/457 (10%)

Query: 89  LTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNS 148
           L      +     +  D+      +             +   +L+      +  ++++  
Sbjct: 490 LMSDTGELMSVEMLFTDVTE----QFSAAVWSNAVLEAAPEAMLIVDELGQIVFTNSRCL 545

Query: 149 HYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL 208
              G + G ++  L       + +               +        S+        L 
Sbjct: 546 QLFGYETGAMLG-LQVEALLPQELGERHVLER------QTFLREGRDRSMANARHVRALK 598

Query: 209 RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE-------TAL 261
               E +    +     +      + +  R   +    +  + ++             A+
Sbjct: 599 ADGNEFIAEIALSILPTAFDGQRQVAASIRDMTQKLAVEQKIRDSEQRFRGLVTNIPGAV 658

Query: 262 SRGRCG-LWNFNFDNKKFHLSRSMYEIMGIPYENK-TLSFRAIARLIHYDNKKICEIARS 319
            R R G +W         ++S ++ EI G           R  A LI  +++  C +   
Sbjct: 659 YRTRIGDVWFME------YISDNIAEITGYAASQFIENRQRTFASLILEEDRPTCHLHID 712

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNII-GIAMDLTEKYHLEKRYA 378
                 +  +  + +RH  G+  W+  + +   T  G      G   D+TE      +  
Sbjct: 713 RALAQQETFEVEYRIRHRDGSIRWVHEKGKASYTEEGIPLWFDGSIDDITESKLALVQLE 772

Query: 379 EADQRLSKAIECT----SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA 434
           ++ Q+++   E       +       + R    +    K  GL    L   +   II   
Sbjct: 773 QSRQQMTNITESIPCTVYQLQWHSPTDRRFTFLSGAAMKMLGLHRDDL--MSNFDII--- 827

Query: 435 QTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
               I +    D  R+     E +L    W++   +   +G    +             L
Sbjct: 828 -AERIFDEERPDVVRALSGQSEDRLQ---WIREFRYRHPNGSIRWMEA------GASGHL 877

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQV 531
            E             T R+ +E+   EL+++ A ++ 
Sbjct: 878 GEEGAITWNGYVMDITQRKTIEQ---ELALSEAHFKA 911



 Score = 52.3 bits (124), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 45/399 (11%), Positives = 129/399 (32%), Gaps = 27/399 (6%)

Query: 61  VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL 120
           + IA + ++ +  +      +  +  L                  L   K   +    L 
Sbjct: 213 LGIAPNRLVVLDDQGRLIYHVDREKVLA-----------TTSTQWLDKNKYRNADFWALQ 261

Query: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
           AK       F+      ++V+ +S      +  ++  + PE     S    V     +L 
Sbjct: 262 AKGLDGQARFV---DDKDVVYLASIATVPQLKWRVIVLAPEQELFSSLLDDVASIILNLS 318

Query: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
                +L             +      +  + +  T +++      + ++ +  ++ + A
Sbjct: 319 LLTLLLLLTCYLAAKRLTRPLELLESGILSFGQGKTQQLIVPKGAVSEIVTLSNTFNQMA 378

Query: 241 KKNKENDTILLEAN-ICVETALSRGRCGLW--NFNFDNKKFHLSRSMYEIMGIPYENKTL 297
           +   E +  +L++        +       +  + + D +   +S  + +++GI  +    
Sbjct: 379 ELLAEREQAILDSRGNRFARLIDGMSDKSFYCSLDPDGQLAQVSEGVTKVLGISPDLLKR 438

Query: 298 SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG 357
            ++ +      + K        +  K          M    G    + V  Q + + +G 
Sbjct: 439 KYQRLFSANPLNEKNW--QYTDLALKGQNVPSHQVEMLDDQGHLRRLDVFMQPLMSDTGE 496

Query: 358 MNIIGI-AMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYG 416
           +  + +   D+TE++             +  +E   EA+++ D+  ++V  N+   + +G
Sbjct: 497 LMSVEMLFTDVTEQFSAA-------VWSNAVLEAAPEAMLIVDELGQIVFTNSRCLQLFG 549

Query: 417 LPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
                ++     +++        +  R +     +D S 
Sbjct: 550 YETGAMLGLQVEALLPQELGERHVLERQTFLREGRDRSM 588


>gi|90418499|ref|ZP_01226411.1| putative two-component signal transduction histidine kinase
            [Aurantimonas manganoxydans SI85-9A1]
 gi|90338171|gb|EAS51822.1| putative two-component signal transduction histidine kinase
            [Aurantimonas manganoxydans SI85-9A1]
          Length = 1302

 Score =  392 bits (1007), Expect = e-106,   Method: Composition-based stats.
 Identities = 113/740 (15%), Positives = 237/740 (32%), Gaps = 80/740 (10%)

Query: 32   RAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTE 91
            + +T        F        P + +V  + +       +   +A++E+    T  + T 
Sbjct: 485  QQWTVFWQSTPEFEEGVASNEPTLILVGGMLLTVL-FGALLYSHARREESIRNTVELKTH 543

Query: 92   AIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYI 151
            AI    + N    D A                        ++      + + +       
Sbjct: 544  AIAARERENRAIVDTAVVG--------------------FIVLDCAGHILSVNRAVEAIF 583

Query: 152  GKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLW 211
            G    EI      +      +              +    P +   ++I         L+
Sbjct: 584  GHTADEIRNRHVETILSYDAITAV------TLATAVGEGEPASDSPVVIRTRSKAGKPLY 637

Query: 212  REEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNF 271
             +    +    S      L I     R     +     L         AL     G+++ 
Sbjct: 638  LDVQRNDWSTESGDLRHTLII-----RDVTAQRLAVEALEANERRWNHALEGAGIGVFDI 692

Query: 272  NFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQL--D 329
            +F   +  +S +  +++G    +           IH ++      A             +
Sbjct: 693  DFRRGQSFVSDTWKQMLGFSPSDDIEPRAEWLARIHPEDLPAL-KAVEDAYYDTATFRSE 751

Query: 330  QIFHMRHASGADIWIQVRAQMMRTI--SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
              + +R      IW++  + ++        M +IG   ++TE    E     +++R+  A
Sbjct: 752  AEYRIRRKDNVWIWLRSDSIVIERDKAGQPMRVIGTQSEITELKTAEAALRSSEERVRLA 811

Query: 388  IECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDP 447
            +      + + D N   +  N       G  +  L+     + +       I   + +  
Sbjct: 812  LRDAPVGMAMLDLNGGWIRVNQALCAFLGYSEDELL-QRDLAAVTHPDDVGIDREQMAQM 870

Query: 448  ERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIND 507
                  + ++   + R+L        DG  +     ++L+  +  Q              
Sbjct: 871  IAQTLPTYQV---EKRFLH------RDGRALWCLFSVSLVHDHDGQAY------------ 909

Query: 508  LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
                        + +   N +        +  ++ K+EF+A +SHELRTPL +I G   +
Sbjct: 910  ----------LVSHVQDINDR--------KEMDRLKNEFVATVSHELRTPLTSIRGSLGL 951

Query: 568  IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
            I + +  +               + + L+ +IN+IL++ KI    ++ +    D    ++
Sbjct: 952  I-QGVMAKDVPPAATRLLTIAVANCERLVALINDILDLEKITAGMMAFETVLVDPNAAVS 1010

Query: 628  EGIRLIGSSAQSKNIKIEKKIPS--ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR 685
            + I           + +        E +   D    +++L  +LSN+ KF+   G + + 
Sbjct: 1011 QAIEANQPYFARFGVSVAFNATGKGEAWIPVDPARFQQVLANLLSNAAKFSPQGGIIDVA 1070

Query: 686  TSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               I   + I++ D G GIP     +I   F    +   +  GG GLGL I+  +    G
Sbjct: 1071 IEPIDGAIRISVTDHGTGIPAEFQSRIFDRFTQADSSATREKGGTGLGLHITRQIIETMG 1130

Query: 746  GRLKIISQEGKGTIVTICMP 765
            G +   +  G G    I MP
Sbjct: 1131 GTIDFANVPGAGARFWIDMP 1150


>gi|298248980|ref|ZP_06972784.1| PAS/PAC sensor signal transduction histidine kinase [Ktedonobacter
           racemifer DSM 44963]
 gi|297546984|gb|EFH80851.1| PAS/PAC sensor signal transduction histidine kinase [Ktedonobacter
           racemifer DSM 44963]
          Length = 981

 Score =  392 bits (1007), Expect = e-106,   Method: Composition-based stats.
 Identities = 114/668 (17%), Positives = 242/668 (36%), Gaps = 60/668 (8%)

Query: 104 FDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
            D+  QK+AE  L +     R L+E+    +   +P+      + +   Y       +  
Sbjct: 365 TDIEKQKRAEQQLKESEENLRVLAETVPQLVWTTRPDGRFDYCNQRYCEYTHAAFEHLQG 424

Query: 161 ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
              R     +  +       Q         +            R      +R  +   + 
Sbjct: 425 YGWRQFMHPEDAERVVVLRQQTLQTGEPYEIE--------YRLRNSQTGTYRWFLARAMP 476

Query: 221 FFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHL 280
                  ++    F       + K+ +  + E+              +W    D +  ++
Sbjct: 477 VRDDTGQII--KWFGTCTDIDEQKQAEQKIKESEENWRVLAETVPQLVWTTRSDGQHEYV 534

