BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780909|ref|YP_003065322.1| hypothetical protein
CLIBASIA_04040 [Candidatus Liberibacter asiaticus str. psy62]
         (159 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780909|ref|YP_003065322.1| hypothetical protein CLIBASIA_04040 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040586|gb|ACT57382.1| hypothetical protein CLIBASIA_04040 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 159

 Score =  203 bits (516), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 159/159 (100%), Positives = 159/159 (100%)

Query: 1   MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARK 60
           MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARK
Sbjct: 1   MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARK 60

Query: 61  AAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD 120
           AAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD
Sbjct: 61  AAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD 120

Query: 121 AEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159
           AEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED
Sbjct: 121 AEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159


>gi|289618583|emb|CBI54827.1| unnamed protein product [Sordaria macrospora]
          Length = 1145

 Score = 49.1 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 6/99 (6%)

Query: 37   ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVA 96
            E+ ++++D   +K AE+A +   KAAE+A +  +KAAEK     +K  +  ++V E    
Sbjct: 1049 EKVESVVDNVKEKVAERAEQVQEKAAEKAEQVQEKAAEKAEQVQEKVAERAEQVQE---- 1104

Query: 97   ANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDG 135
               +   ++ Q+ V+ K    +  AE+   EK Q  T+ 
Sbjct: 1105 -KAQEAGEKAQEVVLEKADQVEKKAEQV-GEKDQEKTEA 1141


>gi|170784800|ref|YP_001718716.1| hypothetical chloroplast RF19 [Trachelium caeruleum]
 gi|157267548|gb|ABV26541.1| hypothetical chloroplast RF19 [Trachelium caeruleum]
          Length = 2136

 Score = 47.6 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 16/116 (13%)

Query: 43  LDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
           +DE TQK   +  E  +K   +  E  +K   +I   D+K  K + E++E         +
Sbjct: 823 IDEKTQKTDNEIDEKTQKTDNEIDEKTQKTDNEI---DEKTQKTDNEIDE---------K 870

Query: 103 SQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKE 158
           +Q+T  ++  K  T +TD E   +EK Q T + I+ ++   +    KDK  E  +E
Sbjct: 871 TQKTDNEIDEK--TQKTDNEI--DEKTQKTDNEIDEKTQKNDKTQKKDKTQETDEE 922


>gi|242242559|ref|ZP_04797004.1| FtsK/SpoIIIE family DNA translocase [Staphylococcus epidermidis
           W23144]
 gi|242233986|gb|EES36298.1| FtsK/SpoIIIE family DNA translocase [Staphylococcus epidermidis
           W23144]
          Length = 797

 Score = 46.8 bits (109), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 38/136 (27%), Positives = 62/136 (45%), Gaps = 28/136 (20%)

Query: 40  KALLDEATQKAAEKAAEAARKAAEQ----AAEAAKKAAEKIIHKDKKKPKENQEV----- 90
           K+L D   + ++  A+E+ ++  EQ      E A+   EKI  K +KK ++N  V     
Sbjct: 186 KSLFDN-LKSSSNHASESIKQKREQNKIKKEEKAQLKEEKIERKKQKKSRQNNNVIKDVS 244

Query: 91  --------NEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNA 142
                   N++P+  + E   QE ++Q     TT+Q       NE+ Q +     NQS  
Sbjct: 245 DFPEISQSNDIPIYGHNE---QEDKRQ----NTTNQRQKRVLDNEQFQQSLPSTKNQSIN 297

Query: 143 TNDPSSKDKIAENTKE 158
            N PS+    AEN ++
Sbjct: 298 NNQPSTT---AENNQQ 310


>gi|159126350|gb|EDP51466.1| THO complex component (Rlr1), putative [Aspergillus fumigatus A1163]
          Length = 2473

 Score = 46.4 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 39/144 (27%), Positives = 60/144 (41%), Gaps = 25/144 (17%)

Query: 15   STTMASCGQADPVAPPPPQTLAERG-----------------KALLDEATQKAAEKAAEA 57
            STT AS   A P   PPP    E G                  A + + + K  E + + 
Sbjct: 1620 STTPASLNAAAPEFKPPPSAEPEGGPRQEVTKKSEVEDGEIEDAKMTDVSAKDIETSNQV 1679

Query: 58   ARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAAN-----IEPESQE--TQQQV 110
            A+K AE+ AEAA +  E+ I     +    Q  +E PVA+      +E  S    +    
Sbjct: 1680 AQKPAEK-AEAASRQGEESIVTQPPETTSTQPTSEKPVASTEAYTGVELPSHPRISDSPA 1738

Query: 111  INKTTTSQTDAEKTPNEKRQGTTD 134
             +KT T  +++ + PN  R+  +D
Sbjct: 1739 ASKTATKASESGRLPNVPRRPESD 1762


>gi|262282126|ref|ZP_06059895.1| glucosyltransferase G [Streptococcus sp. 2_1_36FAA]
 gi|262262580|gb|EEY81277.1| glucosyltransferase G [Streptococcus sp. 2_1_36FAA]
          Length = 1576

 Score = 46.4 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 32  PQTLA-ERGKALLDEATQKAAEKAAEAAR-KAAEQAAEAAKKAAEKIIHKDKKKPKENQE 89
           P+ L  E G    D+A Q A  K   A + K  EQA   + K AE    + K++   ++E
Sbjct: 30  PKALGIESGVIYADDANQVADVKEQSAVQSKDTEQAI--SDKGAEPSQLEAKEQASSSKE 87

Query: 90  VNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSK 149
             +   A N     Q TQQ           + E T  + RQ  T  +++ S+  ND S +
Sbjct: 88  TYQASAATNPTANEQTTQQD---------KEVETTRTDSRQELTQKVSDDSSEKNDSSQE 138

Query: 150 DKIAENTK 157
            K+A+  +
Sbjct: 139 PKVADQAE 146


>gi|146324095|ref|XP_001481502.1| THO complex component (Rlr1) [Aspergillus fumigatus Af293]
 gi|129558071|gb|EBA27443.1| THO complex component (Rlr1), putative [Aspergillus fumigatus Af293]
          Length = 2473

 Score = 46.4 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 39/144 (27%), Positives = 60/144 (41%), Gaps = 25/144 (17%)

Query: 15   STTMASCGQADPVAPPPPQTLAERG-----------------KALLDEATQKAAEKAAEA 57
            STT AS   A P   PPP    E G                  A + + + K  E + + 
Sbjct: 1620 STTPASLNAAAPEFKPPPSAEPEGGPRQEVTKKSEVEDGEIEDAKMTDVSAKDIETSNQV 1679

Query: 58   ARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAAN-----IEPESQE--TQQQV 110
            A+K AE+ AEAA +  E+ I     +    Q  +E PVA+      +E  S    +    
Sbjct: 1680 AQKPAEK-AEAASRQGEESIVTQPPETTSTQPTSEKPVASTEAYTGVELPSHPRISDSPA 1738

Query: 111  INKTTTSQTDAEKTPNEKRQGTTD 134
             +KT T  +++ + PN  R+  +D
Sbjct: 1739 ASKTATKASESGRLPNVPRRPESD 1762


>gi|322804787|emb|CBZ02340.1| N-acetylmuramoyl-L-alanine amidase [Clostridium botulinum H04402
           065]
          Length = 772

 Score = 45.7 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 36/104 (34%), Positives = 54/104 (51%), Gaps = 20/104 (19%)

Query: 36  AERGKALLDEATQKAAEKAA-----EAARKAAEQAA-----EAAKKAAEKIIHKD----K 81
           A+R +A  +EA +KAAE+A      EA RKAAE+A      EA +KAAE+   K+    +
Sbjct: 563 AQRKEA--EEAQRKAAEEAQRKEAEEAQRKAAEEAQRKEAEEAQRKAAEEAQRKEAEEAQ 620

Query: 82  KKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTP 125
           +K  E  +  E   A   E E++ ++ Q   ++  S    EK P
Sbjct: 621 RKAAEEAQRKEAEEAQRKEAEAEASESQQKEQSNVS----EKAP 660


>gi|159470999|ref|XP_001693644.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158283147|gb|EDP08898.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 988

 Score = 45.3 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 48/112 (42%), Gaps = 20/112 (17%)

Query: 36  AERGKALLDEATQKAAEKAAE------AARKAAEQAA--------------EAAKKAAEK 75
           A R K  LD A Q A  +AAE      AAR  AEQAA              EA  KAA  
Sbjct: 113 ALREKLELDLALQAAHRQAAELGEQLRAARSEAEQAAQRTAVPPGLAEELLEARSKAALL 172

Query: 76  IIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNE 127
           +  +D  + + +    E+  A +     QE  QQ++ +T TS +    T  E
Sbjct: 173 VAERDSLRQQVDGLRAELAAAQDTAASRQEVIQQLMQRTETSSSQGHATAAE 224


>gi|206975864|ref|ZP_03236775.1| collagen adhesion protein [Bacillus cereus H3081.97]
 gi|206745958|gb|EDZ57354.1| collagen adhesion protein [Bacillus cereus H3081.97]
          Length = 3386

 Score = 44.9 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 6/113 (5%)

Query: 44  DEATQKAAE-KAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
           D A + A E K+ +  +   EQ    A+K AE+  + D +KP E Q+ N+    A    E
Sbjct: 184 DTAPKPAEEQKSNDVQKPVEEQKNNDAQKPAEEQKNNDAQKPAEEQKNNDAQKPA----E 239

Query: 103 SQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAEN 155
            Q               DA+K   E++ G T     Q   + DPS K +I EN
Sbjct: 240 EQNNNDAQKPAEEQKNNDAQKPVEEQKNGETQQSTEQPGDSPDPSPK-QITEN 291


>gi|71756179|ref|XP_829004.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|70834390|gb|EAN79892.1| hypothetical protein, conserved [Trypanosoma brucei]
          Length = 887

 Score = 44.9 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 12/119 (10%)

Query: 50  AAEKAAEAARKAAEQAAEAAKKAAEKIIHKD----KKKPKENQEVNEVPVAANIEPESQE 105
            A K AE     ++Q +E AK+A  + I  +     +KP + ++ NE    A  +P++ +
Sbjct: 735 GAAKEAETEEIGSKQISETAKEADTEEIDSEWTSEARKPSDTEDANEKTSEAAKDPDNDD 794

Query: 106 TQQQVINKTTTSQTDAEKTPNE------KRQGTTDGINNQSNATNDPSSKDKIAENTKE 158
           T+ +    +  ++ DAE+  ++      KR GT       S A  DP ++D  ++ T E
Sbjct: 795 TESK--QTSEAAKVDAEEIGSDQASEAMKRSGTEGASERTSEAAKDPDTEDTESKQTSE 851


>gi|134058585|emb|CAK44621.1| unnamed protein product [Aspergillus niger]
          Length = 1193

 Score = 44.9 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 6/86 (6%)

Query: 46  ATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE--S 103
           +T + AE A+  A + +EQ   +AK AAE+     K  PK  QE+  VP +  + PE   
Sbjct: 50  STARNAEPASSPAERVSEQRRGSAKGAAER----KKSVPKFKQELEPVPSSDLVIPEEDE 105

Query: 104 QETQQQVINKTTTSQTDAEKTPNEKR 129
           QE   Q   +    ++D+E   ++++
Sbjct: 106 QEDNAQAKKQVNYVESDSEGEDDDEK 131


>gi|317038145|ref|XP_001401672.2| DNA mismatch repair protein Msh6 [Aspergillus niger CBS 513.88]
          Length = 1210

 Score = 43.7 bits (101), Expect = 0.007,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 15/113 (13%)

Query: 46  ATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQE 105
           +T + AE A+  A + +EQ   +AK AAE+     K  PK  QE+  VP +  + PE  E
Sbjct: 50  STARNAEPASSPAERVSEQRRGSAKGAAER----KKSVPKFKQELEPVPSSDLVIPEEDE 105

Query: 106 TQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKE 158
            +            +A+++PN K +  T   + ++    +    D   E+  E
Sbjct: 106 QED-----------NAQESPNGKAELKTASPSRRAKKQVNYVESDSEGEDDDE 147


>gi|313240805|emb|CBY33097.1| unnamed protein product [Oikopleura dioica]
          Length = 954

 Score = 43.7 bits (101), Expect = 0.008,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 71/160 (44%), Gaps = 18/160 (11%)

Query: 11  LSLLSTTMASCGQADPVAP------PPPQTLAERGKALLDEATQKAAEKAAEAARKAAE- 63
           L +L   MA   + +P+         PP+   E G  +  ++ +++      A  ++ + 
Sbjct: 125 LKVLEDLMADHPEPEPIKKKMDQIQAPPEGYEESGLLVNTDSLEESHPSEPPAVYRSDKP 184

Query: 64  --QAAEAAKKAAEKIIHKDKKKPKENQEVN--EVPVAANIEPESQETQQQVINKTTTSQT 119
              A E A KAAE +  + + KP+EN E +  E+PV     P S+E+             
Sbjct: 185 DISAEEIASKAAEVLEIETEAKPEENNEEDKSEMPVVTLEAPPSEES-------VKVESD 237

Query: 120 DAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159
           + +K+ NEK   +T+    +  A    ++K +++E +  D
Sbjct: 238 ELKKSDNEKDTDSTEMSIEKKEAEVIAAAKFEVSEKSGPD 277


>gi|325115206|emb|CBZ50761.1| tsp1 domain-containing protein TSP12 (Precursor),related [Neospora
           caninum Liverpool]
          Length = 1335

 Score = 43.7 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 61/156 (39%), Gaps = 9/156 (5%)

Query: 11  LSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEA--TQKAAEKAAEAARK-----AAE 63
           +S ++ T A  G  DP    PP   ++ G     EA  +  A+EK A++        A +
Sbjct: 289 VSEVAETPAEAGTDDPTGNNPPSPESDSGNTATQEAFTSTDASEKGADSESNSPDPTAGQ 348

Query: 64  QAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEK 123
            A +      EK    D +   + Q  N    + +I PE+ +       + T   T   +
Sbjct: 349 SAGDTTPGTGEK--GTDSQTVHDGQVHNLTTDSQDILPENHQGVNGAFTEPTAEDTTEAE 406

Query: 124 TPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159
           T  +  +   DG+  Q +  +  SS + I+     D
Sbjct: 407 TNTQMPKHEKDGVVRQRDRMDAHSSAESISSKAPAD 442


>gi|283781747|ref|YP_003372502.1| protein-export membrane protein SecD [Pirellula staleyi DSM 6068]
 gi|283440200|gb|ADB18642.1| protein-export membrane protein SecD [Pirellula staleyi DSM 6068]
          Length = 1192

 Score = 43.7 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 50/175 (28%), Positives = 71/175 (40%), Gaps = 37/175 (21%)

Query: 13  LLSTTMASCGQADPV----APPPPQTLAERGKALLDEATQK-----------------AA 51
           LL TT A    A PV    A PPP  +  R       AT+K                 AA
Sbjct: 695 LLLTTFAMSADA-PVEVKEATPPP--VDTRTPETTPPATEKPGEVPAEVPAEKPAETPAA 751

Query: 52  EKAAEAARKAAEQAAEAAK---KAAEKIIHKDKK----KPKENQEVNEVPVAANIEPESQ 104
           EK AEA  KA E  AEA K   K AE+    ++K    KP E +   E   A + EP ++
Sbjct: 752 EKPAEAP-KAEEPPAEAPKAEDKPAEEAPKTEEKPADEKPAEEKPAEEAKPAESTEPAAE 810

Query: 105 ET-QQQVINKTTTSQTDAEKTPNEKR----QGTTDGINNQSNATNDPSSKDKIAE 154
            + Q+   +     +   E+ P E++        +    +    + P ++DK AE
Sbjct: 811 GSCQEPAADDKPADEAKPEEKPAEEKPAETTPPAEAAPAEEKPADAPKTEDKPAE 865


>gi|225076679|ref|ZP_03719878.1| hypothetical protein NEIFLAOT_01730 [Neisseria flavescens
           NRL30031/H210]
 gi|224951955|gb|EEG33164.1| hypothetical protein NEIFLAOT_01730 [Neisseria flavescens
           NRL30031/H210]
          Length = 1064

 Score = 43.7 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 33  QTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNE 92
           Q  A   KA   E     A+ AA AA   AEQA ++A++ AE +   D+K  +  ++   
Sbjct: 842 QINAASSKANQAETKAGQAQTAANAASGKAEQAKKSAEQNAETLREIDRKVTQFGKDSKA 901

Query: 93  VPVA-ANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNAT 143
           V    AN+E  ++ T   +  KT       +K      Q T DGI N S  T
Sbjct: 902 VATTVANLENATRST---LTIKTEAQTAGGQKVVTGISQ-TADGITNTSKVT 949


>gi|308477079|ref|XP_003100754.1| hypothetical protein CRE_15509 [Caenorhabditis remanei]
 gi|308264566|gb|EFP08519.1| hypothetical protein CRE_15509 [Caenorhabditis remanei]
          Length = 317

 Score = 43.3 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 50/99 (50%), Gaps = 12/99 (12%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKK-KPKENQE-VNEV 93
           AE+ K L+   TQK  EK AE  RK A    EA K A   +IH+ +    KE Q+ +N++
Sbjct: 186 AEKTKLLVAHQTQKVVEKLAETERKKA--VIEAEKLAQVALIHQKQLITEKETQKLLNQL 243

Query: 94  PVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGT 132
              +N+E +   T++        S+ +AE    EK+  +
Sbjct: 244 EAESNLESKFTATEK--------SRANAEFYKAEKQAAS 274


>gi|116207902|ref|XP_001229760.1| hypothetical protein CHGG_03244 [Chaetomium globosum CBS 148.51]
 gi|88183841|gb|EAQ91309.1| hypothetical protein CHGG_03244 [Chaetomium globosum CBS 148.51]
          Length = 493

 Score = 43.3 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 24  ADPVAPPPP-QTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEA---AKKAAEKIIHK 79
           A P +PPP       RG+    +A +K + +   ++RK+++ A E+   A+K  E + H 
Sbjct: 376 AQPASPPPSGAATTSRGRKRKSDAAEKQSNQEKPSSRKSSKAAVESVAQAQKQPEPVAHP 435

Query: 80  DKKKPKENQEVNEVPVAANIEPESQETQQQV 110
           +  +  E+Q+  +  +   ++P+  +T Q +
Sbjct: 436 ELDQWYEHQKSLQTFIQGCVQPDDAQTLQYI 466


>gi|260941149|ref|XP_002614741.1| hypothetical protein CLUG_05519 [Clavispora lusitaniae ATCC 42720]
 gi|238851927|gb|EEQ41391.1| hypothetical protein CLUG_05519 [Clavispora lusitaniae ATCC 42720]
          Length = 504

 Score = 43.3 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 60/131 (45%), Gaps = 10/131 (7%)

Query: 22  GQADPVAPPPPQ--TLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHK 79
            Q D + PP  +  T+     A L     + A     AA  A E +      A    +++
Sbjct: 208 AQLDKIVPPGEEKDTVVVIPGAGLGRVAHEVACHRPFAAVHAVEYSG--LMHACHLYMYR 265

Query: 80  DKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQ 139
           DK+  +EN +  E   A++ E + +ET     N+   S +D+EK    KR+ T++  N +
Sbjct: 266 DKQATEENADTEEKESASDSENKKRETTSDSENRKRESTSDSEK---RKRESTSESENGK 322

Query: 140 --SNATNDPSS 148
             SNA+  PSS
Sbjct: 323 KTSNASA-PSS 332


>gi|70954236|ref|XP_746174.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56526705|emb|CAH79695.1| conserved hypothetical protein [Plasmodium chabaudi chabaudi]
          Length = 570

 Score = 43.0 bits (99), Expect = 0.013,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 20/120 (16%)

Query: 55  AEAARKAAEQAAEAAKK-AAEKII--HKDKKKPKENQEVNEVPVAANIEPESQETQQQVI 111
           +E     +  A   AKK  A+K+I  H  ++   +N+  N + +   IE E+ E      
Sbjct: 434 SERGHSTSHMAGSFAKKIQAKKLILTHFSQRYTGDNKLKNMI-IMKKIEEEALEAFHSDR 492

Query: 112 NKTTTSQTDAEKTPNE----------------KRQGTTDGINNQSNATNDPSSKDKIAEN 155
           NK+  S    + TPNE                K++  T+ +N Q+N+ N   +K+ I EN
Sbjct: 493 NKSHISSEKKDITPNENIKKVNLVHVSNFNNEKKEDNTESVNRQNNSANFSKTKNDIQEN 552


>gi|168177854|ref|ZP_02612518.1| putative peptidoglycan hydrolase [Clostridium botulinum NCTC 2916]
 gi|182670514|gb|EDT82488.1| putative peptidoglycan hydrolase [Clostridium botulinum NCTC 2916]
          Length = 774

 Score = 43.0 bits (99), Expect = 0.014,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 14/97 (14%)

Query: 36  AERGKALLDEATQKAAEK-----AAEAARKAAEQAA-----EAAKKAAEKIIHKDKKKP- 84
           A+R +A  +EA +K AE+     A EA RKAAE+A      EA +KAAE+   K+ ++  
Sbjct: 573 AQRKEA--EEAQRKVAEETQRKEAEEAQRKAAEEAQRKEAEEAQRKAAEETQRKEAEEAQ 630

Query: 85  -KENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD 120
            KE +E       A      Q+ Q  V  K   +  D
Sbjct: 631 RKEAEEAQRKAAEAEASKSQQKEQSNVSEKAPATNGD 667


>gi|300812101|ref|ZP_07092549.1| ATP-dependent metallopeptidase HflB [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|300496940|gb|EFK32014.1| ATP-dependent metallopeptidase HflB [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
          Length = 737

 Score = 42.6 bits (98), Expect = 0.018,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 14/110 (12%)

Query: 45  EATQKAAEKAAEAARKAAEQAAE--AAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
           EA   + E+A EAA+K AE+ AE   A+K A     +D  KP       E   A   EP+
Sbjct: 639 EAKALSYEEAKEAAQKRAEEKAEEDTAEKQALATPSEDAVKP-------ETDAAKLAEPD 691

Query: 103 SQETQQQVINK-TTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
           +  +Q+   +   T S++D  K P    +G  D  + ++  T+D S KD+
Sbjct: 692 ASASQEDPADSLPTPSESDLAKDP---EKGDNDAPSQKTEQTDD-SDKDE 737


>gi|297812313|ref|XP_002874040.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
 gi|297319877|gb|EFH50299.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
          Length = 960

 Score = 42.6 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 22/126 (17%)

Query: 37  ERGKALLDEATQKAA---EKAAEAARKAAEQAAE----AAKKAAEKIIHKDKKKPKENQE 89
           E+G A   ++T   A     AAE A   +EQA+E    AA++   K   KDK K K+ +E
Sbjct: 13  EKGNASAPKSTSSKAGPARNAAETAPLKSEQASEDLETAARRKTSKFFGKDKTKVKDEKE 72

Query: 90  VNEVPVAANIEPESQETQQQVINKTTT--------------SQTDAEKTPNEK-RQGTTD 134
           V E+P    ++ +S +  +    K T               S+   + TP++K + G+  
Sbjct: 73  VEEIPAKRKLKTDSDDLAKPRPRKVTKVVDDDDDDDFDVPISRKTRDSTPSKKLKSGSGR 132

Query: 135 GINNQS 140
           GI +++
Sbjct: 133 GIASKT 138


>gi|126321611|ref|XP_001366088.1| PREDICTED: similar to Zinc finger protein 532 isoform 1
           [Monodelphis domestica]
          Length = 1301

 Score = 42.6 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 16/117 (13%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKEN----QEVN 91
           +E+ +A L  A Q  A+ +A+ +   A  AA +AKKAA     +     +E     +E+N
Sbjct: 246 SEKNEASLASAAQSKAKSSAKLSSCIAAIAALSAKKAATDTCKEPVANSREPSPLPKEIN 305

Query: 92  EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSS 148
           + P A    PESQ            S  D+ K P+ K   +   +++++++   PSS
Sbjct: 306 DSPRAVEKSPESQ------------SLIDSAKKPSIKPPDSPRSVSSENSSKGSPSS 350


>gi|118368035|ref|XP_001017227.1| HECT domain and RCC1-like domain-containing protein [Tetrahymena
            thermophila]
 gi|89298994|gb|EAR96982.1| HECT domain and RCC1-like domain-containing protein [Tetrahymena
            thermophila SB210]
          Length = 5350

 Score = 42.2 bits (97), Expect = 0.022,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 55/105 (52%), Gaps = 9/105 (8%)

