RPSBLAST alignment for GI: 254780903 and conserved domain: PRK15347

>gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional. Length = 921
 Score =  145 bits (368), Expect = 4e-35
 Identities = 77/237 (32%), Positives = 133/237 (56%), Gaps = 15/237 (6%)

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           K+RAE ANK KSE L  +SHE+RTPLN +LG  E+++      L + +  + A       
Sbjct: 388 KQRAEQANKRKSEHLTTISHEIRTPLNGVLGALELLQN---TPL-TAEQMDLADTARQCT 443

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE----KKI 648
             LL +INN+L+ S+IE+ ++++  +   L+P++++ +  I   AQSK++ +       +
Sbjct: 444 LSLLAIINNLLDFSRIESGQMTLSLEETALLPLLDQAMLTIQGPAQSKSLTLRTFVGAHV 503

Query: 649 PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSA 708
           P  L  ++ +  +++IL  +L N++KFT   G + +R  +  Q +  T+ DTG GI    
Sbjct: 504 PLYLHLDSLR--LRQILVNLLGNAVKFT-ETGGIRLRVKRHEQQLCFTVEDTGCGI---D 557

Query: 709 LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +++  Q F P + Q D    G GLGL I+ +L  + GG L + S  G G+  ++ +P
Sbjct: 558 IQQQQQIFTPFY-QADTHSQGTGLGLTIASSLAKMMGGELTLFSTPGVGSCFSLVLP 613