Query: 281 SRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS-G 339
           ++   +  G+  E+      A    IH D+++          +     +    +R++  G
Sbjct: 535 NQRWCDYTGVTVEHMQSDRWAPLPFIHPDDREGTRTLWQHALETGAMYEHEERLRNSQTG 594

Query: 340 ADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
              W   R   +R  +G +    G   D+ E+  +E+   ++ +R S  +  +   + + 
Sbjct: 595 EYRWFLTRGAPVRDDTGQIVKWFGTVTDIDEQKRMEEALRQSQERASVLMNSSIIGIFVA 654

Query: 399 DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK 458
            +++R+V  N  + +  G     L       +     T P    RT    +      E  
Sbjct: 655 -EDERVVDANDAFLRMTGYTLEDLRERR---MSWRHMTPPEYMARTLQAHQ------EFA 704

Query: 459 LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
           L  S      E+   DG  + V     +L+H+  Q                ++R+ LE++
Sbjct: 705 LHQSIIPYEKEYVCKDGSRLPVLVGAVVLQHHPFQAIAFVLDN--------SARKELEQR 756

Query: 519 KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
                                   K +F++  SHELR PL A+   +++++K        
Sbjct: 757 ------------------------KDDFISMASHELRNPLAAVKMQTQLVQKR-LERQSH 791

Query: 579 VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
            +       +  S + L  +I  +L++SKI+  ++   ++  DL  +++E    +     
Sbjct: 792 HEAATALSRVEGSVKQLERLIGELLDVSKIQAGRLEYQQEMVDLDALLHEVADTMQQIHT 851

Query: 639 SKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIA 698
           +    I  +  +      DK  + ++   ++SN+IK++     + +  S   + V I + 
Sbjct: 852 TH--TIVVRGTAPCSLVGDKDRLGQVFTNLISNAIKYSPGAETVEMDLSTSAETVTIRVR 909

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           D G+GIP+   +KI   F  + +   ++I G G+GL I   +   HGG + + SQ G G+
Sbjct: 910 DHGLGIPREQRDKIFDRFYRVTDPKQRAIPGLGMGLYIVAEIVKSHGGTITVESQVGTGS 969

Query: 759 IVTICMPQ 766
             T+ +P+
Sbjct: 970 TFTVTLPK 977



 Score =  154 bits (389), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 50/413 (12%), Positives = 118/413 (28%), Gaps = 32/413 (7%)

Query: 104 FDLASQKKAESMLGQLLAKTRFLSESF---ILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
            ++ +    +  + Q         +     I++  P  +V   +         +  E+I 
Sbjct: 116 HEMGAPAPRQETVPQSEHLYLNGLDGLYSGIVVLTPEGIVLGINEVPLADAQIRREEVIG 175

Query: 161 ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
           +             S+  L        ++       ++       P   + R        
Sbjct: 176 QPLAQTRWWSCSPPSQEQLR------AAIARASMGETVCFETVVHPREGMDRHLEVTITP 229

Query: 221 FFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHL 280
              +   +   +L          K  +  +          +      +W    D  +   
Sbjct: 230 HMDVEHHIEYLVLAG--IDITARKRAEAEIHA-------LIDAIPQLVWTGQPDGYRDSY 280

Query: 281 SRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRH-ASG 339
           ++   +  G+  E          + +H ++++          +     +    +R   +G
Sbjct: 281 NQRWRDYTGLSTEEAQG--EGWVQCLHPEDRQRVLSMWQRAVQTGGVYETELRLRQGTTG 338

Query: 340 ADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
           A  W   RA  +R   G +    G + D+ ++   E++  E+++ L    E   + +   
Sbjct: 339 AYRWFLARAMPVRDEGGQIIKWFGTSTDIEKQKRAEQQLKESEENLRVLAETVPQLVWTT 398

Query: 399 DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK 458
             + R   CN  Y +        L     R  +       ++  R    +  +    E +
Sbjct: 399 RPDGRFDYCNQRYCEYTHAAFEHLQGYGWRQFMHPEDAERVVVLRQQTLQTGEPYEIEYR 458

Query: 459 LADS-----RWLQINEWCTHDGG-----TISVGTDITLLKHNQAQLRESKRRL 501
           L +S     RW         D            TDI   K  + +++ES+   
Sbjct: 459 LRNSQTGTYRWFLARAMPVRDDTGQIIKWFGTCTDIDEQKQAEQKIKESEENW 511



 Score = 71.6 bits (174), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 35/398 (8%), Positives = 98/398 (24%), Gaps = 38/398 (9%)

Query: 110 KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRS 169
           K+      + L          + +      +  ++      +G    E+  +        
Sbjct: 8   KRLTPASSETLLTLLETLPGALFVVDDAATIVYANASAQSILGATREEVCAQPLW----- 62

Query: 170 KTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALL 229
           +      ++   Q           +      +    P+ + W             +S+ +
Sbjct: 63  RCAPQLVSTSLYQAVQKTKRTRAPSE-----VEYFSPVTQTW---------LHVQLSSTV 108

Query: 230 LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMG 289
             +L  ++         +T + ++       L     G+     +     ++        
Sbjct: 109 GGLLLQFHEMGAPAPRQET-VPQSEHLYLNGLDGLYSGIVVLTPEGIVLGINEVPLADAQ 167

Query: 290 IPYEN---KTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           I  E    + L+            +++       +       + + H R   G D  ++V
Sbjct: 168 IRREEVIGQPLAQTRWWSCSPPSQEQLRAAIARASMGETVCFETVVHPR--EGMDRHLEV 225

Query: 347 RAQMMRT-ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLV 405
                         ++   +D+T +   E             I+   + +     +    
Sbjct: 226 TITPHMDVEHHIEYLVLAGIDITARKRAEAEIH-------ALIDAIPQLVWTGQPDGYRD 278

Query: 406 MCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADS--- 462
             N  ++   GL             +     + ++       +       E++L      
Sbjct: 279 SYNQRWRDYTGLSTEEAQGEGWVQCLHPEDRQRVLSMWQRAVQTGGVYETELRLRQGTTG 338

Query: 463 --RWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESK 498
             RW         D G   +    T     + +  E +
Sbjct: 339 AYRWFLARAMPVRDEGGQIIKWFGTSTDIEKQKRAEQQ 376


>gi|217972048|ref|YP_002356799.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS223]
 gi|217497183|gb|ACK45376.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS223]
          Length = 1792

 Score =  392 bits (1007), Expect = e-106,   Method: Composition-based stats.
 Identities = 138/701 (19%), Positives = 275/701 (39%), Gaps = 68/701 (9%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNEL--V 140
              +L  A +   Q      D+  +   E  +     + R         +   +  ++  +
Sbjct: 610  LSILPTAFDGQRQVAASIRDMTQKLAVEQKIRDSEQRFRGLVTNIPGAVYRTRIGDVWFM 669

Query: 141  FASSTKNSHYIGKKIGEIIPELSRSRS-------RSKTVQMSEASLDQQPYHVLSVNLPH 193
               S   +   G    + I    R+ +       R       + +L QQ    +   + H
Sbjct: 670  EYISDNIAEITGYAASQFIENRQRTFASLILEEDRPTCHLHIDRALAQQETFEVEYRIRH 729

Query: 194  NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
              GSI  ++ +      + EE     ++F                   ++K     L ++
Sbjct: 730  RDGSIRWVHEKG--KASYTEE--GIPLWFDGSID-----------DITESKLALVQLEQS 774

Query: 254  NICVETALSRGRCGLWN--FNFDNKK--FHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
               +        C ++   ++    +    LS +  +++G+  ++   +F  IA  I  +
Sbjct: 775  RQQMTNITESIPCTVYQLQWHSPTDRRFTFLSGAAMKMLGLHRDDLMSNFDIIAERIFDE 834

Query: 310  NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
             +     A S   +   Q  + F  RH +G+  W++  A       G +   G  MD+T+
Sbjct: 835  ERPDVVRALSGKSEDRLQWIREFRYRHPNGSICWMEAGASGHLGEEGALTWNGYVMDITQ 894

Query: 370  KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
            +  +E+  A ++       +  +  +V  D    ++ CN  +     L  + L    A  
Sbjct: 895  RKTIEQELALSEAHFKALFDGATIGIVNVDIKGVILDCNDQFCADMALSRNHLRN-TAIF 953

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
             +   Q +PI + +  +    +      + +         +    G  + +  +++ L  
Sbjct: 954  EVLSEQDQPIAKAQFQELVEGKIDHYRGERS---------FIRPSGAPLWMTVNVSALLD 1004

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
             Q Q   +   +                  TEL + + +  + KE+A+ A+K K +FLA 
Sbjct: 1005 AQGQFESAVISMVDM---------------TELKLLSDELLLAKEQADAASKAKGDFLAN 1049

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            MSHE+RTP+NAI+G S++  +    +    K   Y + I  + Q LL++IN+IL+ SKIE
Sbjct: 1050 MSHEIRTPMNAIIGMSQLCLQTELDK----KQKNYVEKIERASQSLLSIINDILDFSKIE 1105

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFP 667
              K+ ID     L  ++ +   +    A  K I++   +   +      D   + ++L  
Sbjct: 1106 AGKLDIDSVPFQLDTMLEDLSDMFSEKAAHKQIELLFAVAPNVPRYLLGDSLRLGQVLIN 1165

