BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780907|ref|YP_003065320.1| hypothetical protein CLIBASIA_04030 [Candidatus Liberibacter asiaticus str. psy62] (88 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780907|ref|YP_003065320.1| hypothetical protein CLIBASIA_04030 [Candidatus Liberibacter asiaticus str. psy62] gi|254040584|gb|ACT57380.1| hypothetical protein CLIBASIA_04030 [Candidatus Liberibacter asiaticus str. psy62] Length = 88 Score = 142 bits (358), Expect = 2e-32, Method: Composition-based stats. Identities = 88/88 (100%), Positives = 88/88 (100%) Query: 1 MKLLFSKIAPVFAMGTALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSN 60 MKLLFSKIAPVFAMGTALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSN Sbjct: 1 MKLLFSKIAPVFAMGTALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSN 60 Query: 61 KDKAKEITLDIIDLGIDLLTKEDKKEGA 88 KDKAKEITLDIIDLGIDLLTKEDKKEGA Sbjct: 61 KDKAKEITLDIIDLGIDLLTKEDKKEGA 88 >gi|315122661|ref|YP_004063150.1| hypothetical protein CKC_04565 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496063|gb|ADR52662.1| hypothetical protein CKC_04565 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 88 Score = 40.5 bits (93), Expect = 0.078, Method: Composition-based stats. Identities = 20/33 (60%), Positives = 25/33 (75%) Query: 1 MKLLFSKIAPVFAMGTALISCDSASDPAKKSNI 33 MKL F K+A +F M +L SC+SASD AKK+NI Sbjct: 1 MKLSFPKVASIFTMSMSLYSCESASDTAKKNNI 33 >gi|194880947|ref|XP_001974614.1| GG21841 [Drosophila erecta] gi|190657801|gb|EDV55014.1| GG21841 [Drosophila erecta] Length = 1356 Score = 39.0 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Query: 21 CDSASDPA--KKSNITPIPPAPVALAAPPKNKTEAPKTES 58 CD +PA K+S P+PP+ VA+AAPP TE+PK S Sbjct: 730 CDEEEEPAANKESPAHPVPPSSVAVAAPP--ATESPKKSS 767 >gi|261199872|ref|XP_002626337.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] gi|239594545|gb|EEQ77126.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] Length = 287 Score = 38.6 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 27/53 (50%) Query: 23 SASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSNKDKAKEITLDIIDLG 75 SA+ + K+N +P P A + P N E P T SSNK + + +I LG Sbjct: 139 SAATQSTKTNASPAPTARPPIMTDPGNPPETPSTSSSNKIWIAGVVVGVIALG 191 >gi|258577193|ref|XP_002542778.1| hypothetical protein UREG_02294 [Uncinocarpus reesii 1704] gi|237903044|gb|EEP77445.1| hypothetical protein UREG_02294 [Uncinocarpus reesii 1704] Length = 2149 Score = 37.0 bits (84), Expect = 0.77, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Query: 30 KSNITPIPPAPVALAAPPKNK-----TEAPKTESSNKDKAKEITLDIIDLGIDLLTK 81 +SN P P+P A+A PP + AP + K KE+ D++++ +D +T+ Sbjct: 1571 ESNFLPSVPSPTAVAQPPAQQPPIKIANAPGARVGSLQKVKEMLRDVLEIPLDEITE 1627 >gi|167851526|ref|ZP_02477034.1| hypothetical protein BpseB_40203 [Burkholderia pseudomallei B7210] Length = 587 Score = 37.0 bits (84), Expect = 0.85, Method: Composition-based stats. Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query: 16 TALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSNKDKAKEITLDIIDLG 75 T + + +D A S TP+ A A PP +T A T +S KAK + D +D Sbjct: 353 TGTVHVEPGADAATTSE-TPV--AVTATNLPPSTRTSAAPTTTSEAPKAKAVEPDTVDAL 409 Query: 76 IDLL 79 +DLL Sbjct: 410 LDLL 413 >gi|327350452|gb|EGE79309.1| hypothetical protein BDDG_02248 [Ajellomyces dermatitidis ATCC 18188] Length = 727 Score = 36.3 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 27/53 (50%) Query: 23 SASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSNKDKAKEITLDIIDLG 75 +++ + K+N +P P A + P N E P T SSNK + + +I LG Sbjct: 579 TSATQSTKTNASPAPTARPPIMTDPGNPPETPSTSSSNKIWIAGVVVGVIALG 631 >gi|239607937|gb|EEQ84924.1| conserved hypothetical protein [Ajellomyces dermatitidis ER-3] Length = 298 Score = 36.3 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 27/53 (50%) Query: 23 SASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSNKDKAKEITLDIIDLG 75 +++ + K+N +P P A + P N E P T SSNK + + +I LG Sbjct: 150 TSATQSTKTNASPAPTARPPIMTDPGNPPETPSTSSSNKIWIAGVVVGVIALG 202 >gi|332362953|gb|EGJ40742.1| subtilisin family serine protease [Streptococcus sanguinis SK49] Length = 1506 Score = 36.3 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Query: 15 GTALISCDSASDPAKKS---NITPIPPAPVALAAPPKNKTEAPKTESSNK 61 G A + SA++PA ++ PI PAPV AAP +++ A TE +++ Sbjct: 45 GQATAAVVSATEPASQAATPETQPISPAPVEKAAPASSESVASSTEQASQ 94 >gi|332296504|ref|YP_004438427.1| flagellar M-ring protein FliF [Thermodesulfobium narugense DSM 14796] gi|332179607|gb|AEE15296.1| flagellar M-ring protein FliF [Thermodesulfobium narugense DSM 14796] Length = 515 Score = 34.0 bits (76), Expect = 6.7, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Query: 9 APVFAMGTALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSNKDKAKEIT 68 +PV +IS +D +K N TP P+ P +T AP T SS+ K +EIT Sbjct: 282 SPVVGQNGIVISSKVTTDTSKSQNTTPQTPSATVPQGIPSYQTPAP-TSSSSSRKTEEIT 340 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.309 0.127 0.348 Lambda K H 0.267 0.0399 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 682,741,194 Number of Sequences: 14124377 Number of extensions: 21856599 Number of successful extensions: 144802 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 20 Number of HSP's that attempted gapping in prelim test: 144756 Number of HSP's gapped (non-prelim): 58 length of query: 88 length of database: 4,842,793,630 effective HSP length: 58 effective length of query: 30 effective length of database: 4,023,579,764 effective search space: 120707392920 effective search space used: 120707392920 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 75 (33.5 bits)