Query: 37   ERGKALLDEATQ-KAAEKAAEAARKAAEQAAEA---AKKAAEKIIHKDKKKPKENQEVNE 92
            E+ K L ++  Q +  EK  +  +K  E+AA+      K  EKI+ + KK     Q    
Sbjct: 1987 EQNKILQEKKAQLEQIEKEEQLKKKQQEEAAQKPAIQSKPTEKIVKQGKKIKFIRQGA-- 2044

Query: 93   VPVAANIEPESQETQQQVINKTT--TSQTDAEKTPNEKRQGTTDG 135
             P++++ +P+S + Q++V N+ T  TS ++ EK   ++ Q   +G
Sbjct: 2045 -PISSSNKPKSSQPQKEVGNQQTNQTSASNTEKNNEKESQKLQNG 2088


>gi|328875155|gb|EGG23520.1| hypothetical protein DFA_05653 [Dictyostelium fasciculatum]
          Length = 859

 Score = 42.2 bits (97), Expect = 0.024,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 32/58 (55%)

Query: 81  KKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINN 138
           KKK +E ++   + +     P SQ+ Q+Q + + +  + D ++ P+E RQ   + +NN
Sbjct: 785 KKKQQEIEKEEAIKLNQQTVPASQDEQEQAVEQRSNKEKDDQQQPSENRQEVQEELNN 842


>gi|149017798|ref|ZP_01834257.1| hypothetical protein CGSSp23BS72_10685 [Streptococcus pneumoniae
           SP23-BS72]
 gi|147931362|gb|EDK82340.1| hypothetical protein CGSSp23BS72_10685 [Streptococcus pneumoniae
           SP23-BS72]
          Length = 614

 Score = 42.2 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 68/159 (42%), Gaps = 18/159 (11%)

Query: 5   KYQIILLSLLSTTMASCGQADPVAPPPPQTLAERG---KALLDEATQKAAEKAAEAARKA 61
           K ++IL SL S  +   G    VA  P    AE     K    E    AA K +EAA+K 
Sbjct: 3   KKKMILTSLASVAILGAGF---VASQPTVVRAEEAPVAKQSQAERDYDAAMKKSEAAKKE 59

Query: 62  AEQAAE--AAKKAAEKIIHKDKKKPKEN----QEVNEVPVAANIEPESQETQQQVINKTT 115
            E+A +     KAA+K    D+KK +E     Q+ +E    AN+        Q+   K  
Sbjct: 60  YEEAKKDLEEAKAAQKKYEDDQKKTEEKAKLVQKADEERQKANV------AVQKAYLKLR 113

Query: 116 TSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAE 154
            +Q    K+PN K+      + +     ++ + K K AE
Sbjct: 114 EAQEQLNKSPNNKKNAAQQKLKDALAHIDEVTLKQKEAE 152


>gi|7497322|pir||T32896 hypothetical protein C42C1.9 - Caenorhabditis elegans
          Length = 586

 Score = 42.2 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQE--VNEV 93
           AE+ K L+ + TQK  EK AE  RK A   AE A + A  +IH+ +   ++  E  +N++
Sbjct: 186 AEKTKLLVAQETQKVVEKLAETERKKAVIEAEKAAQVA--LIHQKRLLSEKETEKLLNQM 243

Query: 94  PVAANIEPESQETQQQVINKTTTSQTDAEK 123
              +N+  E  +   +        Q D+ K
Sbjct: 244 EAESNLASERSKADAEFYK--AQKQADSNK 271


>gi|330862937|emb|CBX73072.1| hypothetical protein YEW_HI32400 [Yersinia enterocolitica W22703]
          Length = 1785

 Score = 42.2 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 50/125 (40%), Gaps = 16/125 (12%)

Query: 36  AERGKALLDEATQKAAEKA------AEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQE 89
           AE  K     A  KA   A      A +A  AAE  A AA K A+ +  K+  KP   +E
Sbjct: 732 AEEQKINAKTAENKAENDAIKIQGDANSAVNAAENKASAANKNAKGVQQKEGDKPAGRKE 791

Query: 90  -------VNE---VPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQ 139
                  V++   V  AA +  ES        +    ++ D   T    R  T+D IN+ 
Sbjct: 792 AGGSGRRVDQMAYVTSAAAVSDESITDSGNTHDSIMLAKADGSITGGTNRNTTSDIINSG 851

Query: 140 SNATN 144
            NA N
Sbjct: 852 KNAIN 856


>gi|145505021|ref|XP_001438477.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124405649|emb|CAK71080.1| unnamed protein product [Paramecium tetraurelia]
          Length = 1307

 Score = 41.8 bits (96), Expect = 0.028,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 49/115 (42%), Gaps = 10/115 (8%)

Query: 44  DEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPES 103
           +E +Q+   K+  AA+   +  ++   K + K   +DK K KEN +  + P     E   
Sbjct: 816 NEESQQKTSKSQNAAKSKTQNKSQDKNKESSKNKVQDKSKQKENDKEKQKPKDKEKEKSK 875

Query: 104 QETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKE 158
            +TQ         S+ D E    E+ Q   DG   Q+    +   K++  EN +E
Sbjct: 876 AKTQ---------SKADDEDKEKEQEQDQGDG-EQQNEDQENQEEKNEDQENAEE 920


>gi|15612252|ref|NP_223905.1| NADH dehydrogenase subunit G [Helicobacter pylori J99]
 gi|4155777|gb|AAD06753.1| NADH oxidoreductase I [Helicobacter pylori J99]
          Length = 849

 Score = 41.8 bits (96), Expect = 0.030,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 16/91 (17%)

Query: 33  QTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKK--------P 84
           ++L +  ++++DEA  KA E+  + A + AEQ     +   E +  K+ K+        P
Sbjct: 442 KSLEDSKQSIVDEAALKALEEERKKALEQAEQGCSIGENKEEAVASKENKEENKTEAAAP 501

Query: 85  KENQEVNEVPVAANIEPESQETQQQVINKTT 115
           KENQ  N+         E +E + +V  KTT
Sbjct: 502 KENQTENKT--------EVKEEKIEVPTKTT 524


>gi|194756374|ref|XP_001960454.1| GF11501 [Drosophila ananassae]
 gi|190621752|gb|EDV37276.1| GF11501 [Drosophila ananassae]
          Length = 543

 Score = 41.8 bits (96), Expect = 0.031,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 56/134 (41%), Gaps = 4/134 (2%)

Query: 16  TTMASCGQ-ADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE 74
           T +AS G  A P  PP     A++  AL ++ T KAA+         A++AA A  K   
Sbjct: 409 TQVASSGNGAKPKDPPTISPKAKQNNALPNQNTAKAAQPNQRNPNGNAQKAAPAQPKEQA 468

Query: 75  KIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTD 134
           +   K   KP       +VPV   ++P +Q      I   + +Q DA+     +R GT  
Sbjct: 469 EKQPKLPIKPNPKPSAQKVPVP--VQP-NQSKPNPPIKAESGAQPDAKNQNPSQRPGTKP 525

Query: 135 GINNQSNATNDPSS 148
            +       N  SS
Sbjct: 526 QLEPAVEGKNGESS 539


>gi|326916329|ref|XP_003204460.1| PREDICTED: opioid growth factor receptor-like protein 1-like,
           partial [Meleagris gallopavo]
          Length = 403

 Score = 41.8 bits (96), Expect = 0.032,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 49/119 (41%), Gaps = 26/119 (21%)

Query: 59  RKAAEQAAEAAKKAAEKII--------HKDKKKPKENQ----------EVNEVPVAANIE 100
           RK   + ++  KK A  I         HK  K+PK             E  +V +  N E
Sbjct: 238 RKQKSEGSKTNKKPASPISVHGSYISKHKKLKEPKSTSTSGTSVSKATEERKVELTKNGE 297

Query: 101 PESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159
              Q+ Q+           DA K  +EK  GT  G  ++S A +DPS K +   ++K+D
Sbjct: 298 ENDQDEQEM--------NCDAVKQSSEKNSGTDSGQLSKSEAIHDPSDKKEDTSHSKKD 348


>gi|189206215|ref|XP_001939442.1| ISWI chromatin-remodeling complex ATPase ISW2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187975535|gb|EDU42161.1| ISWI chromatin-remodeling complex ATPase ISW2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 1271

 Score = 41.8 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 60/147 (40%), Gaps = 27/147 (18%)

Query: 15  STTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE 74
           + T+AS     P+ PPP +  AE    L    +Q++A+ A +  R +A+Q A       E
Sbjct: 6   TITLAS---PQPITPPPKRRGAEYQDLLAQFRSQRSAQSATKKRRISAQQEAS----QGE 58

Query: 75  KIIHKDKKKP--KENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGT 132
            I   DK KP  +E    N      ++  ++ + +   + + TT  +     P       
Sbjct: 59  TIATDDKSKPSLREQPTPNYAISNTSVNEDTPDRKSTTVPRRTTRASLGRAKPES----- 113

Query: 133 TDGINNQSNATNDPSSKDKIAENTKED 159
                        PSS+D++A + + +
Sbjct: 114 -------------PSSEDELAPSARPN 127


>gi|261188561|ref|XP_002620695.1| condensin complex subunit 1 [Ajellomyces dermatitidis SLH14081]
 gi|239593179|gb|EEQ75760.1| condensin complex subunit 1 [Ajellomyces dermatitidis SLH14081]
 gi|239613251|gb|EEQ90238.1| condensin complex subunit 1 [Ajellomyces dermatitidis ER-3]
 gi|327357437|gb|EGE86294.1| condensin complex subunit 1 [Ajellomyces dermatitidis ATCC 18188]
          Length = 1208

 Score = 41.8 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 8/54 (14%)

Query: 30  PPPQT--LAERGKA------LLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEK 75
           PPP+T  L E   A      LLD+ATQ   E  ++A R   EQ  EA +KAAE+
Sbjct: 497 PPPETPGLGEDVDATNIDSELLDDATQMPDESPSKAPRLTEEQKQEAMRKAAEE 550


>gi|71661658|ref|XP_817847.1| surface protease GP63 [Trypanosoma cruzi strain CL Brener]
 gi|70883063|gb|EAN95996.1| surface protease GP63, putative [Trypanosoma cruzi]
          Length = 727

 Score = 41.8 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 48/121 (39%), Gaps = 1/121 (0%)

Query: 12  SLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKK 71
           S+ ++ +    +    A  P Q LAE     + EA Q+  E+    A  A E  AE  + 
Sbjct: 564 SVAASALPPAQEPHAEASSPVQPLAEMPSPRVQEALQQPREEIKAQASTAEEPHAEEPRA 623

Query: 72  AAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQG 131
           AA     +   +     + +E PVA     + Q+ ++   NKT       +  P    QG
Sbjct: 624 AASTA-EESHAEASIAGKASEAPVAQAASRQPQQEREAGQNKTVGESATTQHVPANTSQG 682

Query: 132 T 132
           +
Sbjct: 683 S 683


>gi|104773522|ref|YP_618502.1| cell division protein FtsH [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|103422603|emb|CAI97206.1| Cell division protein FtsH [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
          Length = 737

 Score = 41.8 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 14/110 (12%)

Query: 45  EATQKAAEKAAEAARKAAEQAAE--AAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
           EA   + E+A EAA+K AE+ AE   A+K A     +D  KP       E   A   EP+
Sbjct: 639 EAKALSYEEAKEAAQKRAEEKAEEDTAEKQALATPSEDAVKP-------ETDAAKLAEPD 691

Query: 103 SQETQQQVINK-TTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
           +  +Q+  ++   T S++D  K P    +   D  + ++  T+D S KD+
Sbjct: 692 ASASQEDPVDSLPTPSESDLSKDP---EKDDNDAPSQKTEQTDD-SDKDE 737


>gi|315047692|ref|XP_003173221.1| condensin complex subunit 1 [Arthroderma gypseum CBS 118893]
 gi|311343607|gb|EFR02810.1| condensin complex subunit 1 [Arthroderma gypseum CBS 118893]
          Length = 1090

 Score = 41.8 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 9/55 (16%)

Query: 30  PPPQT--LAERG-------KALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEK 75
           PPP+T  LAE G         LLD+ATQ   +  ++A R   E+ A A +KAAE+
Sbjct: 406 PPPETPGLAEMGIESTQIDSELLDDATQVPDDSPSKAPRMTEEEKAAAVQKAAEE 460


>gi|226947747|ref|YP_002802838.1| NlpC/P60 family protein [Clostridium botulinum A2 str. Kyoto]
 gi|226841687|gb|ACO84353.1| NlpC/P60 family protein [Clostridium botulinum A2 str. Kyoto]
          Length = 774

 Score = 41.4 bits (95), Expect = 0.036,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 14/97 (14%)

Query: 36  AERGKALLDEATQKAAEK-----AAEAARKAAEQAA-----EAAKKAAEKIIHKDKKKP- 84
           A+R +A  +EA +K AE+     A EA RKAAE+A      E+ +KAAE+   K+ ++  
Sbjct: 573 AQRKEA--EEAQRKVAEETQRKEAEEAQRKAAEEAQRKEAEESQRKAAEETQRKEAEEAQ 630

Query: 85  -KENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD 120
            KE +E       A      Q+ Q  V  K   +  D
Sbjct: 631 RKEAEEAQRKAAEAEASKSQQKEQSNVSEKAPATNGD 667


>gi|170758368|ref|YP_001785852.1| putative peptidoglycan hydrolase [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169405357|gb|ACA53768.1| putative peptidoglycan hydrolase [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 766

 Score = 41.4 bits (95), Expect = 0.036,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 51/111 (45%), Gaps = 18/111 (16%)

Query: 29  PPPPQTLAERGKALLDEATQKAAEKAA-----EAARKAAEQAA-----EAAKKAAEKIIH 78
           P   +   E  +   +EA +KAAE+A      EA RKAAE+A      EA +K AE+   
Sbjct: 548 PVQTKVTEETQRKATEEAQKKAAEEAQRKEAEEAQRKAAEEAQRKEAEEAQRKEAEEAQR 607

Query: 79  KD----KKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTP 125
           K+    ++K  E  +  E   A   E E++  + Q   ++  S    EK P
Sbjct: 608 KEAEEAQRKAAEEAQRKEAEEAQRKEAEAETFKSQQKEQSNVS----EKAP 654


>gi|17539136|ref|NP_502339.1| hypothetical protein C42C1.15 [Caenorhabditis elegans]
 gi|126468485|emb|CAM36358.1| C. elegans protein C42C1.15, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 312

 Score = 41.4 bits (95), Expect = 0.038,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQE--VNEV 93
           AE+ K L+ + TQK  EK AE  RK A   AE A + A  +IH+ +   ++  E  +N++
Sbjct: 186 AEKTKLLVAQETQKVVEKLAETERKKAVIEAEKAAQVA--LIHQKRLLSEKETEKLLNQM 243

Query: 94  PVAANIEPESQETQQQVINKTTTSQTDAEK 123
              +N+  E  +   +        Q D+ K
Sbjct: 244 EAESNLASERSKADAEFYK--AQKQADSNK 271


>gi|317009950|gb|ADU80530.1| NADH dehydrogenase subunit G [Helicobacter pylori India7]
          Length = 843

 Score = 41.4 bits (95), Expect = 0.038,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 12/86 (13%)

Query: 33  QTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKK---PKENQE 89
           ++L +  + ++DEA  KA E+  + A + AEQ     +  AE    +DK +   PKENQE
Sbjct: 442 KSLEDSKQNIVDEAALKALEEERKKALEQAEQGCSIGENKAEN-QEEDKTEAAAPKENQE 500

Query: 90  VNEVPVAANIEPESQETQQQVINKTT 115
            N+         E +E + +V  KTT
Sbjct: 501 ENKT--------EVKEEKIEVPTKTT 518


>gi|297744256|emb|CBI37226.3| unnamed protein product [Vitis vinifera]
          Length = 1540

 Score = 41.4 bits (95), Expect = 0.041,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 59/122 (48%), Gaps = 11/122 (9%)

Query: 37   ERGKALLDEATQKAAE--KAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVP 94
            E+ K+L+    ++  E  K  E   K +E+  + A +A +KI+       +  ++ ++V 
Sbjct: 1008 EKLKSLVSSLEKRIDETQKKYEETNKLSEERLKQALEADQKIVQLKTAMQRLEEKFSDV- 1066

Query: 95   VAANIEPESQETQQQVINKTTTSQ-TDAEKTPNEKRQGTTDGIN-NQSNATNDPSSKDKI 152
                 E E+Q  +QQ + KT   +  D   TP EK QG  +G + ++ N  N+P S   I
Sbjct: 1067 -----ESENQILRQQALLKTPVKRIADILSTP-EKSQGLENGHHLSEENGANEPMSAMPI 1120

Query: 153  AE 154
             E
Sbjct: 1121 KE 1122


>gi|225437918|ref|XP_002268099.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 1518

 Score = 41.4 bits (95), Expect = 0.041,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 59/122 (48%), Gaps = 11/122 (9%)

Query: 37   ERGKALLDEATQKAAE--KAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVP 94
            E+ K+L+    ++  E  K  E   K +E+  + A +A +KI+       +  ++ ++V 
Sbjct: 986  EKLKSLVSSLEKRIDETQKKYEETNKLSEERLKQALEADQKIVQLKTAMQRLEEKFSDV- 1044

Query: 95   VAANIEPESQETQQQVINKTTTSQ-TDAEKTPNEKRQGTTDGIN-NQSNATNDPSSKDKI 152
                 E E+Q  +QQ + KT   +  D   TP EK QG  +G + ++ N  N+P S   I
Sbjct: 1045 -----ESENQILRQQALLKTPVKRIADILSTP-EKSQGLENGHHLSEENGANEPMSAMPI 1098

Query: 153  AE 154
             E
Sbjct: 1099 KE 1100


>gi|156399887|ref|XP_001638732.1| predicted protein [Nematostella vectensis]
 gi|156225855|gb|EDO46669.1| predicted protein [Nematostella vectensis]
          Length = 911

 Score = 41.4 bits (95), Expect = 0.041,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 25  DPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKP 84
           D V+P  P+T A RG+       ++ AE   +A+ K A+  +E A    +K+  K+ K P
Sbjct: 184 DSVSPGVPKTPARRGR-------KRKAEGDPKASYKIADYISEEAIVKKQKLGQKENKTP 236

Query: 85  KENQEVNEVPVAANIEPESQETQQQVINKTT 115
             +  + +VP   + +   +ET  + +  +T
Sbjct: 237 PTSPSIQQVPKGKSPKVSQKETIVESVKHST 267


>gi|209918832|ref|YP_002292916.1| putative phage tail fiber protein [Escherichia coli SE11]
 gi|209912091|dbj|BAG77165.1| putative phage tail fiber protein [Escherichia coli SE11]
          Length = 590

 Score = 41.4 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 17/118 (14%)

Query: 48  QKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVA----------A 97
           Q++AE AAE+ ++A +  A+A K      I +D +   +N ++N   VA          A
Sbjct: 114 QQSAESAAESEQQAGQHVADAQK------IKEDCQTLADNVQLNATAVAEDKQHVEHLAA 167

Query: 98  NIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAEN 155
            +E  + + QQ V    T +   A++  ++      +  NN  NA     S    A+N
Sbjct: 168 EVEQNAGQMQQGV-QSVTDAVKQAQQAADDSASSAEESKNNADNAARSEQSAKSHADN 224


>gi|291459220|ref|ZP_06598610.1| NlpC/P60 family protein [Oribacterium sp. oral taxon 078 str.
           F0262]
 gi|291418474|gb|EFE92193.1| NlpC/P60 family protein [Oribacterium sp. oral taxon 078 str.
           F0262]
          Length = 838

 Score = 41.4 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 48/116 (41%)

Query: 35  LAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVP 94
           +AE      +   Q+   K  E+ R+        + K  E     +  K +E  +  E  
Sbjct: 478 MAESQTQSSESTKQEEGSKQTESTRQTESAKQTESAKQTESARQTESTKQEEGSKQTEST 537

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKD 150
                  +++ T+Q   +K   S   AE     + + T+ G  +++ AT+DP+SK+
Sbjct: 538 KQTESSKQTESTKQTEGSKQAESARGAESRKAPESERTSSGAKSETPATDDPNSKN 593


>gi|218777912|ref|YP_002429230.1| amino acid permease-associated region [Desulfatibacillum
           alkenivorans AK-01]
 gi|218759296|gb|ACL01762.1| transporter, cation-chloride cotransporter (CCC) family (TC 2.A.30)
           [Desulfatibacillum alkenivorans AK-01]
          Length = 873

 Score = 41.0 bits (94), Expect = 0.048,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 16/80 (20%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIH-------------KDKK 82
           AE+  A++ +A Q+A ++AA+  +K+A+  AEA  + A KI+                 +
Sbjct: 796 AEKRAAMVKQA-QEARDEAAKVFKKSAK--AEARLQEAAKIMESLGLTTKAPQAEKNQSE 852

Query: 83  KPKENQEVNEVPVAANIEPE 102
            P E+ E NE P   N+EPE
Sbjct: 853 APAEDSENNEAPENKNVEPE 872


>gi|320034917|gb|EFW16860.1| condensin complex subunit 1 [Coccidioides posadasii str. Silveira]
          Length = 1192

 Score = 41.0 bits (94), Expect = 0.049,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 9/55 (16%)

Query: 30  PPPQT--LAERG-------KALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEK 75
           PPP+T  LAE G         LLD+AT+   E  ++A R   EQ A A KKA E+
Sbjct: 475 PPPETPGLAEMGLENMNIDSELLDDATELLDESPSKAPRMTDEQKAAAIKKAEEE 529


>gi|303310513|ref|XP_003065268.1| HEAT repeat containing protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240104930|gb|EER23123.1| HEAT repeat containing protein [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 1217

 Score = 41.0 bits (94), Expect = 0.049,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 9/55 (16%)

Query: 30  PPPQT--LAERG-------KALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEK 75
           PPP+T  LAE G         LLD+AT+   E  ++A R   EQ A A KKA E+
Sbjct: 500 PPPETPGLAEMGLENMNIDSELLDDATELLDESPSKAPRMTDEQKAAAIKKAEEE 554


>gi|119195425|ref|XP_001248316.1| condensin complex subunit 1 [Coccidioides immitis RS]
          Length = 1192

 Score = 41.0 bits (94), Expect = 0.049,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 9/55 (16%)

Query: 30  PPPQT--LAERG-------KALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEK 75
           PPP+T  LAE G         LLD+AT+   E  ++A R   EQ A A KKA E+
Sbjct: 475 PPPETPGLAEMGLENMNIDSELLDDATELLDESPSKAPRMTDEQKAAAIKKAEEE 529


>gi|170093241|ref|XP_001877842.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164647701|gb|EDR11945.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 1009

 Score = 41.0 bits (94), Expect = 0.050,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 64/125 (51%), Gaps = 14/125 (11%)

Query: 40  KALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHK--DKKKPKENQEVNEVPVAA 97
           K  L+E  ++ A++  E A+K  E+  EAAKK  E+   +  D+KKP E + + E    A
Sbjct: 710 KKRLEEQAKEVAKRLEEEAKKQMEEE-EAAKKQKEEEDARLADEKKPAEEEALKEKQRLA 768

Query: 98  NIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQS-------NATNDPSSKD 150
             + +SQE  ++ +   TT +   E+T  ++  G    I +         + + +PS++D
Sbjct: 769 --DEQSQEAAREALASGTTGEQTEEQT--QQAGGADQEIVHTPKQQKVPFSTSQEPSAED 824

Query: 151 KIAEN 155
            IAE+
Sbjct: 825 DIAES 829


>gi|32567098|ref|NP_503345.2| hypothetical protein K09C6.1 [Caenorhabditis elegans]
 gi|27669145|gb|AAB70668.2| Hypothetical protein K09C6.1 [Caenorhabditis elegans]
          Length = 661

 Score = 41.0 bits (94), Expect = 0.054,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 9/110 (8%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVA 96
           ER  A +  +T++ +   +EA+     +  + A K+AE+     K KP E    +E    
Sbjct: 381 ERSSAEVSSSTEQTSAPMSEASSSDGRKKPKNAGKSAER-----KGKPAEKNPSSEKDDD 435

Query: 97  ANIEP----ESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNA 142
              EP    E + T   V+N+    + D EK   ++++  T+  N++ +A
Sbjct: 436 GATEPMSGVERRSTPSDVVNEKGRVKGDPEKQKQDRKENKTEEQNSKISA 485


>gi|297193165|ref|ZP_06910563.1| RHS/YD repeat-containing protein [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|297151663|gb|EDY65253.2| RHS/YD repeat-containing protein [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 1050