Query: 668  ILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
            +++N+IKFT   G++++  S + Q      +  ++ D+GIG+ +    K+ + F      
Sbjct: 1166 LMNNAIKFT-ERGEVLLSLSLVEQQDDDVVLRFSVRDSGIGLTEQQQAKLFKSFTQADTS 1224

Query: 723  YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
              +  GG GLGLAI   L  L GG++ + SQ G G+     
Sbjct: 1225 TTRKYGGTGLGLAICKQLVELMGGKIGVESQLGHGSTFYFT 1265



 Score =  130 bits (326), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/367 (11%), Positives = 103/367 (28%), Gaps = 31/367 (8%)

Query: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
                 +   +L+      +  ++++     G + G ++  L       + +        
Sbjct: 518 NAVLEAAPEAMLIVDELGQIVFTNSRCLQLFGYETGAMLG-LQVEALLPQELGERHVLER 576

Query: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
                  +        S+        L     E +    +     +      + +  R  
Sbjct: 577 ------QTFLREGRDRSMANARHVRALKADGNEFIAEIALSILPTAFDGQRQVAASIRDM 630

Query: 241 KKNKENDTILLEANICVE-------TALSRGRCG-LWNFNFDNKKFHLSRSMYEIMGIPY 292
            +    +  + ++             A+ R R G +W         ++S ++ EI G   
Sbjct: 631 TQKLAVEQKIRDSEQRFRGLVTNIPGAVYRTRIGDVWFME------YISDNIAEITGYAA 684

Query: 293 ENK-TLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM 351
                   R  A LI  +++  C +         +  +  + +RH  G+  W+  + +  
Sbjct: 685 SQFIENRQRTFASLILEEDRPTCHLHIDRALAQQETFEVEYRIRHRDGSIRWVHEKGKAS 744

Query: 352 RTISGGMNII-GIAMDLTEKYHLEKRYAEADQRLSKAIECT----SEALVLWDKNDRLVM 406
            T  G      G   D+TE      +  ++ Q+++   E       +       + R   
Sbjct: 745 YTEEGIPLWFDGSIDDITESKLALVQLEQSRQQMTNITESIPCTVYQLQWHSPTDRRFTF 804

Query: 407 CNANYQKAYGLPDHVLVPGNAR--SIIQDAQTRPIIEYR--TSDPERSQDMSKEIKLADS 462
            +    K  GL    L+         I D +   ++      S+           +  + 
Sbjct: 805 LSGAAMKMLGLHRDDLMSNFDIIAERIFDEERPDVVRALSGKSEDRLQWIREFRYRHPNG 864

Query: 463 RWLQINE 469
               +  
Sbjct: 865 SICWMEA 871



 Score = 50.4 bits (119), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/213 (12%), Positives = 73/213 (34%), Gaps = 13/213 (6%)

Query: 247 DTILLEAN-ICVETALSRGRCGLW--NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIA 303
           +  +L++        +       +  + + D +   +S  + +++GI  +     ++ + 
Sbjct: 385 EQAILDSRGNRFARLIDGMSDKSFYCSLDPDGQLAQVSEGVTKVLGISPDLLKRKYQRLF 444

Query: 304 RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQM-MRTISGGMNIIG 362
                + K        +  K          M    G    + V  Q  M   +  M++  
Sbjct: 445 SANPLNEKNW--QYTDLALKGQNVPSHQVEMLDDQGHLRRLDVFMQPLMSDTNELMSVEM 502

Query: 363 IAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVL 422
           +  D+TE++             +  +E   EA+++ D+  ++V  N+   + +G     +
Sbjct: 503 LFTDVTEQFSAA-------VWSNAVLEAAPEAMLIVDELGQIVFTNSRCLQLFGYETGAM 555

Query: 423 VPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           +     +++        +  R +     +D S 
Sbjct: 556 LGLQVEALLPQELGERHVLERQTFLREGRDRSM 588


>gi|46201520|ref|ZP_00054895.2| COG0642: Signal transduction histidine kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 1099

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 137/715 (19%), Positives = 262/715 (36%), Gaps = 74/715 (10%)

Query: 67  SIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFL 126
           +++++ +   ++     + S      +E   +  N +    S+++A++ L  +L      
Sbjct: 31  TLLRLISDSYEEHDKERRLSDRSARLMEEELRAANQE----SRRQAKAHLQAILNTV--- 83

Query: 127 SESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHV 186
               I++A     V + +       G +  E+I                          +
Sbjct: 84  -GEGIVIADQTGTVVSVNPALLSIFGYERDEVIGNNIDMLIP-----------------L 125

Query: 187 LSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFI-LFSYYRQAKKNKE 245
            ++    +SG   I +     + L R   +  +   +               R   + K 
Sbjct: 126 AALKAAGSSGMERIFDLGRESMALRRGGTSFPIELAAGDLTPTGSAQFVVIMRDISERKR 185

Query: 246 NDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIM-GIPYENKTLSFRAIAR 304
            +  + E+               W    D +    S    E    +P      +   +  
Sbjct: 186 IEREMAESEERFRDFAQSTSDWFWEMGPDLRFTGFSGQFTEHTRALPSHYVGHTRDEMIS 245

Query: 305 LIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMN-IIGI 363
                  ++  +A     +  +  D ++H ++  G   +++V  + +   SG      G 
Sbjct: 246 DDTPMEARLQNLADMEARRPFR--DFVYHTKNMDGPGRFLRVNGKPVFDPSGEFKGYRGT 303

Query: 364 AMDLTEKYHLEKRYAEADQRLS-------KAIECTSEALVLWDKNDRLVMCNANYQKAYG 416
           A D+TE+     R   +   +          +E   + +V  D N R    N    K   
Sbjct: 304 ASDITEEIEAADRLKASQAEIERLAERNNSILESVDDGIVGIDLNGRATFVNRAAAKLLD 363

Query: 417 LPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGG 476
                LV  +   ++                         ++LADS       +   DG 
Sbjct: 364 FEPAELVGSDILPLM-----------ALDMETAESLYQILLRLADSIRDDTASFKRRDGS 412

Query: 477 TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERA 536
            + V    + +     Q+                      R  T+  +   + +  KE A
Sbjct: 413 PLPVEYIASPVMDKGNQVGVVLGF----------------RDITQRRLVERQLREAKEAA 456

Query: 537 ETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLL 596
           E  N+TKSEFLA MSHE+RTP+N ++G + ++         + +   +A+ I  SG+ LL
Sbjct: 457 EAGNRTKSEFLATMSHEIRTPMNGVIGMTGLLLDTKL----TEEQRHFAETIRDSGESLL 512

Query: 597 NMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--F 654
            +IN+IL+ SK+E  K+ +D    +L+P++   + ++   A +K I+I   I   L    
Sbjct: 513 TVINDILDFSKMEAGKLDLDYTEFELVPLVESVVDILAPRAHAKGIEIASLIDPRLRMLV 572

Query: 655 NADKRIIKKILFPILSNSIKFTNNNG-KMMIRTSKIGQ---CVIITIADTGIGIPKSALE 710
            +D   ++++L  +  N++KFT   G  + +   +       V   + DTGIGIP  A  
Sbjct: 573 RSDPGRLRQVLMNLGGNAVKFTEKGGVSIEVTLLERPGAQPMVHFDVRDTGIGIPPEAQG 632

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           ++   F  +     +  GG GLGLAI   L  L GG + + SQ GKG+   + +P
Sbjct: 633 RLFSMFMQVDASTARRYGGTGLGLAICRRLAELMGGEVGLESQPGKGSRFWMSVP 687


>gi|296283542|ref|ZP_06861540.1| multi-sensor hybrid histidine kinase [Citromicrobium bathyomarinum
            JL354]
          Length = 1446

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 132/683 (19%), Positives = 257/683 (37%), Gaps = 54/683 (7%)

Query: 95   IIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSE---SFILLAQPNELVFASSTKNSHYI 151
              +    +K      ++  + L +   +   L+    + I            +       
Sbjct: 523  EAYIGRLVKQRTRELEETVAALEESERRFGDLAGLSPAGIFRTDAYGFCTYVNEAWLKQT 582

Query: 152  GKKIGEIIPELSRSRSRSK-TVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRL 210
            G      +               +    LD                   +++        
Sbjct: 583  GLGASHALGAGWLDAVHPDLRDDVKREWLDAVQAGTEWRCKLQFLKPDDVVS-------- 634

Query: 211  WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
            W + +    +                     + K     L E+    ++  S    G++ 
Sbjct: 635  WVDLIAAPRIGDDGEMQ----GFIGVAIDITEQKLATDALKESERRFQSLASFSPAGIFR 690

Query: 271  FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ 330
             +      +++ +  ++ G+       +    +R +HYD+        +      +    
Sbjct: 691  TDSAGVCNYVNPAWCQMAGLTEAEAMGTG--WSRAVHYDDLDGLLQRWAAAVDRGEPYRG 748

Query: 331  IFHMRHASGADIWIQVRAQMMRTISGGMN-IIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
             F   H  G+ +W+   AQ      G +   IG+ +D+T++   EK  AE D++L+   E
Sbjct: 749  EFRWLHLDGSIVWVDAVAQPEFDDDGNVRGYIGVVIDVTDRKRFEKEIAERDKQLAILAE 808

