RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780907|ref|YP_003065320.1| hypothetical protein CLIBASIA_04030 [Candidatus Liberibacter asiaticus str. psy62] (88 letters) >gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional. Length = 991 Score = 27.5 bits (61), Expect = 0.67 Identities = 15/56 (26%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 11 VFAMGTALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTE--APKTESSNKDKA 64 VF GT ++ D A PPAP PP+ AP A Sbjct: 894 VFGPGTGRVATAPGGDAASAPPPGAGPPAPPQAVPPPRTTQPPAAPPRGPDVPPAA 949 >gnl|CDD|178698 PLN03153, PLN03153, hypothetical protein; Provisional. Length = 537 Score = 26.0 bits (57), Expect = 2.1 Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Query: 29 KKSNITPIPPAPVALAAPPKNKTEAPK----TESSNKDKAKEITLDIIDLGI 76 +TP+PP P + + P + + +E E++L+ I GI Sbjct: 77 HHPIVTPLPPPPSSPSLPSSLLLDHFRNRSLSEIERLKVEAELSLNHIMFGI 128 >gnl|CDD|183391 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed. Length = 1228 Score = 25.6 bits (57), Expect = 2.8 Identities = 11/44 (25%), Positives = 16/44 (36%) Query: 23 SASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSNKDKAKE 66 + + PA + P PA A AA A ++ A E Sbjct: 71 APAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVE 114 Score = 25.6 bits (57), Expect = 2.9 Identities = 7/36 (19%), Positives = 11/36 (30%) Query: 23 SASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTES 58 + + + PP P A AA P + Sbjct: 69 APAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAA 104 >gnl|CDD|152182 pfam11746, DUF3303, Protein of unknown function (DUF3303). Several members are annotated as being LysM domain-like proteins, but these did not match any LysM domains reported in the literature. Length = 91 Score = 25.7 bits (57), Expect = 2.8 Identities = 8/24 (33%), Positives = 11/24 (45%) Query: 2 KLLFSKIAPVFAMGTALISCDSAS 25 +LL AP G A++ D A Sbjct: 38 ELLGRWHAPGSGRGFAIVEADDAK 61 >gnl|CDD|178437 PLN02844, PLN02844, oxidoreductase/ferric-chelate reductase. Length = 722 Score = 25.6 bits (56), Expect = 3.2 Identities = 12/45 (26%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Query: 18 LISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSNKD 62 LI + P++ + + V +AA + KT KT S D Sbjct: 555 LIGLNHIFIPSEHKS-----HSGVKMAASGEMKTAKEKTPSWVVD 594 >gnl|CDD|166661 PLN03020, PLN03020, low-temperature-induced protein; Provisional. Length = 556 Score = 25.0 bits (54), Expect = 4.8 Identities = 11/44 (25%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Query: 35 PIPPAPVALAAPPK--NKTEAPKTESSNKDKAKEITLDIIDLGI 76 P+ PA P+ + E P + + +K T I D I Sbjct: 288 PLSPAETKSTEDPQSTSNAEKPSNQKTYTEKISSATSAIADKAI 331 >gnl|CDD|163433 TIGR03721, exospore_TM, BclB C-terminal domain. This domain occurs as the C-terminal region in a number of proteins that have extensive collagen-like triple helix repeat regions. Member domains are predicted by TmHMM to have four or five transmembrane helices. Members are found mostly in the Firmicutes, but also in Acanthamoeba polyphaga mimivirus. Members include spore surface glycoprotein BclB from Bacillus anthracis, a protein of the exosporium. The exosporium is an additional outermost spore layer, lacking in B. subtilis and most other spore formers, consisting of a basal layer and, above it, a nap of fine filaments. Length = 165 Score = 24.9 bits (54), Expect = 5.5 Identities = 15/42 (35%), Positives = 20/42 (47%) Query: 5 FSKIAPVFAMGTALISCDSASDPAKKSNITPIPPAPVALAAP 46 FS A + +G I+ PA + TP+P APV L P Sbjct: 68 FSATAALALLGPVTITAQLYIAPAPSNVFTPVPGAPVTLTPP 109 >gnl|CDD|181844 PRK09424, pntA, NAD(P) transhydrogenase subunit alpha; Provisional. Length = 509 Score = 24.4 bits (54), Expect = 6.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Query: 37 PPAPVALAAPPKNKTEAPKTESSNKDKA 64 PP P+ ++A P AP + K A Sbjct: 369 PPPPIQVSAAPAAAAAAPAAKEEEKKPA 396 >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional. Length = 620 Score = 24.5 bits (53), Expect = 6.5 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Query: 23 SASDPAKKSNITP--IPPAPVALAAPPKNKTEAPKTESSNK 61 A P+ S TP PP + PP + AP+ +S K Sbjct: 418 PAELPSPASAPTPEQQPPVARSAPLPPSPQASAPRNVASGK 458 >gnl|CDD|179276 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional. Length = 475 Score = 24.5 bits (53), Expect = 6.8 Identities = 12/55 (21%), Positives = 16/55 (29%) Query: 11 VFAMGTALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSNKDKAK 65 +F G A + PA P AP+ E KDK + Sbjct: 8 IFGKGEAEQPAPAPPSPAAAPAPPPPAKTAAPATKAAAPAAAAPRAEKPKKDKPR 62 >gnl|CDD|148336 pfam06674, DUF1176, Protein of unknown function (DUF1176). This family consists of several hypothetical bacterial proteins of around 340 residues in length. Members of this family contain six highly conserved cysteine residues. The function of this family is unknown. Length = 338 Score = 24.3 bits (53), Expect = 7.4 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 9/59 (15%) Query: 16 TALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSNKDKAKEITLDIIDL 74 TAL+ + PA S++ P PP PV AAP P + +A+ + I+ L Sbjct: 153 TALVR--KGTKPA--SSVPPAPPLPVIRAAPA-----PPAAAPLDPAEARLLADPILAL 202 >gnl|CDD|185607 PTZ00422, PTZ00422, glideosome-associated protein 50; Provisional. Length = 394 Score = 24.4 bits (53), Expect = 7.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 15 GTALISCDSASDPAKKSNI 33 GTA I+C S + +KS + Sbjct: 267 GTAHINCGSGGNSGRKSIM 285 >gnl|CDD|179396 PRK02255, PRK02255, putrescine carbamoyltransferase; Provisional. Length = 338 Score = 24.3 bits (53), Expect = 7.8 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Query: 61 KDKAKEITLDIIDLGIDLLTKEDKKEGA 88 D KE LDII+LG L KE K G Sbjct: 10 NDFTKEEILDIIELG--LKLKEAIKNGY 35 >gnl|CDD|178744 PLN03205, PLN03205, ATR interacting protein; Provisional. Length = 652 Score = 23.9 bits (51), Expect = 9.6 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Query: 28 AKKSNITPIPPA--PVALAAPPKNKTEAPKTESSN 60 AK +PP P L APP ++ P T+ S+ Sbjct: 24 AKADMYRLLPPPSLPTFLPAPPVSEMTTPSTKISS 58 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.309 0.127 0.348 Gapped Lambda K H 0.267 0.0602 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,355,053 Number of extensions: 69141 Number of successful extensions: 240 Number of sequences better than 10.0: 1 Number of HSP's gapped: 232 Number of HSP's successfully gapped: 51 Length of query: 88 Length of database: 5,994,473 Length adjustment: 57 Effective length of query: 31 Effective length of database: 4,762,817 Effective search space: 147647327 Effective search space used: 147647327 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 50 (23.3 bits)