 Score = 41.0 bits (94), Expect = 0.056,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 23  QADPVA-PPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDK 81
           Q DP + PP P   ++ GKA ++EA +  AE     ARK    AAE A+ A +    +D 
Sbjct: 208 QRDPSSVPPKPGAFSDPGKAQMEEAQEILAE-----ARKQRNAAAETARTAVQAA--RDA 260

Query: 82  KKPK 85
             PK
Sbjct: 261 APPK 264


>gi|118088921|ref|XP_419886.2| PREDICTED: similar to opioid growth factor receptor-like 1 [Gallus
           gallus]
          Length = 673

 Score = 41.0 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 48/119 (40%), Gaps = 26/119 (21%)

Query: 59  RKAAEQAAEAAKKAAEKII--------HKDKKKPKENQ----------EVNEVPVAANIE 100
           RK   + ++  KK A  I         HK  K+PK             E  +V +  N E
Sbjct: 507 RKQKSEGSKTNKKPASPISIHSSYISKHKKLKEPKSTSMSGTSASKATEERKVEITKNGE 566

Query: 101 PESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159
              Q+ Q+           DA K  +EK  GT  G  ++S   +DPS K + A  +K+D
Sbjct: 567 ENDQDEQEM--------NCDAVKQSSEKNSGTDTGQLSKSEEIHDPSDKKEDASQSKKD 617


>gi|313229865|emb|CBY07570.1| unnamed protein product [Oikopleura dioica]
          Length = 324

 Score = 40.7 bits (93), Expect = 0.061,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 3/135 (2%)

Query: 28  APPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKEN 87
           +P P   L E  + +++ A Q A E+  E          E     +E I  KD+   K +
Sbjct: 147 SPKPTTDLDETAEDIVERAIQDALEEKQEKKEPTKADLKENKTDESEFIFQKDQTDEKID 206

Query: 88  QEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPS 147
            E  E     N E   +  +   +    +S  DAE   ++ R+ T   ++  SN ++ P 
Sbjct: 207 FENVEKFGKENEEDIKENVENGDVENQASSIADAENEFDKNRRETLADVSEISNLSSSPK 266

Query: 148 S---KDKIAENTKED 159
           S    D+I+EN++ D
Sbjct: 267 SVQESDEISENSEND 281


>gi|123468119|ref|XP_001317326.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121900057|gb|EAY05103.1| hypothetical protein TVAG_108370 [Trichomonas vaginalis G3]
          Length = 712

 Score = 40.7 bits (93), Expect = 0.062,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 11/80 (13%)

Query: 80  DKKKPKENQEVNE-----------VPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEK 128
           DKKK K+ QE  E           +P     E +S++  +   NK TT Q   EKT N +
Sbjct: 183 DKKKNKQTQEETENKEKIEENKEDIPPKQGTENKSEQPTESTENKETTEQKQEEKTENTE 242

Query: 129 RQGTTDGINNQSNATNDPSS 148
           +  + + I  +    N P+S
Sbjct: 243 KGTSENIIPFELQRINSPNS 262


>gi|237798202|ref|ZP_04586663.1| hypothetical protein POR16_05109 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021054|gb|EGI01111.1| hypothetical protein POR16_05109 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 1129

 Score = 40.7 bits (93), Expect = 0.065,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 59/127 (46%), Gaps = 9/127 (7%)

Query: 10  LLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAE------AARKAAE 63
           L +L  +T  +     P +    Q+L +     L +A QKA ++  E      A++K +E
Sbjct: 12  LFALCLSTFPALAADPPTSEAVQQSLDKIADRKLPDADQKALQQVLEQTLAFLASKKDSE 71

Query: 64  QAAEAAKKA---AEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD 120
           Q  EA K+    A K   +++++    +E   VPVA           +Q++++ +T Q+D
Sbjct: 72  QKLEALKQQLAQAPKQTSENQRELARLKESKVVPVAQRYGGLDVPQLEQLLSQRSTQQSD 131

Query: 121 AEKTPNE 127
            +   N+
Sbjct: 132 LQSELND 138


>gi|254773251|ref|ZP_05214767.1| hypothetical protein MaviaA2_01016 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 173

 Score = 40.7 bits (93), Expect = 0.067,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 3   RLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALL--DEATQKAAEKAAEAARK 60
           RLK   +L  +L T +AS  + DPV  PPP  +A    A+     A   +A + A A R 
Sbjct: 71  RLKAASLLAPVLRTGLASSSRPDPV--PPPTGIAVTSPAISRPPSAVSSSARRVARACRL 128

Query: 61  AAEQAAEAA 69
              + AEAA
Sbjct: 129 RGHRKAEAA 137


>gi|70951278|ref|XP_744892.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56525029|emb|CAH76892.1| conserved hypothetical protein [Plasmodium chabaudi chabaudi]
          Length = 1165

 Score = 40.7 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 52/106 (49%), Gaps = 5/106 (4%)

Query: 48  QKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQ 107
           + + E A E     +    +A  KA E++  ++ K+ K+N   +++ + AN     ++ +
Sbjct: 115 ETSNELANEGKEIVSTSNKDAENKATEELGGEETKQNKDNTADDKIAMNAN-----EDGK 169

Query: 108 QQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIA 153
             +  KT   + DAE   + K    T+ +N++ +  ND  S++K A
Sbjct: 170 DGISAKTNDEEKDAENKLDNKENEKTEELNSEKSKKNDDESENKNA 215


>gi|195380039|ref|XP_002048778.1| GJ21233 [Drosophila virilis]
 gi|194143575|gb|EDW59971.1| GJ21233 [Drosophila virilis]
          Length = 1446

 Score = 40.7 bits (93), Expect = 0.075,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 53/125 (42%), Gaps = 12/125 (9%)

Query: 40   KALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKD--------KKKPKENQEVN 91
            + L  E T++  EKA   A K  E+  EA + A E  I  D         +K  E     
Sbjct: 1102 RNLCREKTKQRLEKAIARASKTPEKQPEAPETAEESDIEVDVEVDVENEAEKEAEATVAA 1161

Query: 92   EVPVAANIEPESQETQQQVINKTTTSQTDAEKTP-NEKRQGTTDGINNQSNAT-NDPS-- 147
            +VPV A +  E Q +   VI  + T+ +    T  NE R       N  +N T N P+  
Sbjct: 1162 DVPVIAVLPAEEQHSDSDVIVDSPTAASPVANTAQNESRLRLRSMRNRNANGTRNTPAGG 1221

Query: 148  SKDKI 152
            SK K+
Sbjct: 1222 SKRKV 1226


>gi|169601438|ref|XP_001794141.1| hypothetical protein SNOG_03584 [Phaeosphaeria nodorum SN15]
 gi|111067669|gb|EAT88789.1| hypothetical protein SNOG_03584 [Phaeosphaeria nodorum SN15]
          Length = 1186

 Score = 40.7 bits (93), Expect = 0.076,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 63/145 (43%), Gaps = 21/145 (14%)

Query: 14  LSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAA--EAAKK 71
           L++  +S  QA      PP T+  + +            K AE   K  + AA  +  ++
Sbjct: 540 LASLTSSLKQASKANSFPPITVPSQAEV--------TPTKEAEVVEKIEDVAATEQPIEQ 591

Query: 72  AAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQG 131
           + E ++ + +  P    E+ E  V +   PE +E     +++TTT++   + +P+++   
Sbjct: 592 STETVLEEPQLLPAFEPEIKEKKVVSFAIPEDEEDDMSPLSRTTTAE---QGSPSQEATL 648

Query: 132 TTDGINNQS--------NATNDPSS 148
           T    N+++        N   DPS+
Sbjct: 649 TMTNSNSEASSNVEGGDNGAQDPSA 673


>gi|212709945|ref|ZP_03318073.1| hypothetical protein PROVALCAL_00995 [Providencia alcalifaciens DSM
           30120]
 gi|212687457|gb|EEB46985.1| hypothetical protein PROVALCAL_00995 [Providencia alcalifaciens DSM
           30120]
          Length = 912

 Score = 40.7 bits (93), Expect = 0.078,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 9/94 (9%)

Query: 46  ATQKAAEKAAEA-ARKAAEQAA--EAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
           A + AA++ AEA A++ AE+ A  EAA KA  ++  ++K K  ENQ+ ++    +N + +
Sbjct: 133 AAEDAAKRDAEANAKREAEEKAKREAADKATREVAEREKVKQSENQKPSKAATESNADKQ 192

Query: 103 SQETQQQVINKTTTSQT------DAEKTPNEKRQ 130
             E +   + +    +T      DA +   E R+
Sbjct: 193 RLEAEAAQLKRKAEEETQRKVEADARRVAEEARK 226


>gi|323455358|gb|EGB11226.1| hypothetical protein AURANDRAFT_61562 [Aureococcus anophagefferens]
          Length = 524

 Score = 40.3 bits (92), Expect = 0.082,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 60/131 (45%), Gaps = 5/131 (3%)

Query: 26  PVAPPPPQTLAERGKALL---DEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKK 82
           P  PP P+ +A   + L+   + A ++AA++  E+A +  E  A+AA++ A+     D  
Sbjct: 244 PGGPPVPEHVAAACRVLIGGSNSAAKRAAKRVLESAAEGEESLADAARRLADG-GELDAL 302

Query: 83  KPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEK-TPNEKRQGTTDGINNQSN 141
           +        E P+ A+  P +   +++   +   ++  A K  P  + Q  +D       
Sbjct: 303 ETTACAWAAENPLVASAAPSTATFERRRAGEVQAARAAAVKEKPPYQTQTRSDRFQASFK 362

Query: 142 ATNDPSSKDKI 152
            T+DP  + ++
Sbjct: 363 WTSDPRLESRM 373


>gi|84995862|ref|XP_952653.1| hypothetical protein [Theileria annulata]
 gi|65302814|emb|CAI74921.1| hypothetical protein TA13245 [Theileria annulata]
          Length = 1599

 Score = 40.3 bits (92), Expect = 0.082,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 55/116 (47%), Gaps = 6/116 (5%)

Query: 46  ATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKP---KENQEVNEVPVAANIEPE 102
           +T    E+  E+ ++  +Q  EAA++  E  +  +   P   KE   V +     N +  
Sbjct: 381 STPDTPEQTEESKQETTQQPEEAAQQP-EPTVPGESTVPDLSKEESSVEKDQSVTNSDNT 439

Query: 103 SQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKE 158
           S+    +V++K   + T  EKT + + Q   D  +N  N+ N+ S   + ++N+KE
Sbjct: 440 SKVKDSEVVDKENPALT--EKTKSLQDQNPPDKTDNTPNSVNNSSENIENSDNSKE 493


>gi|260583741|ref|ZP_05851489.1| translation initiation factor IF-2 [Granulicatella elegans ATCC
           700633]
 gi|260158367|gb|EEW93435.1| translation initiation factor IF-2 [Granulicatella elegans ATCC
           700633]
          Length = 757

 Score = 40.3 bits (92), Expect = 0.090,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 45  EATQKAAEKAAEAARKAAEQAAEAAKK-AAEKIIHKDKKKPKE---NQEVNEVPVAANIE 100
           E  +  A K  EA ++AA+   E AKK A +K  HK    PK+   N + N+       +
Sbjct: 28  EKKETPAPKKVEAKKEAAQPKKETAKKEAVKKAEHKSAHSPKQQEKNHQPNQNQNKHGHK 87

Query: 101 PESQETQQQVINKTTTSQTDAEKTPNEKRQ 130
            ES + Q+ V NK    Q+  E++ +  R+
Sbjct: 88  KESMQKQETVANKGPKHQSRDEESYSNHRE 117


>gi|242769576|ref|XP_002341793.1| C2 domain protein [Talaromyces stipitatus ATCC 10500]
 gi|218724989|gb|EED24406.1| C2 domain protein [Talaromyces stipitatus ATCC 10500]
          Length = 1197

 Score = 40.3 bits (92), Expect = 0.092,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 48/125 (38%), Gaps = 23/125 (18%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVA 96
           ER K + DE  ++  + A +  + A E+AA A KK   K+       P   +E+    V 
Sbjct: 37  ERDKRI-DEEVKRKQQDAKKEGKSADEEAANAQKKGTRKV-----TDPVTGKEIEIEDVQ 90

Query: 97  ANIEPESQETQQQVINKTTTSQTDAEKTPNEK-----------------RQGTTDGINNQ 139
                ES+  +  V N      TD +  PN++                  QGTT  +   
Sbjct: 91  KQYLEESKNPKLTVPNANLNKPTDIKTDPNQEFSEYRHNQDVTAPPEPVAQGTTSDVPIH 150

Query: 140 SNATN 144
             +TN
Sbjct: 151 GESTN 155


>gi|320093803|ref|ZP_08025648.1| SPFH domain/Band 7 family protein [Actinomyces sp. oral taxon 178
           str. F0338]
 gi|319979236|gb|EFW10734.1| SPFH domain/Band 7 family protein [Actinomyces sp. oral taxon 178
           str. F0338]
          Length = 316

 Score = 40.3 bits (92), Expect = 0.092,   Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 28/44 (63%)

Query: 30  PPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAA 73
           PPP+ LA   + +  E T++A   +AEA R+A  + AE AK+AA
Sbjct: 172 PPPRVLAAMEQQITAERTKRATILSAEAEREAQIKRAEGAKQAA 215


>gi|224477878|ref|YP_002635484.1| triacylglycerol lipase [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|222422485|emb|CAL29299.1| triacylglycerol lipase precursor [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 787

 Score = 40.3 bits (92), Expect = 0.095,   Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 8/109 (7%)

Query: 45  EATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKP-KENQEVNEVPVAANIEPE- 102
           +ATQ   E    +      +  E  + + +  +HKD   P K ++E N    A + +P+ 
Sbjct: 68  QATQNQTETLLSSESVEQPEQPEIERPSEQPNLHKDTVNPDKSSEEANTNQPAPSAQPQP 127

Query: 103 --SQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSK 149
             SQ+ Q +  NK   SQTD  +T  +      + INNQ+++T+D +S+
Sbjct: 128 VSSQKEQSESTNKNEVSQTDQHQTQTD----IQNDINNQTSSTSDNTSE 172


>gi|124003289|ref|ZP_01688139.1| two-component hybrid sensor and regulator [Microscilla marina ATCC
           23134]
 gi|123991387|gb|EAY30818.1| two-component hybrid sensor and regulator [Microscilla marina ATCC
           23134]
          Length = 1269

 Score = 40.3 bits (92), Expect = 0.097,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 50/105 (47%), Gaps = 15/105 (14%)

Query: 13  LLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKA 72
           +L+T + S  Q + V          R   + +EA Q+A  KA E A     Q+ E  +  
Sbjct: 481 ILTTYLHSAQQTEEV---------RRLLVIAEEAKQEAETKAQELA-----QSQEELRAT 526

Query: 73  AEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQ-QVINKTTT 116
           +E++ H+++   K   E+NEV V      E  ++QQ ++ N+  T
Sbjct: 527 SEELQHRNEALEKHTNEINEVNVRLEQNQEELQSQQDELKNQNAT 571


>gi|317149085|ref|XP_001823122.2| THO complex component (Rlr1) [Aspergillus oryzae RIB40]
          Length = 2354

 Score = 39.9 bits (91), Expect = 0.10,   Method: Composition-based stats.
 Identities = 35/152 (23%), Positives = 56/152 (36%), Gaps = 21/152 (13%)

Query: 19   ASCGQADPVAPP----PPQTLAERGK---ALLDEATQKAAEKAAEAARKAAEQAAEAAKK 71
            AS  +  P   P    P +T  E G+   A + +A  K      + ++K++EQA   A  
Sbjct: 1590 ASAAEFKPTTEPSKIEPTKTEVEDGEIEDAKMTDAASKNTIDTDKLSQKSSEQADTTAST 1649

Query: 72   AAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQG 131
             AE I  + ++        NE P    +EP +           T SQ    K P   RQ 
Sbjct: 1650 PAEPIASQTQQASSAESTTNEKPATPAVEPRTTGQPAPASPAPTASQA-PPKGPEPGRQA 1708

Query: 132  -------------TTDGINNQSNATNDPSSKD 150
                         +   + +Q++  N P  +D
Sbjct: 1709 NIPRRPDPERAPPSNQNVRSQTHTPNRPYRED 1740


>gi|169608041|ref|XP_001797440.1| hypothetical protein SNOG_07087 [Phaeosphaeria nodorum SN15]
 gi|160701546|gb|EAT85738.2| hypothetical protein SNOG_07087 [Phaeosphaeria nodorum SN15]
          Length = 452

 Score = 39.9 bits (91), Expect = 0.10,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 50/106 (47%), Gaps = 8/106 (7%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           +E  + ++D   QKA ++AAE AR+  ++A E   KA  + I   K+K     E+ + P+
Sbjct: 171 SEHIRMMIDRLKQKARQEAAEKAREKRQEAVEKVNKAKREEIKMQKQK---KAELEKRPL 227

Query: 96  AANIEPESQETQQQVINKTTTSQ---TDAEKTPNEKRQGTTDGINN 138
            +   P S      ++ + + ++    D +  P + +   T   N+
Sbjct: 228 VS--PPVSSRDGHSIVTRLSRARPGAPDRDDIPGQSKGSITLASNS 271


>gi|126321613|ref|XP_001366149.1| PREDICTED: similar to Zinc finger protein 532 isoform 2
           [Monodelphis domestica]
          Length = 1033

 Score = 39.9 bits (91), Expect = 0.11,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 16/117 (13%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKEN----QEVN 91
           +E+ +A L  A Q  A+ +A+ +   A  AA +AKKAA     +     +E     +E+N
Sbjct: 246 SEKNEASLASAAQSKAKSSAKLSSCIAAIAALSAKKAATDTCKEPVANSREPSPLPKEIN 305

Query: 92  EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSS 148
           + P A    PESQ            S  D+ K P+ K   +   +++++++   PSS
Sbjct: 306 DSPRAVEKSPESQ------------SLIDSAKKPSIKPPDSPRSVSSENSSKGSPSS 350


>gi|85091193|ref|XP_958782.1| hypothetical protein NCU05938 [Neurospora crassa OR74A]
 gi|28920167|gb|EAA29546.1| predicted protein [Neurospora crassa OR74A]
          Length = 589

 Score = 39.9 bits (91), Expect = 0.11,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 56/131 (42%), Gaps = 14/131 (10%)

Query: 31  PPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIH--------KDKK 82
           P Q    +GK     + +KA   +A+     A+Q  +  +K A               K+
Sbjct: 329 PVQNRGSQGKTTAKGSQKKATRPSAKKPNAKAKQVTKTTQKPASTQKQAPTPGPPSTQKR 388

Query: 83  KPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNA 142
           KPK   ++ E  V +N+ PE+QE    V  ++ T Q+   +T + KR    DG     N 
Sbjct: 389 KPKRPLQIYE-DVTSNL-PETQE----VARESQTQQSQLSRTRSSKRLAANDGGLVGGNV 442

Query: 143 TNDPSSKDKIA 153
           +N  + + K A
Sbjct: 443 SNTRAKRVKAA 453


>gi|307190294|gb|EFN74386.1| Midasin [Camponotus floridanus]
          Length = 3314

 Score = 39.9 bits (91), Expect = 0.11,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 51/135 (37%), Gaps = 21/135 (15%)

Query: 42   LLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEP 101
            LL E      EK  E A        E+++   +   + D  K +E  E N+     + E 
Sbjct: 2657 LLPENMDMELEK--ETAENEENDEGESSEDEDKNCENMDLDKTQEELETNQEAKENDKEN 2714

Query: 102  ESQETQQQVINKT-----------------TTSQTDAEKTPNEKRQGTTDGINNQSNATN 144
               E   +  N+                   + Q DA +   E  +G+ D +  QSN  N
Sbjct: 2715 AGTENTDEEQNRDEETEEEKLEKAAPSANDASKQMDAAQQVEETMEGSRDTVAQQSNKAN 2774

Query: 145  DPSSKDKIAENTKED 159
            D   ++  AENT+ED
Sbjct: 2775 D--QQETSAENTQED 2787


>gi|126726028|ref|ZP_01741870.1| hypothetical protein RB2150_07468 [Rhodobacterales bacterium
           HTCC2150]
 gi|126705232|gb|EBA04323.1| hypothetical protein RB2150_07468 [Rhodobacterales bacterium
           HTCC2150]
          Length = 860

 Score = 39.9 bits (91), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 6/65 (9%)

Query: 30  PPPQTLAERGKALLDEATQK------AAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKK 83
           P   +LAER + L D   Q+      A  +A +AAR+A ++A EA  +AAE + + +  +
Sbjct: 694 PSADSLAERQQDLQDRLNQQRGNLPNAGSEAGQAAREALDRAGEAMGRAAENLENNELAE 753

Query: 84  PKENQ 88
             +NQ
Sbjct: 754 ALDNQ 758


>gi|296218763|ref|XP_002755652.1| PREDICTED: EH domain-binding protein 1-like protein 1 [Callithrix
           jacchus]
          Length = 1307

 Score = 39.9 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 55/142 (38%), Gaps = 24/142 (16%)

Query: 22  GQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDK 81
           GQ  P AP PP+T AE   +   +  Q  A   A   RK +                 D 
Sbjct: 272 GQLGPEAPRPPETSAEMRSS--RQPGQDTAPTPAPRLRKGS-----------------DA 312

Query: 82  KKPKENQEVNEVPVAANIEPE----SQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGIN 137
            +P   Q  +EVP A+   PE    ++ETQ Q   +  T    A   P  + +G+ +   
Sbjct: 313 LRPSVPQGEDEVPKASGAPPEGLGSARETQAQACPQEGTEARGARLGPGIEEKGSGEPFG 372

Query: 138 NQSNATNDPSSKDKIAENTKED 159
            Q     D  + D+  E + ED
Sbjct: 373 GQRLKAEDMGTGDR-QEASGED 393


>gi|325125153|gb|ADY84483.1| Cell division protein [Lactobacillus delbrueckii subsp. bulgaricus
           2038]
          Length = 737

 Score = 39.9 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 53/110 (48%), Gaps = 14/110 (12%)

Query: 45  EATQKAAEKAAEAARKAAEQAAE--AAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
           EA   + E+A EAA+K AE+ AE   A+K A     +D  KP       E   A   EP+
Sbjct: 639 EAKALSYEEAKEAAQKRAEEKAEEDTAEKQALATPSEDAVKP-------ETDAAKLAEPD 691

Query: 103 SQETQQQVINK-TTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
           +  +Q+   +   T S++D  K P    +   D  + ++  T+D S KD+
Sbjct: 692 ASASQEDPADSLPTPSESDLSKDP---EKDDNDAPSQKTEQTDD-SDKDE 737


>gi|302926127|ref|XP_003054232.1| hypothetical protein NECHADRAFT_90051 [Nectria haematococca mpVI
           77-13-4]
 gi|256735173|gb|EEU48519.1| hypothetical protein NECHADRAFT_90051 [Nectria haematococca mpVI
           77-13-4]
          Length = 970

 Score = 39.9 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 22/128 (17%)

Query: 25  DPVAPPPPQTLAERG----------KALLDEATQKAAEKA----AEAARKAAEQAAEAAK 70
           +P AP P  +L  RG          +A   E T   +EK     A++    + Q+A A  
Sbjct: 374 EPKAPAPSASLERRGVEVEKTNPGKEAATPEPTVSKSEKPKTEEAKSQDSKSTQSAPAES 433

Query: 71  KAAEKIIHKDKKKPKENQEVNEVPVAANI-EPESQET-----QQQVINKTTTSQTDAEKT 124
           KA E      + K  E++    VPV +   EP++QE+      +    K+ ++ T+  K 
Sbjct: 434 KATES--KAAESKVAESKAAEPVPVVSKAAEPKAQESKTEETHETKTEKSNSASTEQPKA 491

Query: 125 PNEKRQGT 132
           P  K+  T
Sbjct: 492 PQVKKART 499


>gi|313674985|ref|YP_004052981.1| hypothetical protein Ftrac_0871 [Marivirga tractuosa DSM 4126]
 gi|312941683|gb|ADR20873.1| hypothetical protein Ftrac_0871 [Marivirga tractuosa DSM 4126]
          Length = 1033

 Score = 39.5 bits (90), Expect = 0.15,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 36/76 (47%)

Query: 55  AEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKT 114
           AE  R+ AEQ +  AK+ AEK    + K  ++  E N+  + AN E    E    +  + 
Sbjct: 528 AERQRQLAEQNSIEAKRNAEKAKENELKAQRQQIEANKSSIRANKERNRAEYNVYLAMQA 587