Query: 390  CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
              ++A+   + +   +  + + +   G+P   L+  NA           +          
Sbjct: 809  NATDAVFRVELDGTCLYASPSAKDVLGVPSEHLIGTNALDGFHPDDQDRMWSLFDDLRSG 868

Query: 450  SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
                                  T D     +  +  L+K  Q+                 
Sbjct: 869  RIKQ---------IVAAYRWRSTKDDDYRWLEANAGLVKDQQSDEA---------KEVSV 910

Query: 510  TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
            + R I +R+K EL          ++ AETA   K+ FLA MSHE+RTP+N ++GF+E++ 
Sbjct: 911  SIRDIGDRKKMEL-----DLVAARQNAETAAAAKATFLANMSHEIRTPMNGVVGFTELLL 965

Query: 570  KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
                      +  E AQ I  SG+ ++ ++N+IL++SKI+  +++I ++  DL   +   
Sbjct: 966  AGELSP----EQRENAQLIADSGRAMMQILNDILDVSKIDAGQMTIVREPIDLRHKLQSC 1021

Query: 630  IRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
            +RL+  +A+ K +K E  I  ++     AD   +++IL  ++ N+IKFT   G +  R S
Sbjct: 1022 MRLLEPTARQKGLKFELLIDEDVPSRVMADPLRLRQILTNLVGNAIKFT-AKGIVNCRVS 1080

Query: 688  -----KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
                 +  + + I + D+GIGIP   L+ I + F        +  GG GLGL IS+ L  
Sbjct: 1081 IERGPEDQETLCIAVEDSGIGIPADRLDAIFREFSQADESTARIYGGTGLGLTISNELAK 1140

Query: 743  LHGGRLKIISQEGKGTIVTICMP 765
            +  G L + S+ G G++ T+ +P
Sbjct: 1141 MMDGELLVSSELGHGSVFTLRLP 1163


>gi|21242798|ref|NP_642380.1| two-component system sensor protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21108282|gb|AAM36916.1| two-component system sensor protein [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 1127

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 137/716 (19%), Positives = 252/716 (35%), Gaps = 53/716 (7%)

Query: 83  NQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLS---ESFILLAQPNEL 139
                 L+  IE++       ++   + KA+  L    A+ R L+      I +A P+  
Sbjct: 274 RAPRRWLSAEIELVRLVVARCWESMQRAKAQQQLAANEARLRRLANTLPQIIFIADPDGR 333

Query: 140 VFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSIL 199
               + +   Y G     + P  +   +  +        L +  + +             
Sbjct: 334 PHYFNQRWYEYTG-----LDPSNNEDAAWHRAHTADGLRLSEHAWSLALKGQRALEVECE 388

Query: 200 IINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVET 259
           ++         W     L V          +      Y      +  +  L E+ +    
Sbjct: 389 LLRHDGQ--SRWHLVRALPVRGDDGS----ISEWIGTYTDIHDRRAFEQQLRESEVRFRA 442

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
                   +W  +      + +   Y   G          +    ++H D+      A  
Sbjct: 443 LCETVPAMIWMADAQGDCVYWNPRWYNFTG--QGEDQALDQGWWDVMHPDDAARVRHAFE 500

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYA 378
              +   +    + +R   G   W    A       G     IG   D++E+ H+E   A
Sbjct: 501 QALEQRGEFLAEYRVRRHDGQYRWCIDTASPHFASDGRFLGHIGSLTDISERKHIEDATA 560

Query: 379 EADQRLSKAIECTSEALVL------WDKNDRLVMCNANYQKA------------------ 414
                LS         +VL       +    + +  +   +                   
Sbjct: 561 SDRAILSLITTGAPLPVVLDAIALSVEARGEIPLYCSVMVRDEVRHTLSFGSAPHFPIEY 620

Query: 415 --YGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCT 472
             +  P  +   G   ++      + I     +D   S   +    +             
Sbjct: 621 RGHFEPSPIGPEGPPCALSAHLGRQVICSDIQADASFSAHHAISAAM--GIAACCVTPIL 678

Query: 473 HDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE 532
              G +    +I   + +   LRE      A+        +     K +LS+        
Sbjct: 679 ASNGQVLGTLNIYYDRPHLPSLREQAMARSASHLAGIVIERTRVDAKLKLSLQAET--AA 736

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           + +AE AN+ K EFLA +SHELRTPLNAILG+S +++ +I               I  S 
Sbjct: 737 RAQAEHANRVKDEFLATLSHELRTPLNAILGWSRLMQSDIADPAN---LGRGLVIIERSA 793

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK--IPS 650
           +    +I+++L+MS I + KI +  ++ D+  ++   + L+  +A ++ I +E       
Sbjct: 794 RAQTQIIDDLLDMSAILSGKIRLQAEHFDIAGLVRSVLELMQPAALTRKIALELDAPCDG 853

Query: 651 ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALE 710
           EL+F  D   ++++L  +LSN++KFT   G + +      + + + + DTGIGI    L 
Sbjct: 854 ELWFFGDAGRLQQVLTNLLSNALKFTPAGGTVRVTMDVEDERLRLCVQDTGIGIAADFLP 913

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ-EGKGTIVTICMP 765
            +   F        + +GG GLGL+IS  L +LHGG L   S  EG+G + TI +P
Sbjct: 914 HVFDRFRQADAGTTRRVGGLGLGLSISRQLVDLHGGSLGASSAGEGQGALFTIVLP 969


>gi|78222916|ref|YP_384663.1| PAS/PAC sensor hybrid histidine kinase [Geobacter metallireducens
            GS-15]
 gi|78194171|gb|ABB31938.1| PAS/PAC sensor hybrid histidine kinase [Geobacter metallireducens
            GS-15]
          Length = 1313

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 119/610 (19%), Positives = 234/610 (38%), Gaps = 41/610 (6%)

Query: 166  RSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSII 225
            R  +    + + +            +      +          RL    +      FS +
Sbjct: 473  RLLAPFAMLGKVTSQLPVRIAQGEQISWRPAEVREEQELQDNFRLMENAL---QNSFSEL 529

Query: 226  SALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMY 285
            +A+   +      +  + +        + + + +  +     +   +      + + +  
Sbjct: 530  TAINEELEHRVTERTAELRIAKEAAENSELQLRSITNSAHDAILMMDHQGSISYWNPAAE 589

Query: 286  EIMGIPYENKTL-SFRAIA--RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADI 342
            +I+G         +   +        D+       +     +          R   G +I
Sbjct: 590  QILGYSAAEALGKNLHDLLTPERYLADHLTAFSEFQQTGSGNAVGKTLELFARRKDGQEI 649

Query: 343  WIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
             + +    +  ++G  N +G+  D+TE+  +          LS A+E +  ++++ D++ 
Sbjct: 650  EVALSLSAVF-LNGAWNAVGLLRDITEQKRINASLR----MLSAAVEHSPVSIIITDRDG 704

Query: 403  RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADS 462
            R+   N    +  G     L   N R           I    + P        E  L+  
Sbjct: 705  RIEYVNPKSCQMTGYAFEELRGQNPR-----------IMKGPTHPPEFYKNLWETILSGR 753

Query: 463  RWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTEL 522
             W         DG  + V   I+ +           +        +    +  ++ + EL
Sbjct: 754  EWYGEFHNRRKDGSLVWVMASISPIYDE--------KGEITHFVGVREEIEKQKKLQEEL 805

Query: 523  SIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYY 582
            +      +V ++RAE AN+ KSEFLA MSHE+RTPLNAI+G S+++ +         +  
Sbjct: 806  ANIAQLEKVARDRAEQANRAKSEFLAGMSHEIRTPLNAIIGMSDLLAETRLDG----EQS 861

Query: 583  EYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNI 642
             Y   +H +G+ L  +IN+IL++SKIE   + +D     L   I +   +    A SK +
Sbjct: 862  GYLSVVHSAGETLQGLINDILDLSKIEAGMLQLDSVPFSLRDCIRQLTDITSVKASSKGV 921

Query: 643  KIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-----VII 695
                 + S +      D   ++++L  ++ N++KFT++ G +++    + Q      +  
Sbjct: 922  TYSFSVKSAVPDWLMGDSLRLRQVLINLVGNAVKFTDSGGSVLLEVEPVQQSDAEVLIRF 981

Query: 696  TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
            ++ADTGIGI    L+ I + F    +   +  GG GLGLAIS  L  + GG + + S  G
Sbjct: 982  SVADTGIGIAPEKLDTIFESFSQADSSTTRRYGGTGLGLAISRHLAGMMGGEIGVESTVG 1041

Query: 756  KGTIVTICMP 765
            KG+     +P
Sbjct: 1042 KGSCFRFTVP 1051



 Score =  104 bits (260), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/309 (10%), Positives = 90/309 (29%), Gaps = 29/309 (9%)

Query: 97  FQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNELVFASSTKNSHYIGK 153
              + +    A  + A+        + R     +   IL+      +   +      +G 
Sbjct: 535 ELEHRVTERTAELRIAKEAAENSELQLRSITNSAHDAILMMDHQGSISYWNPAAEQILGY 594

Query: 154 KIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWRE 213
              E + +        +        L              +  ++             R 
Sbjct: 595 SAAEALGKNLHDLLTPERY------LADHLTAFSEFQQTGSGNAVGKTLELFA-----RR 643

