BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780908|ref|YP_003065321.1| hypothetical protein
CLIBASIA_04035 [Candidatus Liberibacter asiaticus str. psy62]
         (35 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780908|ref|YP_003065321.1| hypothetical protein CLIBASIA_04035 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 35

 Score = 71.6 bits (174), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%)

Query: 1  MMLLFLAGSDAESQEMRAVPIANTGAILEKSNFIV 35
          MMLLFLAGSDAESQEMRAVPIANTGAILEKSNFIV
Sbjct: 1  MMLLFLAGSDAESQEMRAVPIANTGAILEKSNFIV 35


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.320    0.132    0.343 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,759
Number of Sequences: 1233
Number of extensions: 309
Number of successful extensions: 1
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 35
length of database: 328,796
effective HSP length: 9
effective length of query: 26
effective length of database: 317,699
effective search space:  8260174
effective search space used:  8260174
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)
S2: 31 (16.5 bits)