Query: 115 TTSQTDAEKTPNEKRQ 130
             ++  A K  NE+ Q
Sbjct: 588 RRTEEIARKQANEQAQ 603


>gi|83771859|dbj|BAE61989.1| unnamed protein product [Aspergillus oryzae]
          Length = 2435

 Score = 39.5 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 35/152 (23%), Positives = 56/152 (36%), Gaps = 21/152 (13%)

Query: 19   ASCGQADPVAPP----PPQTLAERGK---ALLDEATQKAAEKAAEAARKAAEQAAEAAKK 71
            AS  +  P   P    P +T  E G+   A + +A  K      + ++K++EQA   A  
Sbjct: 1626 ASAAEFKPTTEPSKIEPTKTEVEDGEIEDAKMTDAASKNTIDTDKLSQKSSEQADTTAST 1685

Query: 72   AAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQG 131
             AE I  + ++        NE P    +EP +           T SQ    K P   RQ 
Sbjct: 1686 PAEPIASQTQQASSAESTTNEKPATPAVEPRTTGQPAPASPAPTASQA-PPKGPEPGRQA 1744

Query: 132  -------------TTDGINNQSNATNDPSSKD 150
                         +   + +Q++  N P  +D
Sbjct: 1745 NIPRRPDPERAPPSNQNVRSQTHTPNRPYRED 1776


>gi|156847299|ref|XP_001646534.1| hypothetical protein Kpol_1055p31 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117212|gb|EDO18676.1| hypothetical protein Kpol_1055p31 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 822

 Score = 39.5 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 3/110 (2%)

Query: 44  DEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPES 103
           D   QK   K     +  +E       K +E +  +++KK  E++ V+ +  AA + P S
Sbjct: 223 DTLNQKPVGKPEAPNKAPSEPKHVTTVKTSEPVSEENEKKVIEDKHVSTIQSAA-VLPSS 281

Query: 104 QETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQS--NATNDPSSKDK 151
            ETQ+      +   + A   P       T   NN S   ++  P  KDK
Sbjct: 282 TETQKPAPKSWSAIASSAISKPKSMNHSPTSSTNNLSGQGSSQAPQRKDK 331


>gi|228962109|ref|ZP_04123594.1| hypothetical protein bthur0005_54820 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228797585|gb|EEM44713.1| hypothetical protein bthur0005_54820 [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 437

 Score = 39.5 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 9/112 (8%)

Query: 24  ADPVAPPPPQTLA---ERGKALLDEATQKAAEKAAEAARKAA--EQAAEAAKKAAEKIIH 78
           A  +  P  +T A    +GK + +++ Q A + A E+AR A   EQ  EAAKKAA + I 
Sbjct: 231 AKDIIKPVAETAAAVVNKGKEI-EKSIQDAEKTAEESARAAGKTEQEIEAAKKAARQEIE 289

Query: 79  KDKK---KPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNE 127
           KDKK       N +  E  +   ++P+  +       K TT   + +   N+
Sbjct: 290 KDKKAELSAAANAKAKEYDLITTLDPKRIDEITNAFGKVTTLTVENKTALND 341


>gi|17556907|ref|NP_498856.1| UBX-containing protein in Nematode family member (ubxn-4)
           [Caenorhabditis elegans]
 gi|466104|sp|P34631|UBXN4_CAEEL RecName: Full=UBX domain-containing protein 4
 gi|289758|gb|AAA28196.1| Ubx-containing protein in nematodes protein 4, confirmed by
           transcript evidence [Caenorhabditis elegans]
          Length = 469

 Score = 39.5 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 54/104 (51%), Gaps = 9/104 (8%)

Query: 38  RGKALLDEATQKAAEKAAEAARKAAEQAAEA----AKKAAEKIIH--KDKKKPKENQEVN 91
           R KALL++  QK AEK  EA +   E+  +A     ++ AE ++   K +K  K   E +
Sbjct: 175 RAKALLEQKKQKDAEKKREADKHVKEEMTKAREAKQERDAEALVKAAKQRKMEKLAAESD 234

Query: 92  EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDG 135
           +  + A I+ + +E  Q+   K   ++  +E T  EK+Q TT G
Sbjct: 235 KKRILAQIKAD-REAAQKKFGKLVNTENASENT--EKKQETTVG 275


>gi|163744701|ref|ZP_02152061.1| hypothetical protein OIHEL45_03920 [Oceanibulbus indolifex
          HEL-45]
 gi|161381519|gb|EDQ05928.1| hypothetical protein OIHEL45_03920 [Oceanibulbus indolifex
          HEL-45]
          Length = 393

 Score = 39.5 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 12/70 (17%)

Query: 3  RLKYQIILLSLLSTTMASC-----GQA-------DPVAPPPPQTLAERGKALLDEATQKA 50
          R K Q++LL L +  +A+C     G A       DP AP P   L  RG +  DE   K 
Sbjct: 9  RKKMQLLLLPLFAVILAACQPVAIGGANSGGPSIDPSAPVPVALLVPRGGSASDELLAKN 68

Query: 51 AEKAAEAARK 60
           E AA  A +
Sbjct: 69 LENAARLAMR 78


>gi|71410430|ref|XP_807509.1| surface protease GP63 [Trypanosoma cruzi strain CL Brener]
 gi|70871528|gb|EAN85658.1| surface protease GP63, putative [Trypanosoma cruzi]
          Length = 435

 Score = 39.5 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 48/121 (39%), Gaps = 1/121 (0%)

Query: 12  SLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKK 71
           S+ ++ +    +    A  P Q LAE     + EA Q+  E+    A  A E  AE  + 
Sbjct: 272 SVAASALPPAQEPHAEASSPVQPLAEMPSPRVQEALQQPREEIKAQASTAEEPHAEEPRA 331

Query: 72  AAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQG 131
           AA     +   +     + +E PVA     + Q+ ++   NKT       +  P    QG
Sbjct: 332 AASTA-EESHAEASIAGKASEAPVAQAASRQPQQEREAGQNKTVGESATTQHVPANTSQG 390

Query: 132 T 132
           +
Sbjct: 391 S 391


>gi|82701440|ref|YP_411006.1| F0F1 ATP synthase subunit B [Nitrosospira multiformis ATCC 25196]
 gi|123545141|sp|Q2YCA7|ATPF1_NITMU RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|82409505|gb|ABB73614.1| ATP synthase F0, B subunit [Nitrosospira multiformis ATCC 25196]
          Length = 156

 Score = 39.5 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
            ERGK  L+ A+Q++ +   EA ++A++  A+A K+AAE +   D+ K    +E + + V
Sbjct: 47  GERGKRELELASQRSGDVVREAKQRASDIIAQAEKRAAEIV---DEAKVAAREEGDRILV 103

Query: 96  AANIEPESQ 104
            A  E E +
Sbjct: 104 GAKAEVEQE 112


>gi|289063650|gb|ADC80147.1| IgA protease [Neisseria meningitidis H44/76]
          Length = 1568

 Score = 39.5 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 6/48 (12%)

Query: 33   QTLAERGKALLDEATQKAAEKA--AEAARKAAE----QAAEAAKKAAE 74
            Q LA R KA  +EA ++AAE A   E ARKAAE    Q AE  +KAAE
Sbjct: 1093 QALAVRRKAEAEEAKRQAAELAHQQEEARKAAELAAKQKAETERKAAE 1140


>gi|13183005|gb|AAK15023.1| IgA1 protease [Neisseria meningitidis]
          Length = 1552

 Score = 39.5 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 6/48 (12%)

Query: 33   QTLAERGKALLDEATQKAAEKA--AEAARKAAE----QAAEAAKKAAE 74
            Q LA R KA  +EA ++AAE A   E ARKAAE    Q AE  +KAAE
Sbjct: 1093 QALAVRRKAEAEEAKRQAAELARQQEEARKAAELAAKQKAETERKAAE 1140


>gi|325141927|gb|EGC64367.1| IgA-specific serine endopeptidase [Neisseria meningitidis 961-5945]
 gi|325197920|gb|ADY93376.1| IgA-specific serine endopeptidase [Neisseria meningitidis G2136]
          Length = 1552

 Score = 39.5 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 6/48 (12%)

Query: 33   QTLAERGKALLDEATQKAAEKA--AEAARKAAE----QAAEAAKKAAE 74
            Q LA R KA  +EA ++AAE A   E ARKAAE    Q AE  +KAAE
Sbjct: 1093 QALAVRRKAEAEEAKRQAAELARQQEEARKAAELAAKQKAETERKAAE 1140


>gi|121634498|ref|YP_974743.1| IgA1 protease [Neisseria meningitidis FAM18]
 gi|120866204|emb|CAM09944.1| IgA1 protease [Neisseria meningitidis FAM18]
 gi|316983676|gb|EFV62657.1| igA-specific serine endopeptidase [Neisseria meningitidis H44/76]
 gi|325131846|gb|EGC54546.1| IgA-specific serine endopeptidase [Neisseria meningitidis M6190]
 gi|325137896|gb|EGC60471.1| IgA-specific serine endopeptidase [Neisseria meningitidis ES14902]
 gi|325200614|gb|ADY96069.1| IgA-specific serine endopeptidase [Neisseria meningitidis H44/76]
          Length = 1568

 Score = 39.5 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 6/48 (12%)

Query: 33   QTLAERGKALLDEATQKAAEKA--AEAARKAAE----QAAEAAKKAAE 74
            Q LA R KA  +EA ++AAE A   E ARKAAE    Q AE  +KAAE
Sbjct: 1093 QALAVRRKAEAEEAKRQAAELARQQEEARKAAELAAKQKAETERKAAE 1140


>gi|332027237|gb|EGI67321.1| WD repeat-containing protein C10orf79 [Acromyrmex echinatior]
          Length = 1600

 Score = 39.1 bits (89), Expect = 0.18,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 39/89 (43%)

Query: 35   LAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVP 94
            L  + K L D+ T    EK  E  +K+ ++A        EK+  K  +  K+N E++ V 
Sbjct: 1461 LKRKAKGLRDDKTAVHLEKEIETMKKSLDKALSKEMNKVEKLRQKIARVKKKNTELDRVI 1520

Query: 95   VAANIEPESQETQQQVINKTTTSQTDAEK 123
               N+     E Q+ VI +    +   +K
Sbjct: 1521 TEMNVARWELEYQRDVIGEIRQREHTDQK 1549


>gi|170086410|ref|XP_001874428.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164649628|gb|EDR13869.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 666

 Score = 39.1 bits (89), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKE 86
           +R K    EA  KA E+  EAARKA E+  E A+KA E+ +   +K  ++
Sbjct: 216 QRAKEEEQEAALKAREEQEEAARKAKEERKEVAQKAKEERMEAAQKAKED 265



 Score = 39.1 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 45  EATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNE 92
           EA Q+A E+  EAA KA E+  EAA+KA E+     +K  +E  E  +
Sbjct: 213 EAEQRAKEEEQEAALKAREEQEEAARKAKEERKEVAQKAKEERMEAAQ 260


>gi|74318819|ref|YP_316559.1| F-type H+-transporting ATP synthase subunit B [Thiobacillus
           denitrificans ATCC 25259]
 gi|123611105|sp|Q3SF62|ATPF_THIDA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|74058314|gb|AAZ98754.1| F-type H+-transporting ATP synthase, subunit B [Thiobacillus
           denitrificans ATCC 25259]
          Length = 156

 Score = 39.1 bits (89), Expect = 0.19,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           A+RGK  L+ A +KA +   +A  +AAE  A+A K+AA+ I+ + K   KE  +      
Sbjct: 47  ADRGKHELELAAKKAGDNMRDAKAQAAEVIAQAEKRAAQ-IVEEAKLAAKEEGDRQLAAA 105

Query: 96  AANIEPESQETQQ 108
            ANIE E+   ++
Sbjct: 106 QANIEQEANRARE 118


>gi|315604294|ref|ZP_07879360.1| SPFH domain/Band 7 family protein [Actinomyces sp. oral taxon 180
           str. F0310]
 gi|315314000|gb|EFU62051.1| SPFH domain/Band 7 family protein [Actinomyces sp. oral taxon 180
           str. F0310]
          Length = 319

 Score = 39.1 bits (89), Expect = 0.19,   Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 27/44 (61%)

Query: 30  PPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAA 73
           PPP+ LA   + +  E T++A    AEA R+A  + AE AK+AA
Sbjct: 174 PPPRVLAAMEQQITAERTKRATILTAEAEREAQIKKAEGAKQAA 217


>gi|86133946|ref|ZP_01052528.1| translation initiation factor IF-2 [Polaribacter sp. MED152]
 gi|85820809|gb|EAQ41956.1| translation initiation factor IF-2 [Polaribacter sp. MED152]
          Length = 935

 Score = 39.1 bits (89), Expect = 0.19,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 8/119 (6%)

Query: 39  GKALLDEATQKAAEK---AAEAARKAAEQAAEAA---KKAAEKIIHKDKKKPKENQEVNE 92
           GK  +D A +K  EK     EA +K A +  EA    K  AEK++    + PKE ++V +
Sbjct: 113 GKIDIDNAGKKPTEKPEPVKEAPKKEAPKQVEATPEKKVEAEKVVEDKVEAPKETKKVEK 172

Query: 93  VPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
               + IE  + + + ++  K  +  T AE+   E      + I  Q    + P+   K
Sbjct: 173 AKPISAIEKVASKVESKIEGK--SDATKAEEKSGEVTPENAEAIKTQYKKLDGPNFTGK 229


>gi|308494771|ref|XP_003109574.1| CRE-SDC-2 protein [Caenorhabditis remanei]
 gi|308245764|gb|EFO89716.1| CRE-SDC-2 protein [Caenorhabditis remanei]
          Length = 4287

 Score = 39.1 bits (89), Expect = 0.20,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 49/99 (49%), Gaps = 5/99 (5%)

Query: 33   QTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEV-- 90
            + +AE  +    E  +K  E+  +AAR+AA + AE  +K  +++  +  KK KE + +  
Sbjct: 2352 KKMAEEAEKARQEKIRKQKEEELKAAREAARKLAE--EKEKQRLAEEAAKKRKEEERIRK 2409

Query: 91   NEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKR 129
             +  +    E E +E Q Q+  +  TS   A +  N+ R
Sbjct: 2410 EQEELRKQKEAEKKERQLQLAKERATSMKHA-RDLNDSR 2447


>gi|261392927|emb|CAX50512.1| IgA-specific serine endopeptidase (IgA protease) [Neisseria
            meningitidis 8013]
          Length = 1552

 Score = 39.1 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 6/48 (12%)

Query: 33   QTLAERGKALLDEATQKAAEKA--AEAARKAAE----QAAEAAKKAAE 74
            Q LA R KA  +EA ++AAE A   E ARKAAE    Q AE  +KAAE
Sbjct: 1093 QALAVRRKAEAEEAKRQAAELARQQEEARKAAELAAKQKAETERKAAE 1140


>gi|264679371|ref|YP_003279278.1| ribonuclease R [Comamonas testosteroni CNB-2]
 gi|262209884|gb|ACY33982.1| ribonuclease R [Comamonas testosteroni CNB-2]
          Length = 882

 Score = 39.1 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 44/104 (42%), Gaps = 13/104 (12%)

Query: 26  PVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPK 85
           P + P P   A++G+    +A  K+   AA  A  A EQAA   +   E +I   + KP+
Sbjct: 746 PASAPEPDR-AKQGRKAAKKAMLKSVNLAALEAEYAQEQAAPKPEPVMESVIEVQQAKPR 804

Query: 86  ENQEVNEVP------------VAANIEPESQETQQQVINKTTTS 117
           +     +V             V A ++PES+   +     +T S
Sbjct: 805 KAAGRKKVAALLAPDAPAISVVKAAVKPESKSVAKPATKVSTKS 848


>gi|71909547|ref|YP_287134.1| hypothetical protein Daro_3936 [Dechloromonas aromatica RCB]
 gi|71849168|gb|AAZ48664.1| MJ0042 finger-like region [Dechloromonas aromatica RCB]
          Length = 357

 Score = 39.1 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 34/136 (25%), Positives = 52/136 (38%), Gaps = 9/136 (6%)

Query: 27  VAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHK------D 80
           V  PPP+  A   + L  E      E A E   + AEQ     ++  E++I        D
Sbjct: 58  VNSPPPEEEASLVEQLQTEPEAALEELAVEPEPELAEQVDTLVEEPFEEVIEVLPLEIID 117

Query: 81  KKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQS 140
            + P E    N +      EPES    +       T   D+++TP E  Q   D     +
Sbjct: 118 SEVPAEP---NALTAPGESEPESVPGSELQAPCDDTLPEDSQETPEESTQAARDAGLVAA 174

Query: 141 NATNDPSSKDKIAENT 156
              ND ++ ++ A  T
Sbjct: 175 RELNDTTAYNRWAAGT 190


>gi|71980588|ref|NP_001020985.1| UNCoordinated family member (unc-89) [Caenorhabditis elegans]
 gi|82583720|sp|O01761|UNC89_CAEEL RecName: Full=Muscle M-line assembly protein unc-89; AltName:
            Full=Uncoordinated protein 89
 gi|31746683|gb|AAP68958.1| Uncoordinated protein 89, isoform b, partially confirmed by
            transcript evidence [Caenorhabditis elegans]
          Length = 8081

 Score = 38.7 bits (88), Expect = 0.24,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 32   PQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVN 91
            P+ + +  +      +    EK+ E   K  E+ A   KK  E++    +K P    +  
Sbjct: 1363 PKEVIDSDRKKKKSPSPDKKEKSPE---KTEEKPASPTKKTGEEVKSPKEKSPASPTKKE 1419

Query: 92   EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            + P A  ++  +++       K+ +S T  EK+P+   + T D +  +S     P+ K+K
Sbjct: 1420 KSPAAEEVKSPTKK------EKSPSSPTKKEKSPSSPTKKTGDEVKEKS-PPKSPTKKEK 1472

Query: 152  IAENTKE 158
              E  ++
Sbjct: 1473 SPEKPED 1479


>gi|320169787|gb|EFW46686.1| hydroxyacyl-Coenzyme A dehydrogenase [Capsaspora owczarzaki ATCC
           30864]
          Length = 331

 Score = 38.7 bits (88), Expect = 0.24,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 36  AERGKA-LLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVP 94
           AE+G A +     + A +K AE A+ +AEQAAE+ +K  E I+ + +   K    V E  
Sbjct: 63  AEKGVAGIKSNVARDARKKFAELAKTSAEQAAESERKHVEAIVGRIQATDKLESAVAEAD 122

Query: 95  VAANIEPESQETQQQVINK 113
           +      E+ + +Q +  K
Sbjct: 123 LVIEAIVENIKVKQDLFRK 141


>gi|153930641|ref|YP_001393414.1| putative type IV secretion system protein IcmE/DotG [Yersinia
           pseudotuberculosis IP 31758]
 gi|152958182|gb|ABS45644.1| putative type IV secretion system protein IcmE/DotG [Yersinia
           pseudotuberculosis IP 31758]
          Length = 462

 Score = 38.7 bits (88), Expect = 0.25,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 49/131 (37%), Gaps = 2/131 (1%)

Query: 29  PPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQ 88
           P  PQ   +       EA +++ +  A  AR+AA+            II   K KP  NQ
Sbjct: 96  PAAPQIKTDNSPVTESEAARRS-QMNANQAREAAKLGDSFQPSFDTNIIADQKSKPNYNQ 154

Query: 89  EVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSS 148
               +P A N    +Q +     N  T SQ     +     Q   DG       T + + 
Sbjct: 155 NSTVIPDAINFNNRNQAS-SDTQNPNTGSQRSDSNSNQGNSQKNQDGQQLLKEYTTEVNK 213

Query: 149 KDKIAENTKED 159
           +DK  E+ K +
Sbjct: 214 RDKHVEDMKSE 224


>gi|197097694|ref|NP_001127598.1| beta-adducin [Pongo abelii]
 gi|75041164|sp|Q5R5V7|ADDB_PONAB RecName: Full=Beta-adducin; AltName: Full=Erythrocyte adducin
           subunit beta
 gi|55732312|emb|CAH92859.1| hypothetical protein [Pongo abelii]
          Length = 726

 Score = 38.7 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPKENQEVNEVP 94
           ER K  LD   + A E+    A+ A     ++  K AE    +    K  +E  +  E  
Sbjct: 573 ERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETS 632

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            AA  EPE+ + +  V+N     QT  E       Q TT      S  T+  +SKDK
Sbjct: 633 KAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTT------SADTDVDTSKDK 683


>gi|225449|prf||1303333A protease Ig A
          Length = 1532

 Score = 38.7 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 27   VAPPPPQT-LAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPK 85
            VAPP PQ   AE       +A Q   ++AAEA + A ++  EA +KAAE  I + +++ +
Sbjct: 1015 VAPPSPQANQAEEALRQQAKAEQVKRQQAAEAEKVARQKDEEAKRKAAE--IARQQEEAR 1072

Query: 86   ENQEVNEVPVAANIEPESQETQQQ 109
            +  E+      A  E +++E  +Q
Sbjct: 1073 KAAEL-AAKQKAEAERKARELARQ 1095


>gi|124244|sp|P09790|IGA_NEIGO RecName: Full=IgA-specific serine endopeptidase autotransporter;
            Contains: RecName: Full=IgA-specific serine
            endopeptidase; AltName: Full=IgA protease; Contains:
            RecName: Full=IgA-specific serine endopeptidase
            translocator; AltName: Full=Helper peptide; Flags:
            Precursor
 gi|44869|emb|CAA28538.1| unnamed protein product [Neisseria gonorrhoeae]
          Length = 1532

 Score = 38.7 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 27   VAPPPPQT-LAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPK 85
            VAPP PQ   AE       +A Q   ++AAEA + A ++  EA +KAAE  I + +++ +
Sbjct: 1015 VAPPSPQANQAEEALRQQAKAEQVKRQQAAEAEKVARQKDEEAKRKAAE--IARQQEEAR 1072

Query: 86   ENQEVNEVPVAANIEPESQETQQQ 109
            +  E+      A  E +++E  +Q
Sbjct: 1073 KAAEL-AAKQKAEAERKARELARQ 1095


>gi|195380872|ref|XP_002049185.1| GJ20888 [Drosophila virilis]
 gi|259511408|sp|B4LIK8|SRRT_DROVI RecName: Full=Serrate RNA effector molecule homolog; AltName:
           Full=Arsenite-resistance protein 2 homolog
 gi|194143982|gb|EDW60378.1| GJ20888 [Drosophila virilis]
          Length = 963

 Score = 38.7 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 19  ASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIH 78
           A+  +A+P+ P  PQ   E G AL D A  K+ E++ E   K AEQ AE   +A E    
Sbjct: 430 ATVAKANPLPPDSPQ--PEGGTALQDAAAIKS-EQSDEQQEKDAEQPAEL--QADEPAAA 484

Query: 79  KDKKKPKENQEVNEV 93
           K+ ++P E  E NEV
Sbjct: 485 KNGEEP-EKTEKNEV 498


>gi|71657264|ref|XP_817150.1| serine-alanine-and proline-rich protein [Trypanosoma cruzi strain
           CL Brener]
 gi|70882323|gb|EAN95299.1| serine-alanine-and proline-rich protein, putative [Trypanosoma
           cruzi]
          Length = 330

 Score = 38.7 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 4/132 (3%)

Query: 15  STTMASCGQADPVA--PPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQA-AEAAKK 71
           STT +     +  A  PPPPQT A  G A+ + +   AA +A+++A     Q  + +A  
Sbjct: 151 STTNSESSDVEDSADVPPPPQT-ATPGGAVANSSAGTAASQASDSAPAGGLQGPSHSASV 209

Query: 72  AAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQG 131
           A+         +P E  + +       ++ E+       +++T      AE T  +    
Sbjct: 210 ASPAPESTPDPRPTEGGDHSSHDPPVKVQEETAAAPPTQLSQTGEDGGAAEGTEEDTAAN 269

Query: 132 TTDGINNQSNAT 143
           TTD  +++ NAT
Sbjct: 270 TTDTASSEGNAT 281


>gi|9257192|ref|NP_001608.1| beta-adducin isoform a [Homo sapiens]
 gi|297307158|ref|NP_001171983.1| beta-adducin isoform a [Homo sapiens]
 gi|543774|sp|P35612|ADDB_HUMAN RecName: Full=Beta-adducin; AltName: Full=Erythrocyte adducin
           subunit beta
 gi|29369|emb|CAA41176.1| beta adducin [Homo sapiens]
 gi|119620213|gb|EAW99807.1| adducin 2 (beta), isoform CRA_i [Homo sapiens]
 gi|119620214|gb|EAW99808.1| adducin 2 (beta), isoform CRA_i [Homo sapiens]
 gi|158255450|dbj|BAF83696.1| unnamed protein product [Homo sapiens]
 gi|307685509|dbj|BAJ20685.1| adducin 2 [synthetic construct]
          Length = 726