Query: 214 EVTLEVVFFSIISALLLFILF---SYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
           +   E+     +SA+ L   +      R   + K  +  L      +  A+      +  
Sbjct: 644 KDGQEIEVALSLSAVFLNGAWNAVGLLRDITEQKRINASLRM----LSAAVEHSPVSIII 699

Query: 271 FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL-IHYDNKKICEIARSVTGKHVKQLD 329
            + D +  +++    ++ G  +E        I +   H    +  +          ++  
Sbjct: 700 TDRDGRIEYVNPKSCQMTGYAFEELRGQNPRIMKGPTHP--PEFYKNLWETIL-SGREWY 756

Query: 330 QIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRY---AEADQRLS 385
             FH R   G+ +W+      +    G + + +G+  ++ ++  L++     A+ ++   
Sbjct: 757 GEFHNRRKDGSLVWVMASISPIYDEKGEITHFVGVREEIEKQKKLQEELANIAQLEKVAR 816

Query: 386 KAIECTSEA 394
              E  + A
Sbjct: 817 DRAEQANRA 825


>gi|86142612|ref|ZP_01061051.1| PAS domain protein [Leeuwenhoekiella blandensis MED217]
 gi|85830644|gb|EAQ49102.1| PAS domain protein [Leeuwenhoekiella blandensis MED217]
          Length = 1175

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 134/677 (19%), Positives = 264/677 (38%), Gaps = 62/677 (9%)

Query: 104 FDLASQKKAE---SMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
            D+  +K A+   ++  +   K    S   I+L   +  +  ++  +    G +  ++  
Sbjct: 255 QDINERKIAQLDYNVTKERFEKIVQNSAIGIILVHVDGHLLLANPASLKIFGFQEEQLNE 314

Query: 161 ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVV 220
            L  +          E +++ +   +         G+I          R+ R E+   + 
Sbjct: 315 ALKLTFRNFIHPDFLEEAINYRAQLIA--------GAIDSYQMEAKFYRIDRVEIWCRLS 366

Query: 221 FFSIISALLLFI-LFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
              +     +   + S      + K  +    E      TA      G+   + +     
Sbjct: 367 VSLVKGEDGIKDRIISQVEDITERKHLEFKAKEHAKRFTTAFEYSPNGMGMVSIEGDWLM 426

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKI-CEIARSVTGKHVKQLDQIFHMRHAS 338
           +++++  I G   E       +   L H D+ K   +  +++    +          H S
Sbjct: 427 VNQNLASIFGYKKEEFINKRSS--ELTHPDDLKKDSKQLKALINLEIDTYSIEKRFVHRS 484

Query: 339 GADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT-SEALV 396
           G  I   +   ++    G    +IG   DL+++   E+   ++     + +  T   +++
Sbjct: 485 GKIIHGLLNVSVVTDEQGTPLYLIGQISDLSKRVKAEQALQKSLTEFQQLMNATTKVSIM 544

Query: 397 LWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKE 456
             + +  +   N   +   G     +V     S               ++ E  +  +  
Sbjct: 545 ETNLDGIIQKFNRGAENLLGYTAEEVVGRMNVSSFH------------TEEEFIEREADH 592

Query: 457 IKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
            K  D+ W     +   DG T  V   IT + +    +                      
Sbjct: 593 QKFYDAEW----TYKRKDGSTFPVKLVITPVHNETGDVFGYLGVAI-------------- 634

Query: 517 RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGEL 576
              + L          +++AE AN++KSEFLA MSHE+RTPLN I+GF++++ +      
Sbjct: 635 -DISNLKEMEYSLVEARKKAEAANRSKSEFLANMSHEIRTPLNGIIGFTDLLMQTSLAPF 693

Query: 577 GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSS 636
                 +Y Q +H S   L+++IN+IL+ SKIE  K+ ++++  DLI +  + + ++   
Sbjct: 694 ----QQKYMQTVHNSANTLMDLINDILDFSKIEAGKLELNEERTDLIELCTQTVDIVKHQ 749

Query: 637 AQSKNIKIEKKIPSEL--FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT-------S 687
           A  K +++  +I  ++  F  AD   +++IL  +L N++KFT+  G++ +          
Sbjct: 750 AHQKGLEMLLQISPDVKRFVQADSIRLRQILINLLGNAVKFTDQ-GEVALTVTASNTIAQ 808

Query: 688 KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
           +        I DTGIGI    + KI   F+       +  GG GLGL IS+ L NL G +
Sbjct: 809 ENEAEFKFEIRDTGIGIDPKNINKIFNAFDQEDVSTTRKYGGSGLGLTISNRLLNLMGSK 868

Query: 748 LKIISQEGKGTIVTICM 764
           LK+ S +G G+     +
Sbjct: 869 LKVNSVQGTGSTFYFDL 885



 Score =  117 bits (294), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 59/421 (14%), Positives = 131/421 (31%), Gaps = 44/421 (10%)

Query: 203 SRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILL------EANIC 256
              PL + +  +    ++    +  + +        Q ++ ++    L       + +  
Sbjct: 87  PETPLQKTFTCKTGNAILVNIFLQEVTINDQPGLLYQIQRYEQKSESLQVLDGFSDISKL 146

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
              A    R G W  +  N K   +R   +I  +P + +      I       ++     
Sbjct: 147 FNEASELARVGGWEVDLVNNKVSWTRVTKKIHEVPDDYEPTLEEGINYYKEGQSRDTISE 206

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
                 +     D    +  A   +IW++   +        + + G   D+ E+   +  
Sbjct: 207 LVQKAIQFGTPWDAELQLVTAKNREIWVRALGKAEFKEGVCVRLYGAFQDINERKIAQLD 266

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH---VLVPGNARSIIQD 433
           Y    +R  K ++ ++  ++L   +  L++ N    K +G  +      +    R+ I  
Sbjct: 267 YNVTKERFEKIVQNSAIGIILVHVDGHLLLANPASLKIFGFQEEQLNEALKLTFRNFIHP 326

Query: 434 AQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
                 I YR      + D           +    ++   D   I     ++L+K     
Sbjct: 327 DFLEEAINYRAQLIAGAID----------SYQMEAKFYRIDRVEIWCRLSVSLVKGEDGI 376

Query: 494 LRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
                 ++                  TE      K +   +R  TA +     +  +S E
Sbjct: 377 KDRIISQV---------------EDITERKHLEFKAKEHAKRFTTAFEYSPNGMGMVSIE 421

Query: 554 -----LRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKI 608
                +   L +I G+    K+E   +  S     +  D+    + L  +IN  ++   I
Sbjct: 422 GDWLMVNQNLASIFGY---KKEEFINKRSSE--LTHPDDLKKDSKQLKALINLEIDTYSI 476

Query: 609 E 609
           E
Sbjct: 477 E 477


>gi|325926364|ref|ZP_08187693.1| multi-sensor hybrid histidine kinase [Xanthomonas perforans 91-118]
 gi|325543243|gb|EGD14677.1| multi-sensor hybrid histidine kinase [Xanthomonas perforans 91-118]
          Length = 1084

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 139/716 (19%), Positives = 257/716 (35%), Gaps = 53/716 (7%)

Query: 83  NQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSES---FILLAQPNEL 139
                 L+  IE++       ++   + KA+  L    A+ R L+++    I +A P+  
Sbjct: 227 RAPRRWLSAEIELVRLVVARCWESMQRAKAQQQLAANEARLRRLADTLPQIIFIADPDGR 286

Query: 140 VFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSIL 199
               + +   Y G     + P  +   +  +        L +Q + +             
Sbjct: 287 PHYFNQRWYEYTG-----LDPSSNEDAAWHRAHTADGLRLSEQAWSLALKGQRALEVECE 341

Query: 200 IINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVET 259
           ++         W     L V          +      Y      +  +  L E+ +    
Sbjct: 342 LLRHDGQ--SRWHLVRALPVRGDDGS----ISEWIGTYTDIHDRRAFEQQLRESEVRFRA 395

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
                   +W  +      + +   Y   G          +    ++H D+      A  
Sbjct: 396 LCETVPAMIWMADAQGDCVYWNPRWYNFTG--QGEDQALDQGWWDVMHPDDAARVRHAFE 453

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYA 378
              +   +    + +R   G   W    A       G     IG   D++E+ H+E   A
Sbjct: 454 QALEQRGEFLAEYRVRRHDGQYRWCIDTASPHFASDGRFLGHIGSLTDISERKHIEDATA 513

Query: 379 EADQRLSKAIECTSEALVL------WDKNDRLVMCNANYQKA-------YGLPDHVLVP- 424
                LS         +VL       +    + +  +   +        +G   H  +  
Sbjct: 514 SDRAILSLITTGAPLPVVLDAIALSVEARGEIPLYCSVMVRDEVRHTLSFGSAPHFPIEY 573

Query: 425 ------------GNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCT 472
                       G   ++      + I     +D   S   +    +             
Sbjct: 574 RGHFEPSPIGPDGPPCALSAHLGRQVICSDLQADASFSSHHAISATM--GIAACCVTPIL 631

Query: 473 HDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE 532
              G +    +I   + +   LRE      A+        +     K +LS+        
Sbjct: 632 ASNGQVLGTLNIYYDRPHLPSLREQAMARSASHLAGIVIERTRVDAKLKLSLQAET--AA 689

