HHsearch alignment for GI: 254780904 and conserved domain: PRK10864

>PRK10864 putative methyltransferase; Provisional.
Probab=99.98  E-value=7.2e-32  Score=220.34  Aligned_cols=151  Identities=15%  Similarity=0.136  Sum_probs=117.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHCCCCCCCHHCCCCHHHHHHCCCCCEEE
Q ss_conf             34896899942888547999999999719980498088889999999998531013444200137789984125531012
Q gi|254780904|r   11 SAKGPVIILVDPQLGENIGMVARAMWNFNLTQLRLVNPRDGWPSEKARSSSANADCVIDSVRVFSNLKEAIADLHFIYAT   90 (268)
Q Consensus        11 ~~~~~~vVLv~p~~p~NiGaiaRa~~~fG~~~L~lv~P~~~~~~~~a~~~a~~a~~~~~~~~~~~~~~~a~~~~~~~~~~   90 (268)
T Consensus       197 ~~~~~lL~LDgV~DP~NlGAIiRSAaafGv~gVIl~~~-~~~~s~~avr~SaGa~e~vpv~~v-~nl~~aL~~Lk~----  270 (348)
T PRK10864        197 GAQDCVLALEDVGNPHNLGGIMRSCAHFGVKGVVVQDA-ALLESGAAIRTAEGGAEHVQPITG-DSIVDVLDDFRQ----  270 (348)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHCCCEEEECCC-CCCCCHHHHHHHCCHHCCCCEEEE-CCHHHHHHHHHH----
T ss_conf             99985999789779715889999999858988997999-877437889663322200635997-789999999998----


Q ss_pred             ECCCCCCCEEEECCCCHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             01122343034124203566655311588169999458884243100012322204767873410168899999999999
Q gi|254780904|r   91 TARNRNNFKSVLAPKEAAIVLNERIFSGQNVGIIFGRERWGLTNEEIALSNAIISFPVNPLFPSLNISQAVLLMVWECME  170 (268)
Q Consensus        91 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~valVFG~E~~GLs~eel~~cd~~v~IPt~~~~~SLNLS~AvaIvlYEl~r  170 (268)
T Consensus       271 -----aG~~Ivg~s~~-~~~~l~~~~l~~~~vLVlGsEg~GLs~~v~~~cD~~V~IPm~g~veSLNVSVAagIlLyE~~R  344 (348)
T PRK10864        271 -----AGYTIVTTSSH-KGKPLFKAELPAKMVLVLGQEYDGLSDAARSPGDLSVKIDGTGNVESLNVSVATGVLLAEWWR  344 (348)
T ss_pred             -----CCCEEEEECCC-CCCCHHHCCCCCCEEEEECCCCCCCCHHHHHHCCEEEECCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             -----89689985477-886475636789889998998855069999758889982799998578899999999999987


Q ss_pred             HHC
Q ss_conf             621
Q gi|254780904|r  171 NSI  173 (268)
Q Consensus       171 ~~~  173 (268)
T Consensus       345 Q~~  347 (348)
T PRK10864        345 QNK  347 (348)
T ss_pred             HHC
T ss_conf             316