 Score = 38.7 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPKENQEVNEVP 94
           ER K  LD   + A E+    A+ A     ++  K AE    +    K  +E  +  E  
Sbjct: 573 ERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETS 632

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            AA  EPE+ + +  V+N     QT  E       Q TT      S  T+  +SKDK
Sbjct: 633 KAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTT------SADTDVDTSKDK 683


>gi|41351356|gb|AAH65525.1| ADD2 protein [Homo sapiens]
          Length = 726

 Score = 38.7 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPKENQEVNEVP 94
           ER K  LD   + A E+    A+ A     ++  K AE    +    K  +E  +  E  
Sbjct: 573 ERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETS 632

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            AA  EPE+ + +  V+N     QT  E       Q TT      S  T+  +SKDK
Sbjct: 633 KAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTT------SADTDVDTSKDK 683


>gi|72388832|ref|XP_844711.1| 75 kDa invariant surface glycoprotein [Trypanosoma brucei TREU927]
 gi|62176120|gb|AAX70238.1| 75 kDa invariant surface glycoprotein, putative [Trypanosoma
           brucei]
 gi|70801245|gb|AAZ11152.1| 75 kDa invariant surface glycoprotein, putative [Trypanosoma brucei
           brucei strain 927/4 GUTat10.1]
          Length = 523

 Score = 38.7 bits (88), Expect = 0.30,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 10/58 (17%)

Query: 37  ERGKALLD-----EATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQE 89
           E+ K LL+     EAT+KAAEK A+ +RKA E+A E   KA E     D +  K+N++
Sbjct: 363 EKKKMLLEAVEKAEATEKAAEKQAKDSRKAFEEAEEERVKATE-----DAEAAKQNRD 415


>gi|89901132|ref|YP_523603.1| MCP methyltransferase/methylesterase [Rhodoferax ferrireducens
           T118]
 gi|89345869|gb|ABD70072.1| MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor
           [Rhodoferax ferrireducens T118]
          Length = 1008

 Score = 38.3 bits (87), Expect = 0.32,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 9/121 (7%)

Query: 24  ADPVAPPPPQTLAERGKA-----LLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIH 78
           A+  +PP P TL     A     L  +A+ + AE   E   +A E+   AA +  E    
Sbjct: 653 AESKSPPAPATLPAISAAGGSDKLRSDASAQIAELNEEL--QAKEEYLHAANEELETTNE 710

Query: 79  KDKKKPKENQEVNEVPVAANIEPESQETQQQVINKT-TTSQTDAEKTPNEKRQGTTDGIN 137
           + K   +E Q VNE   + N E E+ + + Q IN+  +T  T+ +   ++  +   D +N
Sbjct: 711 ELKSSNEEMQSVNEELQSTNEELETSKEEMQSINEELSTVNTELQTKVSDLSRANND-MN 769

Query: 138 N 138
           N
Sbjct: 770 N 770


>gi|332226781|ref|XP_003262569.1| PREDICTED: beta-adducin isoform 1 [Nomascus leucogenys]
 gi|332226785|ref|XP_003262571.1| PREDICTED: beta-adducin isoform 3 [Nomascus leucogenys]
 gi|332226787|ref|XP_003262572.1| PREDICTED: beta-adducin isoform 4 [Nomascus leucogenys]
          Length = 726

 Score = 38.3 bits (87), Expect = 0.32,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPKENQEVNEVP 94
           ER K  LD   + A E+    A+ A     ++  K AE    +    K  +E  +  E  
Sbjct: 573 ERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETS 632

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            AA  EPE+ + +  V+N     QT  E       Q TT      S  T+  +SKDK
Sbjct: 633 KAATTEPETTQPEGVVVNGREEEQTAEELLSKGLSQMTT------SADTDVDTSKDK 683


>gi|240112381|ref|ZP_04726871.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae MS11]
 gi|254493182|ref|ZP_05106353.1| IgA-specific serine endopeptidase [Neisseria gonorrhoeae 1291]
 gi|268598442|ref|ZP_06132609.1| IgA-specific serine endopeptidase [Neisseria gonorrhoeae MS11]
 gi|226512222|gb|EEH61567.1| IgA-specific serine endopeptidase [Neisseria gonorrhoeae 1291]
 gi|268582573|gb|EEZ47249.1| IgA-specific serine endopeptidase [Neisseria gonorrhoeae MS11]
          Length = 1532

 Score = 38.3 bits (87), Expect = 0.33,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 27   VAPPPPQT-LAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPK 85
            VAPP PQ   AE       +A Q   ++AAEA + A ++  EA +KAAE  I + +++ +
Sbjct: 1015 VAPPSPQANQAEEALRQQAKAEQVKRQQAAEAEKVARQKDEEAKRKAAE--IARQQEEAR 1072

Query: 86   ENQEVNEVPVAANIEPESQETQQQ 109
            +  E+      A  E +++E  +Q
Sbjct: 1073 KAAEL-AAKQKAEAERKARELARQ 1095


>gi|116283298|gb|AAH10237.1| ADD2 protein [Homo sapiens]
          Length = 709

 Score = 38.3 bits (87), Expect = 0.33,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPKENQEVNEVP 94
           ER K  LD   + A E+    A+ A     ++  K AE    +    K  +E  +  E  
Sbjct: 573 ERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETS 632

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            AA  EPE+ + +  V+N     QT  E       Q TT      S  T+  +SKDK
Sbjct: 633 KAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTT------SADTDVDTSKDK 683


>gi|34785151|gb|AAH56881.1| ADD2 protein [Homo sapiens]
 gi|38453594|gb|AAH51882.1| ADD2 protein [Homo sapiens]
          Length = 707

 Score = 38.3 bits (87), Expect = 0.33,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPKENQEVNEVP 94
           ER K  LD   + A E+    A+ A     ++  K AE    +    K  +E  +  E  
Sbjct: 573 ERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETS 632

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            AA  EPE+ + +  V+N     QT  E       Q TT      S  T+  +SKDK
Sbjct: 633 KAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTT------SADTDVDTSKDK 683


>gi|327281578|ref|XP_003225524.1| PREDICTED: telomere-associated protein RIF1-like [Anolis
            carolinensis]
          Length = 2345

 Score = 38.3 bits (87), Expect = 0.34,   Method: Composition-based stats.
 Identities = 34/148 (22%), Positives = 70/148 (47%), Gaps = 17/148 (11%)

Query: 26   PVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKK 83
            PV   P + ++   +A     +QK   ++     +  E++A++ +K ++  K  HKD +K
Sbjct: 1424 PVIDAPGEAISNVSQAPQISPSQKTLRRSLRRKPETMEESADSQEKGSQQKKDGHKDDEK 1483

Query: 84   -PKENQEVNEVPVAANIEPESQETQQQ-----------VINKTTTSQTDAEKTPNEKRQG 131
             PK++ +  E+ +  ++  ++ +T++            V ++  TS+   EK    K  G
Sbjct: 1484 LPKKSPQGKEIVIQKSVPEKTMDTRRGGIHGSNTADVIVTDECQTSRNSQEK--GNKSTG 1541

Query: 132  TTDGINNQSNATN-DPSSKDKIAENTKE 158
             T+G N+ S+  N   S+ D   E  K+
Sbjct: 1542 KTEGNNSASDIDNLQVSAPDATEEKPKD 1569


>gi|311747499|ref|ZP_07721284.1| hypothetical protein ALPR1_14204 [Algoriphagus sp. PR1]
 gi|126574859|gb|EAZ79230.1| hypothetical protein ALPR1_14204 [Algoriphagus sp. PR1]
          Length = 1775

 Score = 38.3 bits (87), Expect = 0.34,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 100  EPESQ---ETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAEN 155
            +PES    + + + I+KT     + E+TP E   GT  G+ N SN   D +  D +A+N
Sbjct: 1026 QPESDGQFDFRYKYIDKTVAGDPEKEETPYELHPGTLRGLYNISNIKEDGTVADFVAKN 1084


>gi|188593007|emb|CAQ55515.1| invariant surface glycoprotein, putative [Trypanosoma brucei
           TREU927]
          Length = 523

 Score = 38.3 bits (87), Expect = 0.34,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 10/58 (17%)

Query: 37  ERGKALLD-----EATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQE 89
           E+ K LL+     EAT+KAAEK A+ +RKA E+A E   KA E     D +  K+N++
Sbjct: 363 EKKKMLLEAVEKAEATEKAAEKQAKDSRKAFEEAEEERVKATE-----DAEAAKQNRD 415


>gi|320155871|ref|YP_004188250.1| methyl-accepting chemotaxis protein [Vibrio vulnificus MO6-24/O]
 gi|319931183|gb|ADV86047.1| methyl-accepting chemotaxis protein [Vibrio vulnificus MO6-24/O]
          Length = 486

 Score = 38.3 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 34  TLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEV 93
           T  +R KA+            AE A   +E+AA  AK+ A  +    ++    + E+N+V
Sbjct: 185 TAGQRDKAI----------SGAERATAQSEEAALNAKQGAANLTQVLQQATVSSTELNQV 234

Query: 94  PVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGIN 137
            +A + + ++ + Q   +N    SQ  A +  +++     +G+N
Sbjct: 235 SLALDSQSQTLDAQVSQLNLNCQSQASAAEEISQQIHHIAEGLN 278


>gi|27365488|ref|NP_761016.1| methyl-accepting chemotaxis protein [Vibrio vulnificus CMCP6]
 gi|27361636|gb|AAO10543.1| Methyl-accepting chemotaxis protein [Vibrio vulnificus CMCP6]
          Length = 486

 Score = 38.3 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 34  TLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEV 93
           T  +R KA+            AE A   +E+AA  AK+ A  +    ++    + E+N+V
Sbjct: 185 TAGQRDKAI----------SGAERATAQSEEAALNAKQGAANLTQVLQQATVSSTELNQV 234

Query: 94  PVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGIN 137
            +A + + ++ + Q   +N    SQ  A +  +++     +G+N
Sbjct: 235 SLALDSQSQTLDAQVSQLNLNCQSQASAAEEISQQIHHIAEGLN 278


>gi|37680470|ref|NP_935079.1| methyl-accepting chemotaxis protein [Vibrio vulnificus YJ016]
 gi|37199218|dbj|BAC95050.1| methyl-accepting chemotaxis protein [Vibrio vulnificus YJ016]
          Length = 488

 Score = 38.3 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 34  TLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEV 93
           T  +R KA+            AE A   +E+AA  AK+ A  +    ++    + E+N+V
Sbjct: 187 TAGQRDKAI----------SGAERATAQSEEAALNAKQGAANLTQVLQQATVSSTELNQV 236

Query: 94  PVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGIN 137
            +A + + ++ + Q   +N    SQ  A +  +++     +G+N
Sbjct: 237 SLALDSQSQTLDAQVSQLNLNCQSQASAAEEISQQIHHIAEGLN 280


>gi|240115121|ref|ZP_04729183.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae PID18]
 gi|268600796|ref|ZP_06134963.1| IgA1 protease [Neisseria gonorrhoeae PID18]
 gi|268584927|gb|EEZ49603.1| IgA1 protease [Neisseria gonorrhoeae PID18]
          Length = 1532

 Score = 38.3 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 27   VAPPPPQT-LAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPK 85
            VAPP PQ   AE       +A Q   ++AAEA + A ++  EA +KAAE  I + +++ +
Sbjct: 1015 VAPPSPQANQAEEALRQQAKAEQVKRQQAAEAEKVARQKDEEAKRKAAE--IARQQEEAR 1072

Query: 86   ENQEVNEVPVAANIEPESQETQQQ 109
            +  E+      A  E +++E  +Q
Sbjct: 1073 KAAEL-AAKQKAEAERKARELARQ 1095


>gi|123976381|ref|XP_001330511.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121896920|gb|EAY02057.1| hypothetical protein TVAG_383600 [Trichomonas vaginalis G3]
          Length = 913

 Score = 38.3 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 64  QAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIE-PESQETQQQVINKTTTSQTDAE 122
           Q  + + K   K+I ++++   EN ++ E  +AANIE PE ++      + +++S +D E
Sbjct: 841 QKGKFSPKRNRKLIKQNERLENENFKLKEKLIAANIEVPEEEDKNSSSSSSSSSSSSDTE 900

Query: 123 KTPNEKRQGTTD 134
           K+ NE+ +  TD
Sbjct: 901 KSDNEELKSDTD 912


>gi|240117404|ref|ZP_04731466.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae PID1]
 gi|268603101|ref|ZP_06137268.1| IgA-specific serine endopeptidase [Neisseria gonorrhoeae PID1]
 gi|268587232|gb|EEZ51908.1| IgA-specific serine endopeptidase [Neisseria gonorrhoeae PID1]
          Length = 1532

 Score = 38.3 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 27   VAPPPPQT-LAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPK 85
            VAPP PQ   AE       +A Q   ++AAEA + A ++  EA +KAAE  I + +++ +
Sbjct: 1015 VAPPSPQANQAEEALRQQAKAEQVKRQQAAEAEKVARQKDEEAKRKAAE--IARQQEEAR 1072

Query: 86   ENQEVNEVPVAANIEPESQETQQQ 109
            +  E+      A  E +++E  +Q
Sbjct: 1073 KAAEL-AAKQKAEAERKARELARQ 1095


>gi|240013587|ref|ZP_04720500.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae DGI18]
 gi|240016026|ref|ZP_04722566.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae FA6140]
 gi|240120656|ref|ZP_04733618.1| IgA-specific metalloendopeptidase [Neisseria gonorrhoeae PID24-1]
          Length = 1532

 Score = 38.3 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 27   VAPPPPQT-LAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPK 85
            VAPP PQ   AE       +A Q   ++AAEA + A ++  EA +KAAE  I + +++ +
Sbjct: 1015 VAPPSPQANQAEEALRQQAKAEQVKRQQAAEAEKVARQKDEEAKRKAAE--IARQQEEAR 1072

Query: 86   ENQEVNEVPVAANIEPESQETQQQ 109
            +  E+      A  E +++E  +Q
Sbjct: 1073 KAAEL-AAKQKAEAERKARELARQ 1095


>gi|50306131|ref|XP_453027.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49642160|emb|CAH01878.1| KLLA0C18568p [Kluyveromyces lactis]
          Length = 774

 Score = 38.3 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 47/116 (40%), Gaps = 9/116 (7%)

Query: 41  ALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHK---------DKKKPKENQEVN 91
           A L EA     ++A   +R++ EQ    A+KAA     K          KK+P +    +
Sbjct: 69  ASLHEAPAIVLQEAKPVSRESIEQEGAPAEKAASGNSSKLSMRLKKVFGKKEPSQPPVDS 128

Query: 92  EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPS 147
           E+   A+ E  +        N    ++T+++  P  KR   +DG   Q      PS
Sbjct: 129 ELSPPASSEAAANHDANDTTNTLNRNRTNSDTDPEPKRNLYSDGSQIQGTPLTSPS 184


>gi|114577970|ref|XP_001143877.1| PREDICTED: similar to beta adducin isoform 8 [Pan troglodytes]
          Length = 729

 Score = 38.3 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPKENQEVNEVP 94
           ER K  LD   + A E+    A+ A     ++  K AE    +    K  +E  +  E  
Sbjct: 576 ERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETS 635

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            AA  EPE+ + +  V+N     QT  E       Q TT      S  T+  +SKDK
Sbjct: 636 KAATPEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTT------SADTDVDTSKDK 686


>gi|71980604|ref|NP_001020990.1| UNCoordinated family member (unc-89) [Caenorhabditis elegans]
 gi|54607254|gb|AAV34801.1| Uncoordinated protein 89, isoform g, partially confirmed by
            transcript evidence [Caenorhabditis elegans]
          Length = 7122

 Score = 38.3 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 32   PQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVN 91
            P+ + +  +      +    EK+ E   K  E+ A   KK  E++    +K P    +  
Sbjct: 1363 PKEVIDSDRKKKKSPSPDKKEKSPE---KTEEKPASPTKKTGEEVKSPKEKSPASPTKKE 1419

Query: 92   EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            + P A  ++  +++       K+ +S T  EK+P+   + T D +  +S     P+ K+K
Sbjct: 1420 KSPAAEEVKSPTKK------EKSPSSPTKKEKSPSSPTKKTGDEVKEKS-PPKSPTKKEK 1472

Query: 152  IAENTKE 158
              E  ++
Sbjct: 1473 SPEKPED 1479


>gi|315122663|ref|YP_004063152.1| hypothetical protein CKC_04575 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313496065|gb|ADR52664.1| hypothetical protein CKC_04575 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 91

 Score = 38.3 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 42/70 (60%), Gaps = 2/70 (2%)

Query: 1  MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARK 60
          MK  KY+IILLSL+S T+ASCG    VAP PP     R  AL  EA  KA E A EAA+K
Sbjct: 20 MKISKYKIILLSLISLTLASCGSTTDVAPLPPPPTNHRISAL--EAAAKAIESAKEAAQK 77

Query: 61 AAEQAAEAAK 70
            + A   +K
Sbjct: 78 VIDDAIAISK 87


>gi|302880129|ref|YP_003848693.1| ATP synthase F0, B subunit [Gallionella capsiferriformans ES-2]
 gi|302582918|gb|ADL56929.1| ATP synthase F0, B subunit [Gallionella capsiferriformans ES-2]
          Length = 156

 Score = 38.3 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK  LD A +++AE   EA  KAA+  A   K+A E II   K + K   +      
Sbjct: 47  AERGKHDLDLAAKRSAELLREAKEKAADILASGDKRATE-IIEAAKLQAKVEADRIIAGA 105

Query: 96  AANIEPESQETQQQVINKTT 115
            A IE E+   ++Q+ ++ +
Sbjct: 106 TAEIEQEAFRAKEQLRSQVS 125


>gi|289621581|emb|CBI52364.1| unnamed protein product [Sordaria macrospora]
          Length = 1670

 Score = 38.0 bits (86), Expect = 0.40,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 30   PPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQE 89
            P  Q LAE+ +   +E   K A++A EA + AAE  AE A K  + +  +  +  +E+Q+
Sbjct: 1035 PKAQVLAEKAQKAKEEQQAKEAQEALEAGQAAAE-PAELANKLQQDVEPQIAEDIQESQD 1093

Query: 90   VNEVPVAANIEPE 102
             ++V  AA+I PE
Sbjct: 1094 ASQVYEAASIAPE 1106


>gi|134095610|ref|YP_001100685.1| translation initiation factor IF-2 [Herminiimonas arsenicoxydans]
 gi|166232551|sp|A4G7S7|IF2_HERAR RecName: Full=Translation initiation factor IF-2
 gi|133739513|emb|CAL62564.1| Translation initiation factor IF-2 [Herminiimonas arsenicoxydans]
          Length = 941

 Score = 38.0 bits (86), Expect = 0.41,   Method: Composition-based stats.
 Identities = 35/99 (35%), Positives = 48/99 (48%), Gaps = 9/99 (9%)

Query: 40  KALLDEATQ-KAAEKAAEAARKAAEQAAEAAKKAAEKIIHKD-KKKPKENQEVNEVPVAA 97
           K + DE  Q KA   A   A KA E  A  AK AAE  +HK   KKP E ++  +  V A
Sbjct: 234 KVVADEVAQIKAMMNAPRRAIKAPEPVAPVAKPAAEGTLHKPADKKPGEKKDEKKPAVTA 293

Query: 98  NIEPESQETQQQVINKTTTSQTDAEK-TPNEKRQGTTDG 135
           +      +   +  N ++T Q DA+K +   K +G T G
Sbjct: 294 D------KKSIKSANVSSTWQDDAKKRSAGIKTRGNTGG 326


>gi|1160355|gb|AAB00542.1| UNC-89 [Caenorhabditis elegans]
          Length = 6632

 Score = 38.0 bits (86), Expect = 0.42,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 32   PQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVN 91
            P+ + +  +      +    EK+ E   K  E+ A   KK  E++    +K P    +  
Sbjct: 1363 PKEVIDSDRKKKKSPSPDKKEKSPE---KTEEKPASPTKKTGEEVKSPKEKSPASPTKKE 1419

Query: 92   EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            + P A  ++  +++       K+ +S T  EK+P+   + T D +  +S     P+ K+K
Sbjct: 1420 KSPAAEEVKSPTKK------EKSPSSPTKKEKSPSSPTKKTGDEVKEKS-PPKSPTKKEK 1472

Query: 152  IAENTKE 158
              E  ++
Sbjct: 1473 SPEKPED 1479


>gi|123496124|ref|XP_001326896.1| CK1 family protein kinase [Trichomonas vaginalis G3]
 gi|121909817|gb|EAY14673.1| CK1 family protein kinase [Trichomonas vaginalis G3]
          Length = 971

 Score = 38.0 bits (86), Expect = 0.43,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 54/124 (43%), Gaps = 17/124 (13%)

Query: 44  DEATQKAAEKAAEAARKAAEQAAE---AAKKAAEKIIHKDKK-----KPKENQEVNEVPV 95
           DE  QK+  K  E  +K+  +  E     K    K I+++KK     KPKE ++  + P+
Sbjct: 841 DEDKQKSQNKDDEDKQKSQNKDDEDKNIVKGDKNKQINEEKKPEQTTKPKEEEKTEQKPI 900

Query: 96  AANIEPESQETQQQVINKTTTSQ---------TDAEKTPNEKRQGTTDGINNQSNATNDP 146
            A+    SQE++ +   +  T Q         ++ EK  N       + +  Q  A  DP
Sbjct: 901 IADDNKISQESKPEPPKQNNTDQKPQISSEKPSEEEKRVNSDETKKNEEVKKQKQAKEDP 960

Query: 147 SSKD 150
           + +D
Sbjct: 961 NDED 964


>gi|71980586|ref|NP_001020984.1| UNCoordinated family member (unc-89) [Caenorhabditis elegans]
 gi|20198774|gb|AAB54132.2| Uncoordinated protein 89, isoform a, partially confirmed by
            transcript evidence [Caenorhabditis elegans]
          Length = 6632

 Score = 38.0 bits (86), Expect = 0.44,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 32   PQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVN 91
            P+ + +  +      +    EK+ E   K  E+ A   KK  E++    +K P    +  
Sbjct: 1363 PKEVIDSDRKKKKSPSPDKKEKSPE---KTEEKPASPTKKTGEEVKSPKEKSPASPTKKE 1419

Query: 92   EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            + P A  ++  +++       K+ +S T  EK+P+   + T D +  +S     P+ K+K
Sbjct: 1420 KSPAAEEVKSPTKK------EKSPSSPTKKEKSPSSPTKKTGDEVKEKS-PPKSPTKKEK 1472

Query: 152  IAENTKE 158
              E  ++
Sbjct: 1473 SPEKPED 1479


>gi|145636018|ref|ZP_01791697.1| IgA-specific serine endopeptidase [Haemophilus influenzae PittAA]
 gi|145266727|gb|EDK06752.1| IgA-specific serine endopeptidase [Haemophilus influenzae PittAA]
          Length = 1235

 Score = 38.0 bits (86), Expect = 0.44,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 40/80 (50%), Gaps = 16/80 (20%)

Query: 27   VAPPPPQ------TLAERGKALLDEATQKAAEKAA-----EAARKAAEQA--AEAAKKAA 73
            VAPP PQ       L ++ KA   +  Q  AEK A     EA RKAAE A   E A+KA 
Sbjct: 1026 VAPPSPQANQTEEALRQQAKAEQVKRQQAEAEKVARQKDEEAKRKAAEIARQQEEARKAT 1085

Query: 74   EKIIHKDKKKPKENQEVNEV 93
            E      K+K +E ++  E+
Sbjct: 1086 EL---AAKQKAEEERKAAEI 1102


>gi|258576957|ref|XP_002542660.1| predicted protein [Uncinocarpus reesii 1704]
 gi|237902926|gb|EEP77327.1| predicted protein [Uncinocarpus reesii 1704]
          Length = 1455

 Score = 38.0 bits (86), Expect = 0.44,   Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 40/91 (43%), Gaps = 8/91 (8%)

Query: 26  PVAPPPPQTLAERGKALLDEATQKAAEKAA----EAARKAAEQAAEAAKKAAEKIIHKDK 81
           P A PPP+T A RG+    E   +  E+      E  R AAEQAAE  K    K   KDK
Sbjct: 581 PSATPPPRT-ASRGEPDQAEPKVQTQEQKIQSFHEKVRLAAEQAAEEQKALELKKTTKDK 639