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           + +AE AN+ K EFLA +SHELRTPLNAILG+S +++ +I       +       I  S 
Sbjct: 690 RAQAEHANRVKDEFLATLSHELRTPLNAILGWSRLMQSDIADPANMGRG---LVIIERSA 746

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK--IPS 650
           +    +I+++L+MS I + KI +  ++ D+  ++   + L+  +A ++ I +E       
Sbjct: 747 RAQTQIIDDLLDMSAILSGKIRLQAEHFDIAGLVRSVLELMQPTALARKIALELDAPCDG 806

Query: 651 ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALE 710
           EL+F  D   ++++L  +LSN++KFT   G + +      + + + + DTGIGI    L 
Sbjct: 807 ELWFFGDAGRLQQVLTNLLSNALKFTPAGGTVRVAMDVEDERLRLCVQDTGIGIAADFLP 866

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ-EGKGTIVTICMP 765
            +   F        + +GG GLGL+IS  L +LHGG L   S  EG+G + TI +P
Sbjct: 867 HVFDRFRQADAGTTRRVGGLGLGLSISRQLVDLHGGSLGASSAGEGQGALFTIVLP 922


>gi|114797754|ref|YP_761588.1| non-motile and phage-resistance protein [Hyphomonas neptunium ATCC
           15444]
 gi|114737928|gb|ABI76053.1| non-motile and phage-resistance protein [Hyphomonas neptunium ATCC
           15444]
          Length = 821

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 185/695 (26%), Positives = 315/695 (45%), Gaps = 30/695 (4%)

Query: 79  EKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNE 138
           +   +     L  A  +  +       +    +     G L+      + + ++      
Sbjct: 133 DASQSPDGSRLGAAATVAGEMMEQGALIGLSGQ-----GDLVFLAALDARNPVIALTQAS 187

Query: 139 LVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSE---ASLDQQPYHVLSVNLPHNS 195
            +       +H   +  G +I     +   + +    +    +         +       
Sbjct: 188 TIIPEPGSGAHISVQAEGHVIGFGDPALQPAASAADLQRPQVTSSGGVRAASACAPVGEG 247

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKE---NDTILLE 252
              + +    PL    R ++    +F  +++A    +     R + + +E    +T   E
Sbjct: 248 SVCVCVTVDQPLFT--RADLLSLAIFALLVAAPTFTLFGLSRRLSLRQREIAIQETRNEE 305

Query: 253 ANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKK 312
           ++  +   +   R G W +  D     LS    +++G+  E        +   +  +++ 
Sbjct: 306 SDRILGLVMRGARAGYWEWYQDASALFLSDGAADLVGL-GEGGRAPLEELLARVPVESRG 364

Query: 313 ICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKY 371
             +   S   + +  +   F  + +     WI++R  +     +G     GI MD TE+ 
Sbjct: 365 YVKEGFSKA-RSIGWVHLTFIAQTS--PLRWIEMRGSISTDPVTGTTVFGGIMMDATERK 421

Query: 372 HLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSII 431
             E R   A++RL  AIE  +    LWD   RL+  N  +   +GL    L PG +   +
Sbjct: 422 QAEDRVKTAERRLRNAIEGFNGPFALWDTRKRLLYWNRAFALDFGL-QDTLRPGMSHDTV 480

Query: 432 QDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQ 491
             A+   +   R S+ +     +  I L   RWL++ E  T DGG I+VG ++T      
Sbjct: 481 VIARAGAVSMERQSEED---ARTTTIALRTGRWLKMVERATPDGGLITVGIEVTE----- 532

Query: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMS 551
                ++  LK     L  +   LER +   S  + KY  EKE+AE A   KS FLA MS
Sbjct: 533 --NVRNEEELKKQKEKLRRAALDLERSEGHASELSRKYSEEKEKAERAALAKSAFLANMS 590

Query: 552 HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETE 611
           HELRTPLNA++GFSE++  E+ G LG   Y EYA+DI  SGQHLL+MIN+IL+M+KIE  
Sbjct: 591 HELRTPLNAVIGFSEIMTNELAGPLGDPSYKEYAKDILMSGQHLLDMINDILDMAKIEAG 650

Query: 612 KISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILS 670
           K++I  Q  D I  ++  +R+I   A+ K I +  +    L   +AD R I++++  +LS
Sbjct: 651 KMTISPQPIDPIDPVDAAMRMIRRKAEEKAIDLVLEAEDNLPDIDADHRAIRQMMLNLLS 710

Query: 671 NSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGF 730
           N+IKFT+ +G + +R  + G  +   + DTGIGIP   L ++ QPFE +    D++  G 
Sbjct: 711 NAIKFTDRSGTITVRVEQRGTDIYFGVTDTGIGIPAEDLPRLAQPFEQVAKTKDRNHEGT 770

Query: 731 GLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GLGL+++ +   +HGGR+ + S  G+GT V   +P
Sbjct: 771 GLGLSLTKSFAEMHGGRMLLSSIYGEGTTVAFVLP 805


>gi|117926468|ref|YP_867085.1| PAS/PAC sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117610224|gb|ABK45679.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 1075

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 124/705 (17%), Positives = 248/705 (35%), Gaps = 60/705 (8%)

Query: 74  RYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFL---SESF 130
                  +       L     I   N  ++  +A+Q++AE  L +   +       S   
Sbjct: 260 WIMSALLVAVLVVGGLYRVFAIARYNRELQRSIAAQQQAEQRLQRSEERFALAMRGSNDG 319

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +            S +    +G +      +      ++      +  ++Q     LS +
Sbjct: 320 LWDWDIPTDRVTFSPRWLEMLGYQGA--PQDADMRHWQAHIHPDDQPRVEQALGRFLSGD 377

Query: 191 LPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTIL 250
             H      + +     + +    ++   V            +   +      KE    L
Sbjct: 378 QQHYHSEYRMRHKDGHTIAV----LSRAFVLRDATGR--AIRMVGTHADITALKEQARRL 431

Query: 251 LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
            E+         +   G+   + D      + +   ++G              ++ + D+
Sbjct: 432 RESETRFRAYFEQSVVGMVMASLDRHFIDANHAFCHMLGYSRGELL--KMNFPQITYPDD 489

Query: 311 KKI-CEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAMDLT 368
            +        +    V   +      H  G  +W  + A  ++        +I    ++ 
Sbjct: 490 LERDLVQFEQLRSGQVSAFEMEKRYLHRDGHPVWGLLSATTVKDELGQASYLIAQVQNID 549

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR 428
            +    ++  +++  +    E     +         V  N    +  G P+  L   +  
Sbjct: 550 TQKKALEQLRQSESMMRGYFELGLIGMATTTAQHGWVQINQRLCEILGYPEMALRQKSWA 609

Query: 429 SIIQDAQTRPI---IEYRTSDPERSQDMSKEIKLADSRWLQINEWC---THDGGTISVGT 482
            I      +     IE           + K     D  ++  +        +GG I    
Sbjct: 610 EITHPQDRQADEVAIERLRKGLSEGYALEKRFIRQDGAFIYASISAGCLRKEGGEIGHFL 669

Query: 483 DITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKT 542
                                           L +  T         Q +KE+AE AN+ 
Sbjct: 670 -------------------------------TLVQDITARKRMELALQEQKEQAEAANRA 698

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           KS FLA MSHE+RTP+NAILG +E++++       + + +   + ++ SG+ LL++IN+I
Sbjct: 699 KSTFLAVMSHEIRTPMNAILGMAELLRESDL----TSRQHWCVETLNRSGESLLSLINDI 754

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRI 660
           L++SKIE E+++++    DL+ ++ +   L G  AQSK + ++  I   L      D   
Sbjct: 755 LDLSKIEAERLTLEHVVFDLVQLVGDVCSLFGYEAQSKGLALKHHIAPTLPRYVVGDPIR 814

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTSK-IGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
           +++I+  ++ N++KFT   G + +  +      +   I DTGIG+       I +PF   
Sbjct: 815 LRQIMMNLVGNAVKFTKQ-GHVSVELNPLADGRLSFVIRDTGIGVSVEQQRNIFKPFTQA 873

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
            +   +  GG GLGL I   L  L GG +++ S  G+G+     +
Sbjct: 874 DSSITREHGGTGLGLTICMRLVALMGGEMQLESTLGEGSCFHFEL 918


>gi|268326254|emb|CBH39842.1| putative sensory transduction histidine kinase [uncultured archaeon]
          Length = 1037

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 115/658 (17%), Positives = 235/658 (35%), Gaps = 52/658 (7%)

Query: 113  ESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSR-SKT 171
            E+++ + L  T       +++  P+  +  ++    + +G    E+I           K 
Sbjct: 425  ETVIKKELENTLNTMTDTLIVLDPDGDIIKANKAAFNLLGYSEAELIGMSFDKIVGKPKQ 484

Query: 172  VQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLF 231
             +  +  L +      +      +  +      +P+            +  +    L   
Sbjct: 485  EEEGKIELKKLIREPEASITNLETTYLTKDRREIPV-------NFAASIMKNENGELQGI 537

