BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780906|ref|YP_003065319.1| hypothetical protein CLIBASIA_04025 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780906|ref|YP_003065319.1| hypothetical protein CLIBASIA_04025 [Candidatus Liberibacter asiaticus str. psy62] gi|254040583|gb|ACT57379.1| hypothetical protein CLIBASIA_04025 [Candidatus Liberibacter asiaticus str. psy62] Length = 96 Score = 202 bits (513), Expect = 2e-50, Method: Composition-based stats. Identities = 96/96 (100%), Positives = 96/96 (100%) Query: 1 MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKP 60 MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKP Sbjct: 1 MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKP 60 Query: 61 NTSSIKIKNNIIEPQPGPSRWEGGWNGERYVREWER 96 NTSSIKIKNNIIEPQPGPSRWEGGWNGERYVREWER Sbjct: 61 NTSSIKIKNNIIEPQPGPSRWEGGWNGERYVREWER 96 >gi|145521326|ref|XP_001446518.1| hypothetical protein [Paramecium tetraurelia strain d4-2] gi|124413996|emb|CAK79121.1| unnamed protein product [Paramecium tetraurelia] Length = 862 Score = 34.7 bits (78), Expect = 4.0, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Query: 2 TISKNQAILF------FITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKP 55 TI + ILF +T +SS ++D + + NT+NH L F SHN+ P Sbjct: 138 TIMVHWLILFHISKAKLVTKHTISSTQQEINDKIMIDSVGNTQNHSRLKFKEKPSHNESP 197 Query: 56 TEKKPNTSSI 65 T ++ N I Sbjct: 198 TIERDNRLEI 207 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.313 0.132 0.406 Lambda K H 0.267 0.0414 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 907,657,189 Number of Sequences: 14124377 Number of extensions: 31230728 Number of successful extensions: 56663 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 56659 Number of HSP's gapped (non-prelim): 6 length of query: 96 length of database: 4,842,793,630 effective HSP length: 65 effective length of query: 31 effective length of database: 3,924,709,125 effective search space: 121665982875 effective search space used: 121665982875 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 76 (33.9 bits)