Query: 82  KKP---KENQEVNEVPVAANIEPESQETQQQ 109
                 K   E++E P A   E E    + Q
Sbjct: 640 DDSEPLKAAPEISETPAAQPEEAEKPAPEPQ 670


>gi|154508904|ref|ZP_02044546.1| hypothetical protein ACTODO_01415 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798538|gb|EDN80958.1| hypothetical protein ACTODO_01415 [Actinomyces odontolyticus ATCC
           17982]
          Length = 319

 Score = 38.0 bits (86), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 27/44 (61%)

Query: 30  PPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAA 73
           PPP+ LA   + +  E T++A    AEA R+A  + AE AK+AA
Sbjct: 174 PPPRVLAAMEQQITAERTKRATILTAEAEREAQIKKAEGAKQAA 217


>gi|313112911|ref|ZP_07798557.1| 1,4-alpha-glucan branching enzyme [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310624816|gb|EFQ08125.1| 1,4-alpha-glucan branching enzyme [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 750

 Score = 38.0 bits (86), Expect = 0.45,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 54/119 (45%), Gaps = 19/119 (15%)

Query: 23  QADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAA-----RKAAEQAAEAAKKAAEKII 77
           Q+  +  PP  TL        +  T++  + AA+       + AA++    A+KAA K++
Sbjct: 629 QSITITLPPMSTL------YFEVPTKRTRKAAADKTDKAGKKTAAKKTKTVAEKAAAKVV 682

Query: 78  HKDKKKPK------ENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD--AEKTPNEK 128
            K  +KPK      E + V +    A +EPE  E   +   +   ++ +  AEK P ++
Sbjct: 683 KKPGRKPKAEAASAEEKSVKKTARKAKVEPEKAEEAPKKCGRKPKAEAEPKAEKAPAKR 741


>gi|293192642|ref|ZP_06609596.1| SPFH domain/Band 7 family protein [Actinomyces odontolyticus F0309]
 gi|292820149|gb|EFF79146.1| SPFH domain/Band 7 family protein [Actinomyces odontolyticus F0309]
          Length = 319

 Score = 38.0 bits (86), Expect = 0.45,   Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 27/44 (61%)

Query: 30  PPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAA 73
           PPP+ LA   + +  E T++A    AEA R+A  + AE AK+AA
Sbjct: 174 PPPRVLAAMEQQITAERTKRATILTAEAEREAQIKKAEGAKQAA 217


>gi|22326948|ref|NP_680188.1| AtRFC1 (replication factor C 1); ATP binding / DNA binding / DNA
           clamp loader/ nucleoside-triphosphatase/ nucleotide
           binding [Arabidopsis thaliana]
 gi|13374860|emb|CAC34494.1| replication factor C large subunit-like protein [Arabidopsis
           thaliana]
 gi|48958527|gb|AAT47816.1| At5g22010 [Arabidopsis thaliana]
 gi|332005585|gb|AED92968.1| replication factor C1 [Arabidopsis thaliana]
          Length = 956

 Score = 38.0 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 21/125 (16%)

Query: 37  ERGKALLDEATQKAA---EKAAEAARKAAEQAAE----AAKKAAEKIIHKDKKKPKENQE 89
           E+G     ++T   A   + AAE A   +EQA+E    A ++   K   KDK K K+ +E
Sbjct: 13  EKGNGSAPKSTSSKAGPVKNAAETAPIKSEQASEDLETADRRKTSKYFGKDKTKVKDEKE 72

Query: 90  VNEVPVAANIEPESQETQQQVINKTTT-------------SQTDAEKTPNEK-RQGTTDG 135
           V  +P    ++ ES +  +    K T              S+   + TP++K + G+  G
Sbjct: 73  VEAIPAKRKLKTESDDLVKPRPRKVTKVVDDDDDDFDVPISRKTRDTTPSKKLKSGSGRG 132

Query: 136 INNQS 140
           I +++
Sbjct: 133 IASKT 137


>gi|262067498|ref|ZP_06027110.1| conserved hypothetical protein [Fusobacterium periodonticum ATCC
           33693]
 gi|291378761|gb|EFE86279.1| conserved hypothetical protein [Fusobacterium periodonticum ATCC
           33693]
          Length = 184

 Score = 38.0 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 84  PKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNAT 143
           P EN ++ EV    +I  E+ +TQ+ ++ +   S +D EK   EK  G  +  + +  AT
Sbjct: 18  PLENNQIKEVTPIESIHSEAIKTQEDILLE-KASLSDEEKELFEK--GNKEYTSEELKAT 74

Query: 144 NDPSSKDKIAENTKED 159
           N  S+K  + EN K++
Sbjct: 75  NVISTKKDLKENKKDE 90


>gi|296132364|ref|YP_003639611.1| methyl-accepting chemotaxis sensory transducer [Thermincola sp. JR]
 gi|296030942|gb|ADG81710.1| methyl-accepting chemotaxis sensory transducer [Thermincola potens
           JR]
          Length = 618

 Score = 38.0 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 28/109 (25%), Positives = 55/109 (50%), Gaps = 11/109 (10%)

Query: 55  AEAARKAAEQAAEAAKKAAEKIIH----KDKKKPKENQEVNEVPVAANIEPESQETQQQV 110
           A+  RK AE++++A K+ AE + +     DK     N+   EV   AN+  ++ +  + +
Sbjct: 445 ADEVRKLAERSSKATKEIAELVNNIRQGTDKAVLAMNESTTEVETGANLAIDAGKALESI 504

Query: 111 INKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159
           +N  T +  +  K  N  ++     I+NQ+  T    + D +A+ T+E+
Sbjct: 505 LNNVTRTNDEIHKISNAVQR-----ISNQN--TEVVEAIDVVAQVTEEN 546


>gi|114577958|ref|XP_001143122.1| PREDICTED: similar to beta adducin isoform 1 [Pan troglodytes]
 gi|114577960|ref|XP_001143202.1| PREDICTED: similar to beta adducin isoform 2 [Pan troglodytes]
 gi|114577962|ref|XP_001143283.1| PREDICTED: beta-adducin isoform 3 [Pan troglodytes]
 gi|114577964|ref|XP_001143353.1| PREDICTED: similar to beta adducin isoform 4 [Pan troglodytes]
 gi|114577966|ref|XP_001143425.1| PREDICTED: similar to beta adducin isoform 5 [Pan troglodytes]
 gi|114577968|ref|XP_001143954.1| PREDICTED: beta-adducin isoform 9 [Pan troglodytes]
 gi|332813674|ref|XP_003309148.1| PREDICTED: beta-adducin [Pan troglodytes]
          Length = 726

 Score = 37.6 bits (85), Expect = 0.52,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPKENQEVNEVP 94
           ER K  LD   + A E+    A+ A     ++  K AE    +    K  +E  +  E  
Sbjct: 573 ERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETS 632

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            AA  EPE+ + +  V+N     QT  E       Q TT      S  T+  +SKDK
Sbjct: 633 KAATPEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTT------SADTDVDTSKDK 683


>gi|325116257|emb|CBZ51810.1| conserved hypothetical protein [Neospora caninum Liverpool]
          Length = 708

 Score = 37.6 bits (85), Expect = 0.52,   Method: Composition-based stats.
 Identities = 41/142 (28%), Positives = 59/142 (41%), Gaps = 15/142 (10%)

Query: 24  ADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAK---------KAAE 74
           A+  APP P  L E   A+ DE+ + A  KAA  A  A E +A   K          A+ 
Sbjct: 64  AENRAPPSPSLLVEAPSAIADESQRTAFSKAAGNAEGAEESSAAEEKPHISPDKEAPASS 123

Query: 75  KIIHK---DKKKPKENQEVNEVPVAANIE--PESQETQQQVINKTTTSQTDAEKTPNEKR 129
             +HK   +K   KEN+EV  V      +   E   T +    + +     AE +P + R
Sbjct: 124 GRLHKTPAEKTDAKENEEVQGVERKGKGDDAQEKPHTAESPSARLSAEGEKAEDSPTQTR 183

Query: 130 QGTTDGINNQSNATNDPSSKDK 151
           +G  D  N +  A     SK +
Sbjct: 184 EG-VDSENEKKPAIETERSKSR 204


>gi|302878489|ref|YP_003847053.1| translation initiation factor IF-2 [Gallionella capsiferriformans
           ES-2]
 gi|302581278|gb|ADL55289.1| translation initiation factor IF-2 [Gallionella capsiferriformans
           ES-2]
          Length = 884

 Score = 37.6 bits (85), Expect = 0.52,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 56/131 (42%), Gaps = 19/131 (14%)

Query: 17  TMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAA--KKAAE 74
           ++ S   A PV     + +   G A LD   Q+A  +A  AAR+ AE  A  A  K+ AE
Sbjct: 99  SIESVQAAAPVVLTSAEQIKVLGTAELDSREQEAKLQAELAARQEAELIARQAFNKRRAE 158

Query: 75  KI---------------IHKDKKKPKENQEVNEV-PVAAN-IEPESQETQQQVINKTTTS 117
           K+               + +D         V ++ PVA+  I+P++ E  Q  ++K T  
Sbjct: 159 KLAQVEAPVVKAALQAPVKEDVAAEVPAAVVADIEPVASQPIKPQAAEVAQGTLHKPTMR 218

Query: 118 QTDAEKTPNEK 128
             D    P+ K
Sbjct: 219 PGDKVIRPDRK 229


>gi|123497615|ref|XP_001327219.1| Formin Homology 2 Domain containing protein [Trichomonas vaginalis
            G3]
 gi|121910145|gb|EAY14996.1| Formin Homology 2 Domain containing protein [Trichomonas vaginalis
            G3]
          Length = 1322

 Score = 37.6 bits (85), Expect = 0.53,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 60/136 (44%), Gaps = 26/136 (19%)

Query: 44   DEATQKAAEKAAEAARKAAEQA------AEAAKKAAEKIIHKD------------KKKPK 85
            ++A + AA+KAAE ARKA E+A         A   AE+ +               KKK +
Sbjct: 1127 NKARELAAQKAAERARKAEERARMKQGQKPVAPDGAERGVIDSLVQNMEKGNIVLKKKHE 1186

Query: 86   ENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNA--- 142
             N   +  P  + +E +  + + +    +   Q+D+ K  NEK+   +D  NN       
Sbjct: 1187 SNVPEDTTPKVSELEKKMAQRRAKAEKSSDAKQSDSSKN-NEKQ---SDAANNNKKTPEK 1242

Query: 143  -TNDPSSKDKIAENTK 157
             +++    DK ++N K
Sbjct: 1243 NSDNVKPTDKKSDNVK 1258


>gi|229845174|ref|ZP_04465308.1| IgA-specific serine endopeptidase [Haemophilus influenzae 6P18H1]
 gi|229811885|gb|EEP47580.1| IgA-specific serine endopeptidase [Haemophilus influenzae 6P18H1]
          Length = 1598

 Score = 37.6 bits (85), Expect = 0.57,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 40/80 (50%), Gaps = 16/80 (20%)

Query: 27   VAPPPPQ------TLAERGKALLDEATQKAAEKAA-----EAARKAAEQA--AEAAKKAA 73
            VAPP PQ       L ++ KA   +  Q  AEK A     EA RKAAE A   E A+KA 
Sbjct: 975  VAPPSPQANQTEEALRQQAKAEQVKRQQAEAEKVARQKDEEAKRKAAEIARQQEEARKAT 1034

Query: 74   EKIIHKDKKKPKENQEVNEV 93
            E      K+K +E ++  E+
Sbjct: 1035 EL---AAKQKAEEERKAAEI 1051


>gi|195442109|ref|XP_002068802.1| GK17973 [Drosophila willistoni]
 gi|194164887|gb|EDW79788.1| GK17973 [Drosophila willistoni]
          Length = 866

 Score = 37.6 bits (85), Expect = 0.58,   Method: Composition-based stats.
 Identities = 34/118 (28%), Positives = 58/118 (49%), Gaps = 8/118 (6%)

Query: 40  KALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE-KIIHKDKKKPKENQEVNEVPVAAN 98
           K  L+++  K   K  E   K A++  +A K   + +   K+ KKP++ ++ N+ P  A+
Sbjct: 690 KKKLEQSKSKYVAKVFEKPVKKAKKQQQAEKNDKKPQQAEKNDKKPQQAEKNNKKPPQAD 749

Query: 99  IEPESQETQQQV--INKTTTSQT---DAEKTPNEKRQGT--TDGINNQSNATNDPSSK 149
            + + Q T+Q+   IN  TTSQ    + +K   +K Q T  T+GI         P +K
Sbjct: 750 KKAKKQLTEQEKKPINGETTSQKTQLNGQKKVQKKAQETTQTNGIEKLQKQQQKPPAK 807


>gi|300812595|ref|ZP_07093012.1| translation initiation factor IF-2 [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|300496468|gb|EFK31573.1| translation initiation factor IF-2 [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
          Length = 825

 Score = 37.6 bits (85), Expect = 0.59,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 43/108 (39%), Gaps = 2/108 (1%)

Query: 46  ATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQE 105
           +  K   K  E+A K AE AAEA K    KI+     + K+NQ  +E P A         
Sbjct: 106 SESKPVVKKVESAEKPAETAAEAPKVRGPKILKPSPARLKQNQANSEKPAAKPSSSRRPS 165

Query: 106 TQQQVINKTTTSQTDAEKTPNEK--RQGTTDGINNQSNATNDPSSKDK 151
           ++  +         +  +  + K  R+G     N    A +D S + K
Sbjct: 166 SRPSLTEAPMPENKEGRRRTSGKPGRKGQNSYANQGRGANSDRSQQRK 213


>gi|319778226|ref|YP_004129139.1| Translation initiation factor 2 [Taylorella equigenitalis MCE9]
 gi|317108250|gb|ADU90996.1| Translation initiation factor 2 [Taylorella equigenitalis MCE9]
          Length = 939

 Score = 37.6 bits (85), Expect = 0.60,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 17/128 (13%)

Query: 30  PPPQTLAERGKALLDEATQKA---AEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKE 86
           P P+ ++ + +++    +QK+   AEK  E ARK A+  AEA  + A     ++ K  K+
Sbjct: 184 PIPEAVSPKVESVQPVKSQKSTEEAEKNREDARKKAQSEAEALTQYA-----RNPKPAKK 238

Query: 87  NQEVNEVPVAANIEPESQETQQQVINKTTTSQT----DAEKTPNEKRQGTTDGINNQSNA 142
                 VP ++  EP +++     + KT ++Q     D + + N+K+     G   +S  
Sbjct: 239 ATPAPSVPSSSVAEPSAKKVNTPNVTKTVSTQAKPVVDEDDSDNKKK-----GSKAKSTK 293

Query: 143 TNDPSSKD 150
            +D S K+
Sbjct: 294 GSDKSEKN 301


>gi|242012235|ref|XP_002426839.1| ebna2 binding protein P100, putative [Pediculus humanus corporis]
 gi|212511052|gb|EEB14101.1| ebna2 binding protein P100, putative [Pediculus humanus corporis]
          Length = 2247

 Score = 37.6 bits (85), Expect = 0.61,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 47/118 (39%), Gaps = 9/118 (7%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVA 96
           ER   L +       +K  +  +K   +     + A+  I++K+ KKP  N E + VP  
Sbjct: 806 ERKSNLPNNENNIKIDKLNKGLKKNDMKHTSDNENASAGIVNKNDKKPYSNPEKSNVPFN 865

Query: 97  ANIEPESQ---------ETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATND 145
             + PE Q         E ++ +  KT T     E+      +    G  N+++  +D
Sbjct: 866 KKLTPEKQSSLGKKEGNEPKKSIDKKTETKTRSTERKFRSNFERDKFGKENRNDFKSD 923


>gi|118369186|ref|XP_001017798.1| XMAP215 protein [Tetrahymena thermophila]
 gi|89299565|gb|EAR97553.1| XMAP215 protein [Tetrahymena thermophila SB210]
          Length = 2501

 Score = 37.6 bits (85), Expect = 0.62,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 52/117 (44%), Gaps = 19/117 (16%)

Query: 44  DEATQKAAEKAAEAARKAAEQAAEAAKKAAEK---IIHKDKKKPKENQEVNEVPVAANIE 100
           D+  Q+  + + +A +K +  +  A K   +K   +  K ++  ++N E++E PV+ N  
Sbjct: 154 DKNEQENQDNSQQADKKPSASSTAADKPWLKKKAVVSDKSEESSQQNNEIDEKPVSGNTN 213

Query: 101 PESQE-------TQQQVIN---------KTTTSQTDAEKTPNEKRQGTTDGINNQSN 141
            ++ E       + ++  N         K  T   D E   NE+  G T  +NNQ +
Sbjct: 214 QKNLEDDRPIGTSNKEASNDDRPIGGGPKKNTFSQDQEYPDNERPLGNTKQVNNQDD 270


>gi|189239270|ref|XP_001810058.1| PREDICTED: similar to transcriptional regulator ATRX (X-linked
           helicase II) [Tribolium castaneum]
          Length = 1848

 Score = 37.6 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 37/140 (26%), Positives = 60/140 (42%), Gaps = 23/140 (16%)

Query: 31  PPQTLAERGKALLDEATQKA----AEKAAEAARKAAEQAAEAAKK---AAEKIIHKDKKK 83
           P +  +E   + LDE    +     EK  + A   +E+ AE A     + +      ++ 
Sbjct: 702 PEKDSSESTASDLDEEINHSPVSEVEKNQDLAVGNSEEMAEDALNLLNSDKDDSDDKEEA 761

Query: 84  PKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNAT 143
           P+EN E       ++ E   +ET ++   K  T++T      NE  Q  T+  +N S  T
Sbjct: 762 PEENSE------NSDKEKNGKETAEKASEKDPTNET------NENEQDNTEKNDNGSEKT 809

Query: 144 NDPSSK----DKIAENTKED 159
           ND  S+    DK  E +K D
Sbjct: 810 NDDQSEKEANDKSDEGSKSD 829


>gi|257053300|ref|YP_003131133.1| extracellular solute-binding protein family 5 [Halorhabdus
           utahensis DSM 12940]
 gi|256692063|gb|ACV12400.1| extracellular solute-binding protein family 5 [Halorhabdus
           utahensis DSM 12940]
          Length = 735

 Score = 37.6 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 31/79 (39%), Gaps = 4/79 (5%)

Query: 68  AAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNE 127
           A K         D K    ++ V   P     +  + E++   + +  TS TDAE    +
Sbjct: 637 ATKTVTPTATPTDPKTATVSETVTNTPATTETDRSATESRTTTVTEIPTSTTDAESEGGQ 696

Query: 128 KRQGTTDGINNQSNATNDP 146
             Q +TDG    +  TN P
Sbjct: 697 NTQDSTDG----ATTTNGP 711


>gi|254805224|ref|YP_003083445.1| putative DNA polymerase III tau and gamma chain [Neisseria
           meningitidis alpha14]
 gi|254668766|emb|CBA06660.1| putative DNA polymerase III tau and gamma chain [Neisseria
           meningitidis alpha14]
          Length = 710

 Score = 37.2 bits (84), Expect = 0.67,   Method: Composition-based stats.
 Identities = 40/148 (27%), Positives = 62/148 (41%), Gaps = 22/148 (14%)

Query: 6   YQIILLSLLSTTMASCGQADPVA--------PPPPQTLAERGKALLDEATQKAAEKAAEA 57
           + + LL +L+ T  +    D  A         P  QT AE+  A      +  AE A  +
Sbjct: 348 FMMTLLRMLAFTPLAAASCDANAVIENTELQSPSVQT-AEKEAAAKKPQPRPEAETAQTS 406

Query: 58  ARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQE---TQQQVINKT 114
            + A+  A  +  K AE         P  NQE N+VP   +   E+Q    T  Q   K+
Sbjct: 407 VQTASAAAMPSEGKTAE---------PVTNQENNDVPPWEDAPDEAQTAAGTTAQTSAKS 457

Query: 115 TTSQTDAEKTPNEKRQGTTDGINNQSNA 142
             + ++AE TP E +       +N++NA
Sbjct: 458 IQTASEAE-TPPENQVSKNKAADNETNA 484


>gi|322782508|gb|EFZ10457.1| hypothetical protein SINV_11681 [Solenopsis invicta]
          Length = 873

 Score = 37.2 bits (84), Expect = 0.68,   Method: Composition-based stats.
 Identities = 38/147 (25%), Positives = 66/147 (44%), Gaps = 21/147 (14%)

Query: 33  QTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHK---DKKKPKENQE 89
           + +AER K   + A +K +E+  E+      + A   K   E+I      D+     +QE
Sbjct: 603 ENIAERIKRRKENAEKKTSEQGIESNASKRNRTATKKKTLLERIDEDPTVDQAALSTSQE 662

Query: 90  VNEVPVA----ANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTT---------DGI 136
             E+  +    A     S+ TQ++ + K  +S TDA  +P +  +  T         DG+
Sbjct: 663 STEIDGSSMRRAKRRKTSKSTQKEDMEKNESS-TDAASSPRKSARNLTRVSSMANESDGV 721

Query: 137 NNQSNAT----NDPSSKDKIAENTKED 159
            N++N+     + P S D+I E T E+
Sbjct: 722 RNKTNSKFNYDSPPESCDEIEECTPEN 748


>gi|59802443|ref|YP_209155.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA 1090]
 gi|194100107|ref|YP_002003247.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae NCCP11945]
 gi|239998095|ref|ZP_04718019.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae 35/02]
 gi|240013276|ref|ZP_04720189.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae DGI18]
 gi|240015724|ref|ZP_04722264.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA6140]
 gi|240079858|ref|ZP_04724401.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA19]
 gi|240112067|ref|ZP_04726557.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae MS11]
 gi|240114813|ref|ZP_04728875.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae PID18]
 gi|240117015|ref|ZP_04731077.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae PID1]
 gi|240120348|ref|ZP_04733310.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae PID24-1]
 gi|240122652|ref|ZP_04735608.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae PID332]
 gi|240124840|ref|ZP_04737726.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae SK-92-679]
 gi|240127355|ref|ZP_04740016.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae SK-93-1035]
 gi|254492877|ref|ZP_05106048.1| ATP synthase subunit B [Neisseria gonorrhoeae 1291]
 gi|260441373|ref|ZP_05795189.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae DGI2]
 gi|268593947|ref|ZP_06128114.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae 35/02]
 gi|268596003|ref|ZP_06130170.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA19]
 gi|268598126|ref|ZP_06132293.1| ATP synthase subunit B [Neisseria gonorrhoeae MS11]
 gi|268600469|ref|ZP_06134636.1| ATP synthase subunit B [Neisseria gonorrhoeae PID18]
 gi|268602701|ref|ZP_06136868.1| ATP synthase subunit B [Neisseria gonorrhoeae PID1]
 gi|268681251|ref|ZP_06148113.1| ATP synthase subunit B [Neisseria gonorrhoeae PID332]
 gi|268683421|ref|ZP_06150283.1| ATP synthase subunit B [Neisseria gonorrhoeae SK-92-679]
 gi|268685728|ref|ZP_06152590.1| ATP synthase subunit B [Neisseria gonorrhoeae SK-93-1035]
 gi|291044730|ref|ZP_06570439.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae DGI2]
 gi|293397829|ref|ZP_06642035.1| ATP synthase F0, B subunit [Neisseria gonorrhoeae F62]
 gi|75355268|sp|Q5F4Z4|ATPF_NEIG1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694329|sp|B4RJF6|ATPF_NEIG2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|59719338|gb|AAW90743.1| putative ATP synthase B chain [Neisseria gonorrhoeae FA 1090]
 gi|193935397|gb|ACF31221.1| AtpF [Neisseria gonorrhoeae NCCP11945]
 gi|226511917|gb|EEH61262.1| ATP synthase subunit B [Neisseria gonorrhoeae 1291]
 gi|268547336|gb|EEZ42754.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae 35/02]
 gi|268549791|gb|EEZ44810.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA19]
 gi|268582257|gb|EEZ46933.1| ATP synthase subunit B [Neisseria gonorrhoeae MS11]
 gi|268584600|gb|EEZ49276.1| ATP synthase subunit B [Neisseria gonorrhoeae PID18]
 gi|268586832|gb|EEZ51508.1| ATP synthase subunit B [Neisseria gonorrhoeae PID1]
 gi|268621535|gb|EEZ53935.1| ATP synthase subunit B [Neisseria gonorrhoeae PID332]
 gi|268623705|gb|EEZ56105.1| ATP synthase subunit B [Neisseria gonorrhoeae SK-92-679]
 gi|268626012|gb|EEZ58412.1| ATP synthase subunit B [Neisseria gonorrhoeae SK-93-1035]
 gi|291011624|gb|EFE03620.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae DGI2]
 gi|291611775|gb|EFF40844.1| ATP synthase F0, B subunit [Neisseria gonorrhoeae F62]
 gi|317165539|gb|ADV09080.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 156