Query: 232  ILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIP 291
            +  +      + K+ +  L E+           +  ++  +   K   ++ +M  + G+P
Sbjct: 538  VCNAC--DITERKQAEEALRESEERFRAISETAQDSIFIKDRALKYTLVNPTMERLFGLP 595

Query: 292  YENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM 351
                         L   +         S      + +++    +   G      V    M
Sbjct: 596  ASKIIGKTDD--DLFDKEAASHIREVDSHVL-KGETVEEEHTKKIK-GVLFSFHVIKVPM 651

Query: 352  RTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNAN 410
            R  SG  + + GIA D+TE+   E+   E+++R     E   +       +  ++    +
Sbjct: 652  RDNSGEVIGLCGIARDITERKRAEEALRESEERYRSIFESIQDVYAAVAMDGTILEITPS 711

Query: 411  YQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWL--QIN 468
             Q   G     ++  +        + R  +  R        D    ++    R +     
Sbjct: 712  IQSFSGYAPEEVLGRSLAEFYVYPEQRAALLERLRLGGSVNDYEVVLRHKTGRAVTSSFT 771

Query: 469  EWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK 528
                 D     V    T+                              R  TE    + +
Sbjct: 772  VKVVTDASGTPVKIVGTM------------------------------RDVTERKRLDDE 801

Query: 529  YQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
             +   ++    +K K+ FL    HE+R+PL  I+G++ ++++       + K  +Y + I
Sbjct: 802  RERLIKKLGELDKMKTNFLNVAYHEMRSPLAPIVGYASLLEQGEL----NEKQKKYVRII 857

Query: 589  HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI 648
              S   L  +I ++LE++++E  K  +  +   +  I+N  +   G  A +K   I   +
Sbjct: 858  EESASQLEELIESMLEVTRLEAGKAELSLEKMSIPEIVNNVLERFGPQADAKKQTISAVV 917

Query: 649  PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSA 708
            P       DK+ I  I   ++SN+IK+T   G++ I      + + + +ADTGIGIPK  
Sbjct: 918  PEGTEVEGDKQKITAIFDNLISNAIKYTGEKGRIDIVVEDRKEGIRVCVADTGIGIPKEQ 977

Query: 709  LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            L +  + F        +  GG GLGLAI      LHGG + + S+ GKG+     +P+
Sbjct: 978  LPRAFERFFMADTSLRRK-GGLGLGLAIVKGYVKLHGGEVWVTSELGKGSKFWFTLPK 1034


>gi|170741220|ref|YP_001769875.1| multi-sensor hybrid histidine kinase [Methylobacterium sp. 4-46]
 gi|168195494|gb|ACA17441.1| multi-sensor hybrid histidine kinase [Methylobacterium sp. 4-46]
          Length = 1596

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 123/679 (18%), Positives = 262/679 (38%), Gaps = 58/679 (8%)

Query: 101  NIKFDLASQKKAESMLGQLLAKTRFLSESF--ILLAQP---NELVFASSTKNSHYIGKKI 155
                D+ ++++AE  L +  ++ R ++E+   ++  +    +  +   S      +G   
Sbjct: 692  RTYTDITARRQAEEALRESESRHRLIAENVSDVITLRRAGGDGALLYVSPAIRTVLGYAP 751

Query: 156  GEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEV 215
             +     + S    +         D+     ++  +     +   ++        W    
Sbjct: 752  EDFAARPAESLLHPE---------DRDRVAAVTAAIDAARPTATSVHRLRHRDGHWVFVE 802

Query: 216  TLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDN 275
            T         +      + +  R   +    +  + E+ +            +   +   
Sbjct: 803  TALTWMQGEGAR--GARILAAMRDVSRRVAAEAAVRESEMLYRLLAETTSDVITRLDLGL 860

Query: 276  KKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE-IARSVTGKH--VKQLDQIF 332
               ++S +   ++G   E+     +  + ++H D+    + +AR +       + +   F
Sbjct: 861  AWQYVSPACRAVLGYEPEDLLR--QRPSAVVHPDDLPALQDLARRLAAGEIAGEHVTTTF 918

Query: 333  HMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
              RH  G  +W +    +MR   G   +I+    D+T +   E     ++ R     E  
Sbjct: 919  RTRHGRGGFVWTEAGLSLMRDEGGAPVSIVCSLRDVTARKAAEAALEASEARYRFLSENG 978

Query: 392  SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ 451
            S+ +V  D++      +   ++  G     +V       +       +          ++
Sbjct: 979  SDMIVQADRDSVRRYVSPACREILGYEPEEIVGTKPLDGVHPDDRAALAATLADLAAGTR 1038

Query: 452  DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
            D++   +           +   DG  + V     LL+  + +       +          
Sbjct: 1039 DVATSRQR----------YRRRDGSYVWVEAKFRLLRDAEGRAEGYVASV---------- 1078

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
                 R  +E        ++ ++ AE A++ K++FLA MSHE+RTPLN ILG+++++   
Sbjct: 1079 -----RDVSERQRQAEALELARDAAEQASRAKTDFLASMSHEIRTPLNGILGYTDLLLD- 1132

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
                         A+ I  +G  LL ++N+IL+ SKIE  +I +D Q   L  +++  + 
Sbjct: 1133 --DPSLGGGQRRQAERIQSAGAALLTIVNDILDFSKIEAGQIELDPQPFLLDALLDNTVS 1190

Query: 632  LIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K I +  ++          D+  +++IL  +L+N++KFT+  G + +  +  
Sbjct: 1191 VVRGFARKKAIAVAVRLDGAAPRTLVGDQDRLRQILLNLLNNAVKFTHA-GSVTLAVACE 1249

Query: 690  G-----QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
                   C+   ++DTGIGIP+   E++ Q F  + N   +  GG GLGLAIS  L  L 
Sbjct: 1250 SPPGATACLRFAVSDTGIGIPRDKHERLFQRFSQVDNSIRRDFGGTGLGLAISKNLVELM 1309

Query: 745  GGRLKIISQEGKGTIVTIC 763
            GG + + S   +GT     
Sbjct: 1310 GGTIGVESVVSEGTTFWFT 1328



 Score =  166 bits (421), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 68/450 (15%), Positives = 136/450 (30%), Gaps = 27/450 (6%)

Query: 62  FIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLA 121
            +  +    + + + Q       T + L            +   LA Q+ +E++   +  
Sbjct: 282 VVGLAREDALGSWHRQV---LVLTGIALAALGLTWLIGLRLGRTLAQQRASETLFRAMFE 338

Query: 122 KTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQ 181
                     L    +  + A +   +  +G     ++         +  V   EA L  
Sbjct: 339 AASEAQFICRLETDGSFRLEACNRAAAARLGAAPEALVGRPLGGALPAGRVARIEADLR- 397

Query: 182 QPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAK 241
                    +               +L   R+E               L  + +  R+  
Sbjct: 398 -RCLAAGNPIRLQESGDGAGRVFEEVLTPLRDEAGR------------LDRVLASIREIT 444

Query: 242 KNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRA 301
             K  +    EA   +  A      G W  +  +     SR ++ I G+   +   +  A
Sbjct: 445 HLKRAEAETREAVRRLLMAEEIAHVGHWRIDLRDDSMTWSREVFRIHGLEPGSVAPTLAA 504

Query: 302 IARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NI 360
                H D++     +        +       +    G+   +  RA       G +  +
Sbjct: 505 ALGFCHPDDRPAVAASIEAQIASKQPATDALRIVRPDGSIRHVVTRALCEFGPDGAVAAL 564

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
            G   D+TE   +E+  AEA   L+  +E   + L++     R+ +CNA      GLP  
Sbjct: 565 FGTLSDVTELRRVEREAAEAASLLATTLESMDQGLIVVSPEGRIEICNARALALLGLPPE 624

Query: 421 VLVPG-NARSIIQDAQTRPIIEYRTSDPER--------SQDMSKEIKLADSRWLQINEWC 471
           ++        +++             +  R         +  +      +   L+I    
Sbjct: 625 LMAGKPTTHEVLEHQWRSGEFAGAEEEVRRLMRAGGIVPEPHTYTRVRPNGTVLEIRTMP 684

Query: 472 THDGGTISVGTDITLLKHNQAQLRESKRRL 501
              GG +   TDIT  +  +  LRES+ R 
Sbjct: 685 MAGGGLVRTYTDITARRQAEEALRESESRH 714



 Score = 92.7 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 50/460 (10%), Positives = 113/460 (24%), Gaps = 49/460 (10%)

Query: 83  NQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQP---NEL 139
              +  L   +  I +  ++K   A  ++A   L               L       +  
Sbjct: 427 RDEAGRLDRVLASIREITHLKRAEAETREAVRRLLMAEEIAHVGHWRIDLRDDSMTWSRE 486

Query: 140 VFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSIL 199
           VF         +   +   +         +    +      +QP       +  +     
Sbjct: 487 VFRIHGLEPGSVAPTLAAALGFCHPDDRPAVAASIEAQIASKQPATDALRIVRPDGSIRH 546

Query: 200 IINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVET 259
           ++   +           L                        + +  +    EA   + T
Sbjct: 547 VVTRALCEFGPDGAVAALFGTL----------------SDVTELRRVEREAAEAASLLAT 590

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYE---NKTLSFRAIARLIHYDNKKICEI 316
            L     GL   + + +    +     ++G+P E    K  +   +            E 
Sbjct: 591 TLESMDQGLIVVSPEGRIEICNARALALLGLPPELMAGKPTTHEVLEHQWRSGEFAGAEE 650

