RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780907|ref|YP_003065320.1| hypothetical protein CLIBASIA_04030 [Candidatus Liberibacter asiaticus str. psy62] (88 letters) >gnl|CDD|35779 KOG0559, KOG0559, KOG0559, Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion]. Length = 457 Score = 27.3 bits (60), Expect = 0.97 Identities = 14/50 (28%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Query: 15 GTALISCDSASDPAKKSNITPIPPAPVAL---AAPPKNKTEAPKTESSNK 61 G L + PAK P P AAPPK ++ P E++ Sbjct: 140 GQKLAKISPGAAPAKGGASAPAKAEPKTAPAAAAPPKPSSKPPPKEAAPV 189 >gnl|CDD|39041 KOG3837, KOG3837, KOG3837, Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only]. Length = 523 Score = 25.0 bits (54), Expect = 4.8 Identities = 12/46 (26%), Positives = 15/46 (32%), Gaps = 7/46 (15%) Query: 17 ALISCDSASDPAKKSNITPIP-------PAPVALAAPPKNKTEAPK 55 L S D ++ P P APV +PP N A Sbjct: 31 DLSSNDMLGFIVDGIDLPPPPGLKPGDSDAPVRPDSPPPNVERAQP 76 >gnl|CDD|36166 KOG0948, KOG0948, KOG0948, Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]. Length = 1041 Score = 24.5 bits (53), Expect = 7.4 Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 60 NKDKAKEITLDIIDLGIDLLTKEDKK 85 N D+ KE+ I + ID L++ED++ Sbjct: 409 NTDEEKELVETIFNNAIDQLSEEDRE 434 >gnl|CDD|34948 COG5386, COG5386, Cell surface protein [Cell envelope biogenesis, outer membrane]. Length = 352 Score = 24.2 bits (52), Expect = 7.4 Identities = 13/61 (21%), Positives = 18/61 (29%), Gaps = 2/61 (3%) Query: 25 SDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSNKDKAKEITLDIIDLGIDLLTKEDK 84 D T P P P K K E PKT + I ++ G + + Sbjct: 192 DDKNVAQPGTTTPKTPTPQTTPNKPKVENPKT--GLTTTSYLIDFHVVKAGTNETSTMFT 249 Query: 85 K 85 Sbjct: 250 Y 250 >gnl|CDD|145511 pfam02405, DUF140, Domain of unknown function DUF140. This domain has no known function nor do any of the proteins that possess it. The aligned region is approximately 150 amino acids long. Length = 215 Score = 23.9 bits (53), Expect = 8.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Query: 9 APVFAMGTALISC 21 A VF + ALI C Sbjct: 164 AVVFGLIIALIGC 176 >gnl|CDD|34819 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]. Length = 427 Score = 24.0 bits (51), Expect = 9.2 Identities = 9/33 (27%), Positives = 14/33 (42%) Query: 15 GTALISCDSASDPAKKSNITPIPPAPVALAAPP 47 +A+ S +A K + P+P P PP Sbjct: 368 SSAVFSKATAEPAFKSAMAIPMPSMPHVQGFPP 400 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.309 0.127 0.348 Gapped Lambda K H 0.267 0.0492 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 960,507 Number of extensions: 38987 Number of successful extensions: 152 Number of sequences better than 10.0: 1 Number of HSP's gapped: 150 Number of HSP's successfully gapped: 22 Length of query: 88 Length of database: 6,263,737 Length adjustment: 57 Effective length of query: 31 Effective length of database: 5,032,024 Effective search space: 155992744 Effective search space used: 155992744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 51 (24.0 bits)