 Score = 37.2 bits (84), Expect = 0.68,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   + +E  A A K+AA KI+ + K++            
Sbjct: 47  AERGKSDFEQAEKKVAELLAEGRNQVSEMVANAEKRAA-KIVEEAKEQASSEAARIAAQA 105

Query: 96  AANIEPE 102
            A++E E
Sbjct: 106 KADVEQE 112


>gi|154308765|ref|XP_001553718.1| hypothetical protein BC1G_07805 [Botryotinia fuckeliana B05.10]
 gi|150852756|gb|EDN27948.1| hypothetical protein BC1G_07805 [Botryotinia fuckeliana B05.10]
          Length = 458

 Score = 37.2 bits (84), Expect = 0.68,   Method: Composition-based stats.
 Identities = 42/152 (27%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 17  TMASCGQADPVAPPPPQTLAERGKALLDEATQKAA------EKAAEAARKAAEQAAEAAK 70
           T AS    D  A P  +T    G ++  +AT+++       E+A EA   +    A++A+
Sbjct: 140 TEASQTSTDAAAQPAIETRGAWGTSI-PQATEESTVETQPIEEALEATHISTADEAKSAE 198

Query: 71  KAAEKIIHKDKKKPKENQEVNEVPVAANIEPES-QETQQQVINKTTTSQTDAEK--TP-N 126
           K AE  + ++  K    +E  + P AA  EPE+  ET ++V    + +++D E   TP N
Sbjct: 199 KPAEDAVTEESTKDGVTEEQTQEPTAAT-EPETIPETIEEVPASESDAESDGEGWITPSN 257

Query: 127 EKRQGTTDGINNQSNATNDPSSKDKIAENTKE 158
            K+    D   N S +  + S   ++A  T +
Sbjct: 258 LKKHQQKD--TNSSFSPQEESKTIQVATITTD 287


>gi|225075910|ref|ZP_03719109.1| hypothetical protein NEIFLAOT_00934 [Neisseria flavescens
           NRL30031/H210]
 gi|224952766|gb|EEG33975.1| hypothetical protein NEIFLAOT_00934 [Neisseria flavescens
           NRL30031/H210]
          Length = 156

 Score = 37.2 bits (84), Expect = 0.69,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   +  E  A A K+AA KI+ + K++            
Sbjct: 47  AERGKSDFEQAEKKVAELMAEGRNQVTEMVANAEKRAA-KIVEEAKEQASHEAARIAAQA 105

Query: 96  AANIEPESQETQQQVINKTTT 116
            A++E E    ++ +  +  T
Sbjct: 106 KADVEQEVNRAREVLREQVAT 126


>gi|123393069|ref|XP_001300341.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121881364|gb|EAX87411.1| hypothetical protein TVAG_189240 [Trichomonas vaginalis G3]
          Length = 1369

 Score = 37.2 bits (84), Expect = 0.71,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 79   KDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKT-PNEKR 129
            KDKKK K N+  NE  +++    +++E  Q+  N+    +   EKT PNE +
Sbjct: 1010 KDKKKSKSNEVKNETKISSKKSQKTEEKSQKNPNENKNQKLQEEKTKPNESK 1061


>gi|261378155|ref|ZP_05982728.1| ATP synthase F0, B subunit [Neisseria cinerea ATCC 14685]
 gi|296313932|ref|ZP_06863873.1| ATP synthase F0, B subunit [Neisseria polysaccharea ATCC 43768]
 gi|269145618|gb|EEZ72036.1| ATP synthase F0, B subunit [Neisseria cinerea ATCC 14685]
 gi|296839470|gb|EFH23408.1| ATP synthase F0, B subunit [Neisseria polysaccharea ATCC 43768]
          Length = 156

 Score = 37.2 bits (84), Expect = 0.72,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   +  E  A A K+AA KI+ + K++            
Sbjct: 47  AERGKSDFEQAEKKVAELMAEGRHQVTEMVANAEKRAA-KIVEEAKEQASHEAARIAAQA 105

Query: 96  AANIEPESQETQQ 108
            A++E E    ++
Sbjct: 106 KADVEQEVNRARE 118


>gi|115442738|ref|XP_001218176.1| histone deacetylase RPD3 [Aspergillus terreus NIH2624]
 gi|114188045|gb|EAU29745.1| histone deacetylase RPD3 [Aspergillus terreus NIH2624]
          Length = 675

 Score = 37.2 bits (84), Expect = 0.74,   Method: Composition-based stats.
 Identities = 36/142 (25%), Positives = 61/142 (42%), Gaps = 2/142 (1%)

Query: 16  TTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEK 75
           T MA  G+ +PVAP  P +  E  KA  ++ T + A +A  A      + +EA   A   
Sbjct: 512 TEMAVDGK-EPVAPSAPVSRPESPKAQDEDTTMEDAGEAEAAPEPEKTEQSEAPAPAVND 570

Query: 76  IIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDG 135
            + +++ KP E   ++E  V    E  + E  Q    + T+     E    EK +  T+ 
Sbjct: 571 SL-REENKPVEEIAMSEKTVQEPTEERAPEKAQSPPKEPTSQDGAQEAAEAEKVEELTEK 629

Query: 136 INNQSNATNDPSSKDKIAENTK 157
           +      T +   ++  AE T+
Sbjct: 630 MVEPQEKTPEAPKEEPAAEKTE 651


>gi|241758905|ref|ZP_04757017.1| ATP synthase F0, B subunit [Neisseria flavescens SK114]
 gi|241320726|gb|EER56959.1| ATP synthase F0, B subunit [Neisseria flavescens SK114]
          Length = 156

 Score = 37.2 bits (84), Expect = 0.74,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   +  E  A A K+AA KI+ + K++            
Sbjct: 47  AERGKSDFEQAEKKVAELMAEGRNQVTEMVANAEKRAA-KIVEEAKEQASHEAARIAAQA 105

Query: 96  AANIEPESQETQQQVINKTTT 116
            A++E E    ++ +  +  T
Sbjct: 106 KADVEQEVNRAREVLREQVAT 126


>gi|4218031|gb|AAD12715.1| unknown [Homo sapiens]
          Length = 541

 Score = 37.2 bits (84), Expect = 0.74,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPKENQEVNEVP 94
           ER K  LD   + A E+    A+ A     ++  K AE    +    K  +E  +  E  
Sbjct: 388 ERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETS 447

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            AA  EPE+ + +  V+N     QT  E       Q TT      S  T+  +SKDK
Sbjct: 448 KAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTT------SADTDVDTSKDK 498


>gi|309379547|emb|CBX21913.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 156

 Score = 37.2 bits (84), Expect = 0.76,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   +  E  A A K+AA KI+ + K++  +         
Sbjct: 47  AERGKSDFEQAEKKVAELMAEGRNQVTEMVANAEKRAA-KIVEEAKEQASQEAARIAAQA 105

Query: 96  AANIEPESQETQQ 108
            A++E E    ++
Sbjct: 106 KADVEQEVNRARE 118


>gi|302688343|ref|XP_003033851.1| hypothetical protein SCHCODRAFT_233443 [Schizophyllum commune H4-8]
 gi|300107546|gb|EFI98948.1| hypothetical protein SCHCODRAFT_233443 [Schizophyllum commune H4-8]
          Length = 1773

 Score = 37.2 bits (84), Expect = 0.79,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 51/113 (45%), Gaps = 18/113 (15%)

Query: 22   GQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKK---AAEK-II 77
            G + P  PP   T  +   A   +  +KA +KA +   KAAE+  +A  K   A EK  +
Sbjct: 1592 GTSQPPDPPLADTSLDPADAKARKKEEKARQKAEKEVAKAAEKEGKARAKEEQAREKERV 1651

Query: 78   HKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQ 130
             ++K + KE+QE              QE ++    K  T Q +AE+    K+Q
Sbjct: 1652 RQEKARAKEDQE--------------QEKERAKREKELTKQREAEQKQLAKQQ 1690


>gi|319638947|ref|ZP_07993705.1| ATP synthase subunit B [Neisseria mucosa C102]
 gi|317399851|gb|EFV80514.1| ATP synthase subunit B [Neisseria mucosa C102]
          Length = 156

 Score = 37.2 bits (84), Expect = 0.80,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   +  E  A A K+AA KI+ + K++         V  
Sbjct: 47  AERGKSDFEQAEKKVAELMAEGRNQVTEMVANAEKRAA-KIVEEAKEQASHEAARIAVQA 105

Query: 96  AANIEPESQETQQ 108
            A++E E    ++
Sbjct: 106 KADVEQEVNRARE 118


>gi|261364183|ref|ZP_05977066.1| ATP synthase F0, B subunit [Neisseria mucosa ATCC 25996]
 gi|288567790|gb|EFC89350.1| ATP synthase F0, B subunit [Neisseria mucosa ATCC 25996]
          Length = 156

 Score = 37.2 bits (84), Expect = 0.82,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   + +E  A A K+AA+ +     ++ KE   V  V +
Sbjct: 47  AERGKSDFEQAEKKVAELLAEGRNQVSEMVANAEKRAAKIV-----EEAKEQASVEAVRI 101

Query: 96  AANIEPESQE 105
            A  + ++Q+
Sbjct: 102 TAQAKADAQQ 111


>gi|91777096|ref|YP_546852.1| F0F1 ATP synthase subunit B [Methylobacillus flagellatus KT]
 gi|123380256|sp|Q1GXM6|ATPF_METFK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|91711083|gb|ABE51011.1| ATP synthase F0, B subunit [Methylobacillus flagellatus KT]
          Length = 156

 Score = 37.2 bits (84), Expect = 0.82,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK  LD ATQ++AE   +A +KA    A+A K+A+E I+ + K   K   +      
Sbjct: 47  AERGKQELDMATQRSAEVVNDAKQKATSIIAQAEKRASE-IVEEAKANAKAEGDRIIAGA 105

Query: 96  AANIEPESQETQQ 108
            A I+ E    ++
Sbjct: 106 KAEIDQEVNRAKE 118


>gi|325685943|gb|EGD28006.1| translation initiation factor IF-2 [Lactobacillus delbrueckii
           subsp. lactis DSM 20072]
          Length = 825

 Score = 37.2 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 43/110 (39%), Gaps = 2/110 (1%)

Query: 44  DEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPES 103
           + +  K   K  E+A K AE AAEA K    KI+     + K+NQ  +E P A       
Sbjct: 104 EASESKPVVKKVESAEKPAETAAEAPKVRGPKILKPSPARLKQNQANSEKPAAKPSSSCR 163

Query: 104 QETQQQVINKTTTSQTDAEKTPNEK--RQGTTDGINNQSNATNDPSSKDK 151
             ++            +  +  + K  R+G     N    A +D S + K
Sbjct: 164 PSSRPSFTEAPMPENKEGRRRKSGKPGRKGQNSYANQGRGANSDRSQQRK 213


>gi|313124028|ref|YP_004034287.1| translation initiation factor if-2 [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|312280591|gb|ADQ61310.1| Translation initiation factor IF-2 [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
          Length = 825

 Score = 37.2 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 43/110 (39%), Gaps = 2/110 (1%)

Query: 44  DEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPES 103
           + +  K   K  E+A K AE AAEA K    KI+     + K+NQ  +E P A       
Sbjct: 104 EASESKPVVKKVESAEKPAETAAEAPKVRGPKILKPSPARLKQNQANSEKPAAKPSSSRR 163

Query: 104 QETQQQVINKTTTSQTDAEKTPNEK--RQGTTDGINNQSNATNDPSSKDK 151
             ++            +  +  + K  R+G     N    A +D S + K
Sbjct: 164 PSSRPSFTEAPMPENKEGRRRKSGKPGRKGQNSYANQGRGANSDRSQQRK 213


>gi|262174048|ref|ZP_06041724.1| minor tail protein [Vibrio mimicus MB-451]
 gi|261890228|gb|EEY36216.1| minor tail protein [Vibrio mimicus MB-451]
          Length = 783

 Score = 37.2 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 6/71 (8%)

Query: 46  ATQKAAEKAAEAAR-----KAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIE 100
           A ++A +KAAEAA+     +  E+AAE  KK AE+   +DK++ KE +   ++     +E
Sbjct: 386 AQKEAQDKAAEAAKEREKQRLEEEAAEKRKKDAEEKQREDKRQ-KEREAAKKLADQKALE 444

Query: 101 PESQETQQQVI 111
            E + T++ ++
Sbjct: 445 RERENTEEWLV 455


>gi|301111203|ref|XP_002904681.1| Crinkler (CRN) family protein [Phytophthora infestans T30-4]
 gi|262095998|gb|EEY54050.1| Crinkler (CRN) family protein [Phytophthora infestans T30-4]
          Length = 731

 Score = 37.2 bits (84), Expect = 0.84,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 51  AEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQV 110
           AE+  E  RK AE+  E  +K AE+   +D+K+ KE + + E      +  E++E  ++ 
Sbjct: 204 AEENRERDRKRAEENRERDRKRAEENRERDRKQAKEFRRLAE--ETRKLAEENRERDRKR 261

Query: 111 INKTTTSQTDAEKTPNEKRQ 130
             +T     +  K   EKR+
Sbjct: 262 AEETRKLAEEIRKLAEEKRE 281


>gi|239919161|gb|ACS34893.1| sialidase [Corynebacterium diphtheriae]
          Length = 731

 Score = 37.2 bits (84), Expect = 0.85,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 11/105 (10%)

Query: 43  LDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEV-NEVP----VAA 97
           +D+   +A EKAAEA  K A++AAE  +K  E++        KEN E+ N+V        
Sbjct: 516 IDKEIVEAQEKAAEAT-KEAQEAAEKVQKLTEEL----AAARKENDELKNQVKGFKEAVG 570

Query: 98  NIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNA 142
           ++  E+++   +V  K  T+ T+A++      +  +D +     A
Sbjct: 571 DLANEAEDLADKVF-KLETAVTEAKEKATVAEKAASDAVTQLQKA 614


>gi|15677768|ref|NP_274932.1| F0F1 ATP synthase subunit B [Neisseria meningitidis MC58]
 gi|121635594|ref|YP_975839.1| F0F1 ATP synthase subunit B [Neisseria meningitidis FAM18]
 gi|161869275|ref|YP_001598442.1| F0F1 ATP synthase subunit B [Neisseria meningitidis 053442]
 gi|218767491|ref|YP_002342003.1| F0F1 ATP synthase subunit B [Neisseria meningitidis Z2491]
 gi|254804247|ref|YP_003082468.1| ATP synthase B chain [Neisseria meningitidis alpha14]
 gi|304388490|ref|ZP_07370593.1| ATP synthase F0 sector subunit B [Neisseria meningitidis ATCC
           13091]
 gi|81832758|sp|Q7DD66|ATPF_NEIMB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694325|sp|A1KW15|ATPF_NEIMF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694330|sp|A9M119|ATPF_NEIM0 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694333|sp|A1IPX1|ATPF_NEIMA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|7227196|gb|AAF42267.1| ATP synthase F0, B subunit [Neisseria meningitidis MC58]
 gi|120867300|emb|CAM11071.1| ATP synthase B chain [Neisseria meningitidis FAM18]
 gi|121051499|emb|CAM07792.1| ATP synthase B chain [Neisseria meningitidis Z2491]
 gi|161594828|gb|ABX72488.1| ATP synthase B chain [Neisseria meningitidis 053442]
 gi|254667789|emb|CBA03746.1| ATP synthase B chain [Neisseria meningitidis alpha14]
 gi|254670871|emb|CBA07366.1| ATP synthase B chain [Neisseria meningitidis alpha153]
 gi|254672599|emb|CBA06305.1| ATP synthase B chain [Neisseria meningitidis alpha275]
 gi|261393268|emb|CAX50894.1| ATP synthase B chain [Neisseria meningitidis 8013]
 gi|304337487|gb|EFM03653.1| ATP synthase F0 sector subunit B [Neisseria meningitidis ATCC
           13091]
 gi|308390036|gb|ADO32356.1| ATP synthase B chain [Neisseria meningitidis alpha710]
 gi|316985560|gb|EFV64507.1| ATP synthase F0, B subunit [Neisseria meningitidis H44/76]
 gi|319409753|emb|CBY90059.1| ATP synthase B chain [Neisseria meningitidis WUE 2594]
 gi|325127452|gb|EGC50382.1| ATP synthase F0, B subunit [Neisseria meningitidis N1568]
 gi|325129476|gb|EGC52306.1| ATP synthase F0, B subunit [Neisseria meningitidis OX99.30304]
 gi|325131661|gb|EGC54367.1| ATP synthase F0, B subunit [Neisseria meningitidis M6190]
 gi|325133399|gb|EGC56063.1| ATP synthase F0, B subunit [Neisseria meningitidis M13399]
 gi|325135531|gb|EGC58149.1| ATP synthase F0, B subunit [Neisseria meningitidis M0579]
 gi|325137524|gb|EGC60107.1| ATP synthase F0, B subunit [Neisseria meningitidis ES14902]
 gi|325139591|gb|EGC62131.1| ATP synthase F0, B subunit [Neisseria meningitidis CU385]
 gi|325141532|gb|EGC64002.1| ATP synthase F0, B subunit [Neisseria meningitidis 961-5945]
 gi|325143649|gb|EGC65968.1| ATP synthase F0, B subunit [Neisseria meningitidis M01-240013]
 gi|325199029|gb|ADY94485.1| ATP synthase F0, B subunit [Neisseria meningitidis G2136]
 gi|325200989|gb|ADY96444.1| ATP synthase F0, B subunit [Neisseria meningitidis H44/76]
 gi|325201423|gb|ADY96877.1| ATP synthase F0, B subunit [Neisseria meningitidis M01-240149]
 gi|325204890|gb|ADZ00344.1| ATP synthase F0, B subunit [Neisseria meningitidis M01-240355]
 gi|325206845|gb|ADZ02298.1| ATP synthase F0, B subunit [Neisseria meningitidis M04-240196]
 gi|325207404|gb|ADZ02856.1| ATP synthase F0, B subunit [Neisseria meningitidis NZ-05/33]
          Length = 156

 Score = 37.2 bits (84), Expect = 0.86,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   + +E  A A K+AA KI+ + K++            
Sbjct: 47  AERGKSDFEQAEKKVAELLAEGRNQVSEMVANAEKRAA-KIVEEAKEQASSEAARIAAQA 105

Query: 96  AANIEPE 102
            A++E E
Sbjct: 106 KADVEQE 112


>gi|299751970|ref|XP_001830616.2| sex determining protein [Coprinopsis cinerea okayama7#130]
 gi|298409617|gb|EAU91247.2| sex determining protein [Coprinopsis cinerea okayama7#130]
          Length = 844

 Score = 37.2 bits (84), Expect = 0.87,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 55/125 (44%), Gaps = 5/125 (4%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AE    L++E  +K A+KA   A K+        K  + K      K         +   
Sbjct: 232 AEELGGLVEEQKEKRAQKAQALASKSGSSKTPTTKGGSSKTPTTTSKSGSSKTPTTKGGS 291

Query: 96  AANIEPESQETQQQVI----NKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
           +     +S  ++        +KTTT+++D+ KTP  K  G++  I  +S+++  P++K  
Sbjct: 292 SKTTTTKSGSSKTPTTKSGSSKTTTTKSDSSKTPTTK-SGSSKTITTKSDSSKTPTTKSG 350

Query: 152 IAENT 156
            ++ T
Sbjct: 351 SSKTT 355


>gi|7648481|dbj|BAA94842.1| glycogen debranching enzyme [Arthrobacter sp. Q36]
          Length = 823

 Score = 37.2 bits (84), Expect = 0.87,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 31/61 (50%)

Query: 24  ADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKK 83
           ADPVA P    +A+    + D     A E AAE A+ AAE  AE AK   E+   K  +K
Sbjct: 745 ADPVAEPADPPVADPADPVADPVADPAPEPAAEPAKSAAEPGAEPAKDPEEQPAEKPARK 804

Query: 84  P 84
           P
Sbjct: 805 P 805


>gi|193215226|ref|YP_001996425.1| phosphodiesterase [Chloroherpeton thalassium ATCC 35110]
 gi|193088703|gb|ACF13978.1| RNA binding metal dependent phosphohydrolase [Chloroherpeton
           thalassium ATCC 35110]
          Length = 524

 Score = 36.8 bits (83), Expect = 0.89,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 36  AERGKALL-DEATQKAAEKAAEAARKAAEQAAEAAKKAAEK 75
           AE  KA+L D   Q+A E+AAE  R   E+A + A K AEK
Sbjct: 156 AEEAKAMLMDNMIQQAKEEAAETIRAIHEEAEKTANKTAEK 196


>gi|257126828|ref|YP_003164942.1| hypothetical protein Lebu_2092 [Leptotrichia buccalis C-1013-b]
 gi|257050767|gb|ACV39951.1| protein of unknown function DUF552 [Leptotrichia buccalis C-1013-b]
          Length = 179

 Score = 36.8 bits (83), Expect = 0.89,   Method: Composition-based stats.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 91  NEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQ-GTTDGINNQSNATNDPSSK 149
           N+    A  E  SQ  Q +V +KTTT++ + EK P EK+  G+  G+  +  +T   SSK
Sbjct: 28  NDEKKEAATEQPSQNQQAKVQHKTTTNRVEQEKQPEEKKGIGSLFGVGKKEESTKMASSK 87


>gi|38344444|emb|CAE05650.2| OSJNBa0038O10.16 [Oryza sativa Japonica Group]
          Length = 1073

 Score = 36.8 bits (83), Expect = 0.90,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 56/120 (46%), Gaps = 6/120 (5%)

Query: 29  PPPPQTLAERGKALLDEATQKAAEKAAEAARKAAE---QAAEAAKKAAEKIIHKDKKKPK 85
           P  P   ++ G++  ++     A +     R+AA+   +A EAA++  +K I  + KK +
Sbjct: 390 PSRPSRHSKSGQSKAEDPATTEARRRESDRREAADRLREAEEAAQQLVDKAIRLEDKKNR 449

Query: 86  ENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATND 145
            +    ++ V    +     +Q+Q I      ++ +      ++ G    IN+++NA+N+
Sbjct: 450 MDNRKRKIIV---FQEAQDSSQRQRIKPLQIGESFSAGQEQSQQLGMNGEINSETNASNE 506


>gi|297198363|ref|ZP_06915760.1| secreted protein [Streptomyces sviceus ATCC 29083]
 gi|197714420|gb|EDY58454.1| secreted protein [Streptomyces sviceus ATCC 29083]
          Length = 183

 Score = 36.8 bits (83), Expect = 0.92,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 33  QTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNE 92
           Q LA  G  +LD A      +AA AAR+A E+  E A+    + +     +P + + V+E
Sbjct: 55  QELATSG--VLDPAASIVLYEAAHAARQAEEEQREVAESELSQALRAVFAEPAQVEAVHE 112

Query: 93  VPVAANIEPESQETQQQV 110
           VP   +   E  E  ++V
Sbjct: 113 VPGGESAAHELTEAVRRV 130


>gi|325142631|gb|EGC65022.1| DNA polymerase III, subunits gamma and tau [Neisseria meningitidis
           961-5945]
          Length = 709

 Score = 36.8 bits (83), Expect = 0.93,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 48/107 (44%), Gaps = 7/107 (6%)

Query: 43  LDEATQKAAEKAAEAA----RKAAEQAAEAAKKAAEKIIHKDKK--KPKENQEVNEVPVA 96
           L   + + AEK A A     R  AE A  + + A+   +  + K  +P  NQE N+VP  
Sbjct: 377 LQSPSVQTAEKEAAAKKPQPRPEAETAQTSVQTASAAAMPSESKTAEPVSNQENNDVPPW 436

Query: 97  ANIEPESQETQQQVINKTTTSQTDAE-KTPNEKRQGTTDGINNQSNA 142
            +   E+Q           + QT +E +TP E +       +N++NA
Sbjct: 437 EDAPDEAQTAAGTAQTSAKSIQTASEAETPPENQVSKNKAADNETNA 483


>gi|195431308|ref|XP_002063688.1| GK15778 [Drosophila willistoni]
 gi|194159773|gb|EDW74674.1| GK15778 [Drosophila willistoni]
          Length = 2284

