RPSBLAST alignment for GI: 254780903 and conserved domain: PRK11073

>gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional. Length = 348
 Score = 47.4 bits (113), Expect = 1e-05
 Identities = 52/228 (22%), Positives = 100/228 (43%), Gaps = 30/228 (13%)

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           ++HE++ PL  + G ++++ K     L      EY + I      L N+++ +L   +  
Sbjct: 137 LAHEIKNPLGGLRGAAQLLSKA----LPDPALTEYTKVIIEQADRLRNLVDRLLGPQRPG 192

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPI 668
           T       ++   I  + E +  + S     N+++ +   PS      D   I+++L  I
Sbjct: 193 THVT----ES---IHKVAERVVQLVSLELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNI 245

Query: 669 LSNSIK-FTNNNGKMMIRTSKIGQCVI----------ITIADTGIGIPKSALEKIGQPFE 717
           + N+++      G + +RT    Q  +          I I D G GIP    + +   F 
Sbjct: 246 VRNALQALGPEGGTITLRTRTAFQLTLHGERYRLAARIDIEDNGPGIPPHLQDTL---FY 302

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           P+ +  +   GG GLGL+I+  L + H G+++  S  G  T  ++ +P
Sbjct: 303 PMVSGRE---GGTGLGLSIARNLIDQHSGKIEFTSWPGH-TEFSVYLP 346