RPSBLAST alignment for GI: 254780903 and conserved domain: COG4191

>gnl|CDD|33926 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms]. Length = 603
 Score = 74.2 bits (182), Expect = 1e-13
 Identities = 67/287 (23%), Positives = 124/287 (43%), Gaps = 24/287 (8%)

Query: 491 QAQLRESKRRLKATI----NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
            A+L+E++  L+  +     DL+ +   L+ +  E     A+  + + + E     K   
Sbjct: 326 LAELQEARAELERRVEERTADLTRANARLQAEIAERE--QAEAALRRAQDELVQAGKLAA 383

Query: 547 LAKMS----HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           L +MS    HEL  PL AI  +++     +  E G     E A++       L   +  I
Sbjct: 384 LGQMSAGIAHELNQPLAAIRTYAD--NARLLLERGRT---EEARENLERISALTERMAAI 438

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP-SELFFNADKRII 661
               K    K         L   I   + L+    ++  +++E  +P + L+  A++  +
Sbjct: 439 TAHLKSFARKSRDAAGPVSLREAIEGALELLRGRLRAAGVELELDLPDAPLWVMANEIRL 498

Query: 662 KKILFPILSNSIKFTNN--NGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
           +++L  +L N++       + ++ IR  + G  V++T+ D G GI   AL  + +PF   
Sbjct: 499 EQVLVNLLQNALDAMAGQEDRRLSIRAQREGGQVVLTVRDNGPGIAPEALPHLFEPF--- 555

Query: 720 HNQYDQSIG-GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
                + +G G GLGLAIS  +    GG L++ +    G   TI + 
Sbjct: 556 --FTTKPVGKGLGLGLAISQNIARDLGGSLEVANHPEGGASFTIELR 600