RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780906|ref|YP_003065319.1| hypothetical protein CLIBASIA_04025 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Score = 24.9 bits (54), Expect = 4.2 Identities = 5/32 (15%), Positives = 13/32 (40%), Gaps = 7/32 (21%) Query: 49 DSHNQKPTEKKPNTSSIKI-------KNNIIE 73 +S +++ + PN + + I+E Sbjct: 5 ESIDKRAGRRGPNLNIVLTCPECKVYPPKIVE 36 >2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A Length = 130 Score = 24.7 bits (54), Expect = 5.0 Identities = 7/33 (21%), Positives = 15/33 (45%) Query: 1 MTISKNQAILFFITGMILSSCGDTLSDSKQHNK 33 + ++ NQA + G + S +S+ + K Sbjct: 76 LQLNANQAFFLLVNGHSMVSVSTPISEVYESEK 108 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 24.5 bits (53), Expect = 6.2 Identities = 17/76 (22%), Positives = 23/76 (30%), Gaps = 39/76 (51%) Query: 7 QAI--LFFITG---------MILSSCGDTLSDSKQHNK--------------------IN 35 +AI LFFI G L L DS ++N+ +N Sbjct: 298 KAITVLFFI-GVRCYEAYPNTSLPP--SILEDSLENNEGVPSPMLSISNLTQEQVQDYVN 354 Query: 36 NTKNHLDLLFPIDDSH 51 T +HL P Sbjct: 355 KTNSHL----P-AGKQ 365 >1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycoprotein; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Length = 971 Score = 23.8 bits (51), Expect = 10.0 Identities = 5/23 (21%), Positives = 11/23 (47%) Query: 70 NIIEPQPGPSRWEGGWNGERYVR 92 ++E PG EG ++ + + Sbjct: 60 ALLEGNPGHYSAEGIFDLQPFFD 82 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.313 0.132 0.406 Gapped Lambda K H 0.267 0.0637 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 833,085 Number of extensions: 30201 Number of successful extensions: 52 Number of sequences better than 10.0: 1 Number of HSP's gapped: 52 Number of HSP's successfully gapped: 8 Length of query: 96 Length of database: 5,693,230 Length adjustment: 62 Effective length of query: 34 Effective length of database: 4,190,102 Effective search space: 142463468 Effective search space used: 142463468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.2 bits)