RPSBLAST alignment for GI: 254780903 and conserved domain: PRK11006

>gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional. Length = 430
 Score = 60.8 bits (148), Expect = 1e-09
 Identities = 55/239 (23%), Positives = 100/239 (41%), Gaps = 40/239 (16%)

Query: 546 FLAKMSHELRTPLNAILGFSEVIK-KEIFGEL----------------GSVKYYEYAQDI 588
           F A +SHELRTPL  + G+ E+++ + + G L                G VK       I
Sbjct: 207 FFANVSHELRTPLTVLQGYLEMMQDQPLEGALREKALHTMREQTQRMEGLVKQLLTLSKI 266

Query: 589 HYSGQHLLNMINNILEMSKI-ETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK 647
             +    LN   ++  M ++ E E  ++ +    +   ++  +++ G+  Q ++      
Sbjct: 267 EAAPTIDLNEKVDVPMMLRVLEREAQTLSQGKHTITFEVDNSLKVFGNEDQLRSAI---- 322

Query: 648 IPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKS 707
             S L +NA                +  T     + +R  ++ Q    ++ D G GI   
Sbjct: 323 --SNLVYNA----------------VNHTPEGTHITVRWQRVPQGAEFSVEDNGPGIAPE 364

Query: 708 ALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            + ++ + F  +     +  GG GLGLAI     + H  RL+I S+ GKGT  +  +P+
Sbjct: 365 HIPRLTERFYRVDKARSRQTGGSGLGLAIVKHALSHHDSRLEIESEVGKGTRFSFVLPE 423