Query: 317 ARSVTGKHVK--QLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLE 374
                 +          +     +G    +++R   M        ++    D+T +   E
Sbjct: 651 EVRRLMRAGGIVPEPHTYTRVRPNGTV--LEIRTMPMAGGG----LVRTYTDITARRQAE 704

Query: 375 KRYAEADQRLSKAIECTSEALVLWDK--NDRLVMCNANYQKAYGLPDHVLVPGNARSIIQ 432
           +   E++ R     E  S+ + L     +  L+  +   +   G          A S++ 
Sbjct: 705 EALRESESRHRLIAENVSDVITLRRAGGDGALLYVSPAIRTVLGYAPEDFAARPAESLLH 764

Query: 433 DAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQA 492
                 +     +        +   +L              DG  + V T +T       
Sbjct: 765 PEDRDRVAAVTAAIDAARPTATSVHRL-----------RHRDGHWVFVETALT------W 807

Query: 493 QLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE 532
              E  R  +        SR++        S    +   E
Sbjct: 808 MQGEGARGARILAAMRDVSRRVAAEAAVRESEMLYRLLAE 847


>gi|154251104|ref|YP_001411928.1| PAS/PAC sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
 gi|154155054|gb|ABS62271.1| PAS/PAC sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
          Length = 661

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 159/668 (23%), Positives = 272/668 (40%), Gaps = 53/668 (7%)

Query: 110 KKAESMLGQLLAKTRF-------LSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPEL 162
           K++E+  G+  A +              + +   + ++   S      +G     ++   
Sbjct: 12  KQSETSAGEFRAASGDFYRALVENVGDILTILDCDGVITYQSPAVRKAMGTSEDLLVGRR 71

Query: 163 SRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFF 222
                     +  E  + +                +L +     L   WR   T      
Sbjct: 72  IADLVHPDDRERIERRIAECARV--------PGSEVLELVRLPHLNGTWRRLETRGCNLI 123

Query: 223 SIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSR 282
                +   +  S  R   +    ++ L EA           R G W +         SR
Sbjct: 124 -GDPDVAGILCVS--RDVTETHMLESKLREAEQL-------ARFGHWRWVKGEPAPQWSR 173

Query: 283 SMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADI 342
            +  I+G+       +      L+H +++           +  + ++ I   R   G   
Sbjct: 174 GVARILGLEEGQLPAAGDWYEHLVHPEDRDELLSQFIDAFETHEPVNSITRFRAGDGNYR 233

Query: 343 WIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKN 401
           +I+  A       S    ++G+A D+ E+   E     ++ +     E  S+ +  +D  
Sbjct: 234 YIKTYAYAEADAYSEIGALVGLAEDVHEEVEAELALKASEAKYRLMTEQASDVVAHYDAE 293

Query: 402 DRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLAD 461
            +++  +   +   G      +       +   +  P           S     E    D
Sbjct: 294 SKVIFISPAVEPILGRKAEEFIGNPISEEMIHREDFPRARDAFIQCITSG----ESVHFD 349

Query: 462 SRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
            R+L        DG  + + +              + RR   T    +     + R  +E
Sbjct: 350 YRFLH------KDGHYVWLES--------------TMRRACDTDGRQTAEVIGITRDISE 389

Query: 522 LSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKY 581
                 +    +ERAETA++TKS FLA MSHELRTPLNAI+GFSE+++ ++FG LG  +Y
Sbjct: 390 RKRHEMELLDARERAETASRTKSRFLANMSHELRTPLNAIIGFSEILRMQMFGALGHPRY 449

Query: 582 YEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKN 641
            EYAQ I+ SG  LL++I++IL+MSKIE  K  +  +  D   +I   +RL+   A+   
Sbjct: 450 TEYAQLINESGALLLDLISDILDMSKIEAGKYELHPETVDAAALIESCVRLVRGRAEENG 509

Query: 642 IKIEKKIPS---ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIA 698
           I + KKI          AD+R +K+I+  +LSNS KFT   G++ +  ++  + +   +A
Sbjct: 510 IHLVKKIQCAELGGTLVADERALKQIMLNLLSNSAKFTPAGGRISVALTETEETICFAVA 569

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           DTG GIP   + ++GQPFE +      S  G GLGLA+  +L  LHGG + I S+ G GT
Sbjct: 570 DTGRGIPADQIARLGQPFEQIATDAALSKEGTGLGLALVRSLAELHGGSMAIDSELGVGT 629

Query: 759 IVTICMPQ 766
            VT+ +P+
Sbjct: 630 TVTVTLPK 637



 Score = 58.8 bits (141), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 48/182 (26%), Gaps = 24/182 (13%)

Query: 88  MLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRF---LSESFILLAQPNELVFASS 144
              +A   I     +  D+  + +AE  L    AK R     +   +        V   S
Sbjct: 241 AEADAYSEIGALVGLAEDVHEEVEAELALKASEAKYRLMTEQASDVVAHYDAESKVIFIS 300

Query: 145 TKNSHYIGKKIGEIIPEL------SRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSI 198
                 +G+K  E I          R           +     +  H     L  +   +
Sbjct: 301 PAVEPILGRKAEEFIGNPISEEMIHREDFPRARDAFIQCITSGESVHFDYRFLHKDGHYV 360

Query: 199 LIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE 258
            + ++          +                  +    R   + K ++  LL+A    E
Sbjct: 361 WLESTMRRACDTDGRQTA---------------EVIGITRDISERKRHEMELLDARERAE 405

Query: 259 TA 260
           TA
Sbjct: 406 TA 407


>gi|212637156|ref|YP_002313681.1| sensory box histidine kinase/response regulator [Shewanella
            piezotolerans WP3]
 gi|212558640|gb|ACJ31094.1| Sensory box histidine kinase/response regulator [Shewanella
            piezotolerans WP3]
          Length = 1771

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 128/695 (18%), Positives = 252/695 (36%), Gaps = 56/695 (8%)

Query: 86   SLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTR---FLSESFILLAQPNE--LV 140
              +L    +   Q      D+  + K    +     + R         +   +  +  ++
Sbjct: 615  LGLLPVDADGQRQVAATVRDMTEELKIAQRIKDSENRFRGLVTNIPGAVYRTRIEDTWIM 674

Query: 141  FASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILI 200
               S       G    + I   +  RS +  +   + ++                    I
Sbjct: 675  EYVSDNIGDITGYPAADFIE--NSKRSFASLIIEEDLAIASHAIETALAEQRSFEVQYRI 732

Query: 201  INSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETA 260
             +    +   W  E    +   + ++      +         +K     + ++   +ET 
Sbjct: 733  QHRDASIH--WVHEKGKAIYDENGVALWFDGSI----NDITISKAAQEKIAQSQQQLETI 786

Query: 261  LSRGRCGL----WNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
                   +    W  N D     LS +    +G   +     F  +A  I  D +     
Sbjct: 787  TESIPSTVYQLHWRSNRDRNFTFLSSACIATLGFHRDQVIEKFDLVAECIINDERTHIIE 846

Query: 317  ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
            A S          + F  RH  G   W+Q  A   +     +   G  MD+TE+  ++K 
Sbjct: 847  ALSGVSSSGLNWTEEFRYRHPMGDIRWLQAGAHGNQLADDSIIWNGYLMDITERKQIDKE 906

Query: 377  YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
             A+ +       +     +V  D+   ++ CN  + +   L    L   +          
Sbjct: 907  LAKREAHFRALFDNAGIGIVNVDERGLILDCNEQFSQYVQLSSDELNGSSFFDYQHRDDQ 966

Query: 437  RPIIEYRTSDPERSQD-MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLR 495
            +   +  +         M+ EI+L            +  G  + +   +T L+     L 
Sbjct: 967  QTAKQLFSQLMGNDDSSMTAEIRL-----------LSQSGDVMWMDLTLTGLQDKHGTLN 1015

Query: 496  ESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELR 555
             +   +                  T L   + + +  K+ A+ A+K KS+FLA MSHE+R
Sbjct: 1016 SAVLSMAN---------------ITSLKQISNELKQAKDSADAASKAKSDFLANMSHEIR 1060

Query: 556  TPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISI 615
            TP+NAI+G S++  +    +    K   Y Q I  + + LL +IN+IL+ SKIE  K+ I
Sbjct: 1061 TPMNAIIGMSQLCLQTELDK----KQQNYVQKIDRASKSLLGIINDILDFSKIEAGKLDI 1116

Query: 616  DKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSI 673
            +  +  L  ++ +   +    A  K +++   +   +      D   + ++L  +++N++
Sbjct: 1117 ESVSFQLETMLEDLSDMFSVKAADKQLELLFAVAPNIPRQLEGDPLRLSQVLINLMNNAV 1176

Query: 674  KFTNNNGKMMIRTSKIGQ-----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
            KFT+  G++++  S++ +      +  ++ D GIG+ +    K+ + F        +  G
Sbjct: 1177 KFTDQ-GEVLLSISQLERVDDAITLRFSVRDNGIGLTEDQRNKLFKSFSQADTSTTRKYG 1235

Query: 729  GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
            G GLGLAI   L  L GG + + SQ G G+     
Sbjct: 1236 GTGLGL