 Score = 36.8 bits (83), Expect = 0.95,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           A +   +L E+TQ+  E+  +       +  E   +  EK +   + +P + +E ++V  
Sbjct: 153 ANKNVEILSESTQERDEQTEQGELNKLPEVEEQLNQ--EKQMDSQEVEPSQAEEQDKVEQ 210

Query: 96  AANIEPESQETQQQVINKTTTSQTDAEKTPNE 127
           A    PE Q+TQ +      TS+ + E TP +
Sbjct: 211 AEKQAPEEQDTQAEEEEPHQTSKINDEITPTK 242


>gi|313229402|emb|CBY23989.1| unnamed protein product [Oikopleura dioica]
          Length = 416

 Score = 36.8 bits (83), Expect = 1.00,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 10/119 (8%)

Query: 42  LLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEP 101
           + +EA + A +KAAE       +  E A+K AEK   +++K     +  NE      +E 
Sbjct: 150 MFEEANRDAIKKAAEEEELLKMKEREEAEKLAEKAKQEEQKSAAVQETRNE-----EVEQ 204

Query: 102 ESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK--IAENTKE 158
           E +  Q Q +    ++  +  + P+  +   T+G++   +     SSK +  I+E+TKE
Sbjct: 205 EREIVQSQSVPSEVSNVQNGNELPDSVK---TNGMSQSEDLNQSISSKHESSISESTKE 260


>gi|261379449|ref|ZP_05984022.1| ATP synthase F0, B subunit [Neisseria subflava NJ9703]
 gi|261400616|ref|ZP_05986741.1| ATP synthase F0, B subunit [Neisseria lactamica ATCC 23970]
 gi|269209702|gb|EEZ76157.1| ATP synthase F0, B subunit [Neisseria lactamica ATCC 23970]
 gi|284797903|gb|EFC53250.1| ATP synthase F0, B subunit [Neisseria subflava NJ9703]
          Length = 156

 Score = 36.8 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   +  E  A A K+AA KI+ + K++            
Sbjct: 47  AERGKSDFEQAEKKVAELMAEGRNQVTEMVANAEKRAA-KIVEEAKEQASHEAARIAAQA 105

Query: 96  AANIEPESQETQQ 108
            A++E E    ++
Sbjct: 106 KADVEQEVNRARE 118


>gi|156550675|ref|XP_001605377.1| PREDICTED: similar to DCAPL3 [Nasonia vitripennis]
          Length = 2978

 Score = 36.8 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 3/110 (2%)

Query: 43   LDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
            L +A+ ++A   AEA+R   E+    A    E    KD  K K N+  NEV +   I   
Sbjct: 916  LVDASSESAVAMAEASRGIEEKRETRASDEPESTAKKDASKVKNNESNNEVDLEDVIIHA 975

Query: 103  SQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKI 152
             QE     IN  T ++T  +   +E  +    G    S    D ++++KI
Sbjct: 976  VQEPD---INNDTITKTTNDDRNDENNEEKISGEIPPSGGAPDANNENKI 1022


>gi|109898309|ref|YP_661564.1| putative solute/DNA competence effector [Pseudoalteromonas
           atlantica T6c]
 gi|123171279|sp|Q15UC8|PROQ_PSEA6 RecName: Full=Protein proQ homolog
 gi|109700590|gb|ABG40510.1| ProQ activator of osmoprotectant transporter ProP
           [Pseudoalteromonas atlantica T6c]
          Length = 216

 Score = 36.8 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 46/113 (40%), Gaps = 6/113 (5%)

Query: 28  APPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKA-AEKIIHKDKKKPKE 86
           A P  +  A+  +A L+E+  K AEK     RKA   A   AKK+   K +   K  PK 
Sbjct: 88  AAPIEKEHADHAQAQLEESKAKVAEK-----RKAQNAAKPGAKKSYKSKTVPAFKSSPKG 142

Query: 87  NQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQ 139
             + N  P A    PE    +Q V   + T +      P      + DG+  Q
Sbjct: 143 TNQDNVKPKAKLPPPEKLSAEQLVAGTSVTVKIGKSPMPATITDVSKDGVQVQ 195


>gi|195120025|ref|XP_002004529.1| GI19984 [Drosophila mojavensis]
 gi|193909597|gb|EDW08464.1| GI19984 [Drosophila mojavensis]
          Length = 1445

 Score = 36.8 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 44/88 (50%), Gaps = 1/88 (1%)

Query: 40   KALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNE-VPVAAN 98
            + L  + T++  E+A   A K  E+  E  K  A  +  +++    E+Q  +E V VA+ 
Sbjct: 1096 RNLRRDKTKQQLERAIARASKTPEKEPEPEKVVAPIMDEENEYVDVESQGEDEIVEVASP 1155

Query: 99   IEPESQETQQQVINKTTTSQTDAEKTPN 126
            ++ +S    + +++  TT+  DA +  N
Sbjct: 1156 VQSQSHNESEVIVDSPTTASPDASRAVN 1183


>gi|116310965|emb|CAH67901.1| OSIGBa0115K01-H0319F09.7 [Oryza sativa Indica Group]
          Length = 911

 Score = 36.8 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 61/122 (50%), Gaps = 10/122 (8%)

Query: 29  PPPPQTLAERGKALLDEATQKAAEKAAEAARKAAE---QAAEAAKKAAEKIIH-KDKKKP 84
           P  P   ++ G++  ++     A +     R+AA+   +A EAA++  +K I  +DKK  
Sbjct: 390 PSRPSRHSKSGQSKAEDPATTEARRRESDRREAADRLREAEEAAQQLVDKAIRLEDKKNR 449

Query: 85  KENQEVNEVPVAANIEPESQET-QQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNAT 143
            +N++   +     +  E+Q++ Q+Q I      ++ +      ++ G    IN+++NA+
Sbjct: 450 MDNRKRKMI-----VFQEAQDSSQRQRIKPLQIGESFSAGQEQSQQLGMNGEINSETNAS 504

Query: 144 ND 145
           N+
Sbjct: 505 NE 506


>gi|68075315|ref|XP_679575.1| hypothetical protein [Plasmodium berghei strain ANKA]
 gi|56500352|emb|CAH98063.1| conserved hypothetical protein [Plasmodium berghei]
          Length = 744

 Score = 36.8 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 7/62 (11%)

Query: 99  IEPESQETQQQ-VINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTK 157
           ++ ES+E +    INK T+SQ+   ++ +E          +Q++   D S++D+I ENTK
Sbjct: 418 VDDESEEDEHSDSINKKTSSQSYTSESLDELEN------EDQTSENGDSSNEDRINENTK 471

Query: 158 ED 159
           ++
Sbjct: 472 KN 473


>gi|224008739|ref|XP_002293328.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220970728|gb|EED89064.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 1204

 Score = 36.8 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 44  DEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIE--- 100
           D    ++ EK+ E   + A + +++     + +++ ++     + E  E PV ANIE   
Sbjct: 561 DITLHESVEKSGEVEPQVASEDSDSLSTDVDIVVNTNQIDDASSTEDEEKPVTANIEREQ 620

Query: 101 PESQETQQQVINKTTTSQTDAEKTPN 126
           PES +    V    +TSQ DA +T N
Sbjct: 621 PESPDVVDAVQRSDSTSQDDASETTN 646


>gi|195027153|ref|XP_001986448.1| GH20524 [Drosophila grimshawi]
 gi|193902448|gb|EDW01315.1| GH20524 [Drosophila grimshawi]
          Length = 546

 Score = 36.4 bits (82), Expect = 1.2,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 58/115 (50%), Gaps = 13/115 (11%)

Query: 10  LLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAA-EA 68
           L + LST++ +  +    AP  P++LAE  K+L ++ TQ+  E   E  R+  E    E 
Sbjct: 292 LATNLSTSLRAHQEQCHSAPTGPKSLAEVEKSLFNKETQQLME--IEKLRQKLEDTEREM 349

Query: 69  AKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEK 123
           AK  AE  ++ D+ + K+N + NE     N+E        Q I+   T++ D E+
Sbjct: 350 AKLIAE--MNTDQCEAKQNDD-NEKSNLTNVE-------NQNISNGQTARNDQEQ 394


>gi|302542128|ref|ZP_07294470.1| conserved hypothetical protein [Streptomyces hygroscopicus ATCC
           53653]
 gi|302459746|gb|EFL22839.1| conserved hypothetical protein [Streptomyces himastatinicus ATCC
           53653]
          Length = 480

 Score = 36.4 bits (82), Expect = 1.2,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 61/159 (38%), Gaps = 20/159 (12%)

Query: 1   MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARK 60
           MK  +Y  ++   ++    +  +A    P P       G   LD+A QK A    +AA  
Sbjct: 76  MKLAEYAAVVGDQMAAAGQALREAQKAIPKPVDAAEAHGDPDLDDALQKDATTNKQAAIH 135

Query: 61  AAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD 120
             E+     + A ++I      K +E      +P+   I             +T  SQ  
Sbjct: 136 QLERVTSYYRFANDEI------KAREEPRFKPLPIDDRI-------------RTQASQAY 176

Query: 121 AEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159
              +P  +   TT     Q++ ++ P  + ++A+ T +D
Sbjct: 177 GS-SPGAEAYATTSNTRTQADGSSAPEPRTRVAQETGQD 214


>gi|331232615|ref|XP_003328969.1| DNA mismatch repair protein mutS [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309307959|gb|EFP84550.1| DNA mismatch repair protein mutS [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 1189

 Score = 36.4 bits (82), Expect = 1.2,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 54/125 (43%), Gaps = 12/125 (9%)

Query: 41  ALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIE 100
           A   E  QK  +    AA   +++  +  +KAA     K K +PK+ +  N+     N  
Sbjct: 116 ASTSEDLQKVTKNQQTAANNQSKEETKNQQKAANNQPKKTKNQPKKTE--NQPKKTENQP 173

Query: 101 PESQETQQQVI----NKTTTSQTDAEKTPNE--KRQGTTDGINNQSNATNDP----SSKD 150
            E  + QQ+ +     + T +Q +A K   E  K Q   +  N Q+ A N P     ++ 
Sbjct: 174 KEETKNQQKAVKNQSKEATKNQQEATKNQQEAAKNQLKEETKNQQNAAKNQPKMATKNQQ 233

Query: 151 KIAEN 155
           K AEN
Sbjct: 234 KAAEN 238


>gi|310819162|ref|YP_003951520.1| hypothetical protein STAUR_1889 [Stigmatella aurantiaca DW4/3-1]
 gi|309392234|gb|ADO69693.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 274

 Score = 36.4 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 9/64 (14%)

Query: 20  SCGQADPVAPPPPQTLAERGKALLD---------EATQKAAEKAAEAARKAAEQAAEAAK 70
           S G+ DP+      +  ER + L+D         +A +K  +  A+AARK AE   EAA+
Sbjct: 90  SSGETDPLLVKRAHSAVERLRLLIDKEEQQQVAVDAERKRLQDEADAARKQAEAEQEAAR 149

Query: 71  KAAE 74
           +A E
Sbjct: 150 RAEE 153


>gi|115375341|ref|ZP_01462604.1| tetratricopeptide repeat domain protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|115367625|gb|EAU66597.1| tetratricopeptide repeat domain protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 284

 Score = 36.4 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 9/64 (14%)

Query: 20  SCGQADPVAPPPPQTLAERGKALLD---------EATQKAAEKAAEAARKAAEQAAEAAK 70
           S G+ DP+      +  ER + L+D         +A +K  +  A+AARK AE   EAA+
Sbjct: 100 SSGETDPLLVKRAHSAVERLRLLIDKEEQQQVAVDAERKRLQDEADAARKQAEAEQEAAR 159

Query: 71  KAAE 74
           +A E
Sbjct: 160 RAEE 163


>gi|268638121|ref|XP_002649177.1| type A von Willebrand factor  domain-containing protein
            [Dictyostelium discoideum AX4]
 gi|223635327|sp|Q869L3|MDN1_DICDI RecName: Full=Midasin; AltName: Full=MIDAS-containing protein
 gi|256013014|gb|EEU04125.1| type A von Willebrand factor  domain-containing protein
            [Dictyostelium discoideum AX4]
          Length = 5900

 Score = 36.4 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 100  EPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATN-DPSSKDKIAENTKE 158
            EPE ++ ++   + TT  Q D     +E+  G  D   ++SN +N D   KD+  ++  +
Sbjct: 5276 EPEKEQPEEDQTSLTTNEQQDETPKDSEQPLGVKDKTGSKSNVSNTDEEMKDESNQDNAD 5335

Query: 159  D 159
            D
Sbjct: 5336 D 5336


>gi|118382850|ref|XP_001024581.1| Kinesin motor domain containing protein [Tetrahymena thermophila]
 gi|89306348|gb|EAS04336.1| Kinesin motor domain containing protein [Tetrahymena thermophila
            SB210]
          Length = 5542

 Score = 36.4 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 56/114 (49%), Gaps = 18/114 (15%)

Query: 63   EQAAEAAKKAAEKIIHKDKKKPKENQE----------VNEVPVAANIEPESQE-----TQ 107
            E+ ++   K  ++ ++KD++   E  +            E  +++N E E+Q+      +
Sbjct: 2110 EEESKTQTKEDKQNVNKDQESETEQDQNGDLIGSQILCQEDNLSSNREQENQDKQEQSEE 2169

Query: 108  QQVINKTTTSQTDAEKTPNEKRQG--TTDGINNQSNATNDPSSKDKIAENTKED 159
            +Q  NK+  + T+ ++   +  QG  + DG N++SN+ ND  S DK  +   +D
Sbjct: 2170 EQSENKSQNADTEKDEENQDNGQGDNSEDGSNDESNSANDQQS-DKKEQKLDQD 2222


>gi|255067778|ref|ZP_05319633.1| ATP synthase F0, B subunit [Neisseria sicca ATCC 29256]
 gi|255047989|gb|EET43453.1| ATP synthase F0, B subunit [Neisseria sicca ATCC 29256]
          Length = 156

 Score = 36.4 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   + +E  A A K+AA+ +     ++ KE   V  V +
Sbjct: 47  AERGKSDFEQAEKKVAELLAEGRNQVSEMVANAEKRAAKIV-----EEAKEQATVEAVRI 101

Query: 96  AANIEPESQE 105
            A  + ++Q+
Sbjct: 102 TAQAKADAQQ 111


>gi|170034569|ref|XP_001845146.1| chromodomain helicase DNA binding protein [Culex quinquefasciatus]
 gi|167875927|gb|EDS39310.1| chromodomain helicase DNA binding protein [Culex quinquefasciatus]
          Length = 5423

 Score = 36.4 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 45   EATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPES- 103
            ++   AAEK+AE+A K      +    + E +  KD+ K  + +EV E P   +   E  
Sbjct: 3665 DSEDDAAEKSAESAEKPEAMEVDEKVPSEENVEKKDEAK-SDAEEVKEKPTEKDSSSEET 3723

Query: 104  -QETQQQVINKTTTSQTDAEK-TPNEKRQ 130
              ET  +V  K     TD E+ +P++K +
Sbjct: 3724 PMETTAEVAEKPAEKSTDTEEGSPSKKSE 3752


>gi|296269103|ref|YP_003651735.1| RNA binding metal dependent phosphohydrolase [Thermobispora
          bispora DSM 43833]
 gi|296091890|gb|ADG87842.1| RNA binding metal dependent phosphohydrolase [Thermobispora
          bispora DSM 43833]
          Length = 537

 Score = 36.4 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 27 VAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKA 72
          + PPP   + ER +A ++E  ++A  +AAE   KA   A E  KK+
Sbjct: 31 ITPPPRSQVMERVRAEINEELERARREAAEIRSKAERDAGEILKKS 76


>gi|261334940|emb|CBH17934.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 777

 Score = 36.4 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 62/134 (46%), Gaps = 25/134 (18%)

Query: 50  AAEKAAEAARKAAEQAAEAAKKA-AEKIIHK---DKKKPKENQEVNEVPVAANIEPESQE 105
            A K AE     ++Q +E AK+A AE+I  +   + +KP + ++ NE    A  +P++ +
Sbjct: 591 GAAKEAETEEIGSKQISETAKEADAEEIDSEWTSEARKPSDTEDANEKTSEAAKDPDNDD 650

Query: 106 TQQQVINK---------TTTSQT------DAEKTPNE------KRQGTTDGINNQSNATN 144
           T+ +  ++         T + QT      DAE+  ++      KR GT       S A  
Sbjct: 651 TESKQTSEAAKDPDTEDTESKQTSEAAKVDAEEIGSDQASEAMKRSGTEGASERTSEAAK 710

Query: 145 DPSSKDKIAENTKE 158
           DP + D  ++ T E
Sbjct: 711 DPDNDDTESKQTSE 724


>gi|17561158|ref|NP_507932.1| hypothetical protein F48F5.1 [Caenorhabditis elegans]
          Length = 1291

 Score = 36.4 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 21/114 (18%)

Query: 40  KALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANI 99
           + ++DE  Q+  EK    A+  A+Q    A+K AEK      KK ++NQ+  E  + A+ 
Sbjct: 831 RKVVDEQNQR--EKDELQAKLRADQEKSEARKIAEK------KKDEQNQKEKEAKLRADQ 882

Query: 100 EPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIA 153
           E              + ++  AEK  +E+ Q   D +  +  A  + S   KIA
Sbjct: 883 E-------------KSEARKVAEKKKDEQNQKEKDKLQAKLRADQEKSEARKIA 923


>gi|238059176|ref|ZP_04603885.1| hypothetical protein MCAG_00142 [Micromonospora sp. ATCC 39149]
 gi|237880987|gb|EEP69815.1| hypothetical protein MCAG_00142 [Micromonospora sp. ATCC 39149]
          Length = 210

 Score = 36.4 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 18  MASCGQADPVAPPPPQTLA--------ERGKALLDEATQKAAEKAAEAARKAAEQAAEAA 69
           M   G    VAP  P  +         E     +DEAT++ AE  AEA R+A E  AEA 
Sbjct: 69  MLRHGALPSVAPQGPDPMVIELAVRAQEEANRTIDEATEEGAEIIAEARRQAEEIVAEAF 128

Query: 70  KKAA 73
           ++A 
Sbjct: 129 RRAG 132


>gi|325136513|gb|EGC59117.1| DNA polymerase III, subunits gamma and tau [Neisseria meningitidis
           M0579]
          Length = 738

 Score = 36.4 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 45/113 (39%), Gaps = 10/113 (8%)

Query: 31  PPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEV 90
           P    AE+  A      +  AE A    + A+  A  +  K AE         P  NQE 
Sbjct: 409 PSAQTAEKETAAKKPQPRPEAETAQTPVQTASAAAMPSESKTAE---------PVSNQEN 459

Query: 91  NEVPVAANIEPESQETQQQVINKTTTSQTDAE-KTPNEKRQGTTDGINNQSNA 142
           N+VP   +   E+Q           + QT +E +TP E +       +N++NA
Sbjct: 460 NDVPPWEDAPDEAQTAAGTAQTSAKSIQTASEAETPPENQVSKNKAADNETNA 512


>gi|198419720|ref|XP_002129146.1| PREDICTED: similar to CTCL tumor antigen L14-2 isoform 1 [Ciona
           intestinalis]
          Length = 870

 Score = 36.4 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 34/62 (54%)

Query: 98  NIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTK 157
           N++P+   T+ + +N+T   ++DAE+  NE+    T  IN+  N + + S  +  +   K
Sbjct: 37  NMKPDIDPTESENLNETEILESDAEQISNEEETDATSSINDDPNVSTNNSDVEHQSNKVK 96

Query: 158 ED 159
           ED
Sbjct: 97  ED 98


>gi|198419722|ref|XP_002129170.1| PREDICTED: similar to CTCL tumor antigen L14-2 isoform 2 [Ciona
           intestinalis]
          Length = 858

 Score = 36.4 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 34/62 (54%)

Query: 98  NIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTK 157
           N++P+   T+ + +N+T   ++DAE+  NE+    T  IN+  N + + S  +  +   K
Sbjct: 37  NMKPDIDPTESENLNETEILESDAEQISNEEETDATSSINDDPNVSTNNSDVEHQSNKVK 96

Query: 158 ED 159
           ED
Sbjct: 97  ED 98


>gi|261334942|emb|CBH17936.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 987

 Score = 36.0 bits (81), Expect = 1.5,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 62/134 (46%), Gaps = 25/134 (18%)

Query: 50  AAEKAAEAARKAAEQAAEAAKKA-AEKIIHK---DKKKPKENQEVNEVPVAANIEPESQE 105
            A K AE     ++Q +E AK+A AE+I  +   + +KP + ++ NE    A  +P++ +
Sbjct: 735 GAAKEAETEEIGSKQISETAKEADAEEIDSEWTSEARKPSDTEDANEKTSEAAKDPDNDD 794

Query: 106 TQQQVINK---------TTTSQT------DAEKTPNE------KRQGTTDGINNQSNATN 144
           T+ +  ++         T + QT      DAE+  ++      KR GT       S A  
Sbjct: 795 TESKQTSEAAKDPDTEDTESKQTSEAAKVDAEEIGSDQASEAMKRSGTEGASERTSEAAK 854

Query: 145 DPSSKDKIAENTKE 158
           DP + D  ++ T E
Sbjct: 855 DPDNDDTESKQTSE 868



 Score = 36.0 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 58/125 (46%), Gaps = 14/125 (11%)

Query: 45  EATQKAAEKAAEAARKAAEQAAEAAKK-----AAEKIIHKDKKKPKENQEVNEVPVAANI 99
           E+ Q +     +A    ++QA+EA K+     A+E+     K    ++ E  +   AA  
Sbjct: 813 ESKQTSEAAKVDAEEIGSDQASEAMKRSGTEGASERTSEAAKDPDNDDTESKQTSEAAK- 871

Query: 100 EPESQETQQQVINKTTTSQTDAEKTPNE------KRQGTTDGINNQSNATNDPSSKDKIA 153
           +P++++T+ +    +  ++ DAE+  ++      KR GT       S A  DP + D  +
Sbjct: 872 DPDTEDTESK--QTSEAAKVDAEEIGSDQASEAMKRSGTEGASERTSEAAKDPDNDDTES 929

Query: 154 ENTKE 158
           + T E
Sbjct: 930 KQTSE 934


>gi|307637937|gb|ADN80387.1| NADH-ubiquinone oxidoreductase chain G [Helicobacter pylori 908]
 gi|325996541|gb|ADZ51946.1| NADH-ubiquinone oxidoreductase chain G [Helicobacter pylori 2018]
 gi|325998130|gb|ADZ50338.1| NADH-ubiquinone oxidoreductase chain G [Helicobacter pylori 2017]
          Length = 853

 Score = 36.0 bits (81), Expect = 1.5,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 11/91 (12%)

Query: 33  QTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKK-KPKENQEVN 91
           ++L +  ++++DEA  KA E   E  +KA EQA +       K  +K++   PKEN+E N
Sbjct: 442 KSLEDSKQSIVDEAALKALE---EERKKALEQAEQGCSIGENKEENKEEAVAPKENKEEN 498

Query: 92  EVPVAANIEPESQETQQQVINKTTTSQTDAE 122
           +   A    P+  +T+    NKT   +   E
Sbjct: 499 KTEAAT---PKENQTE----NKTEVKEEKIE 522


>gi|328875967|gb|EGG24331.1| hypothetical protein DFA_06481 [Dictyostelium fasciculatum]
          Length = 1597

 Score = 36.0 bits (81), Expect = 1.6,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 42/97 (43%)

Query: 63   EQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAE 122
            E+   AAK    +  + + KK  ++        A  +  ++QE    + N  T +   A+
Sbjct: 1057 ERVTNAAKSIQGQFSNSNAKKELDSLFDQAEETAKELAQDTQEAANDLSNVATNTLEQAK 1116

Query: 123  KTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159
            +  NE  Q T +  N+ SN T++   + K   N  +D
Sbjct: 1117 EITNEIVQDTQEAANDLSNVTSNTFEQAKETVNNAKD 1153


>gi|300521554|gb|ADK25988.1| chaperone DnaK [Candidatus Nitrososphaera gargensis]
          Length = 623

 Score = 36.0 bits (81), Expect = 1.7,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 9/95 (9%)

Query: 41  ALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVP------ 94
           A  D ATQK A+    A  K ++   E  K+ +E+    DKKK +E +  NE        
Sbjct: 465 AAKDIATQKEAKITITANNKLSKDEIEKLKRESEQFAEADKKKKEEAEVRNEADNLIYAA 524

Query: 95  ---VAANIEPESQETQQQVINKTTTSQTDAEKTPN 126
              V  +++ + +  Q + +NK +    DA  + N
Sbjct: 525 DKLVKQDLKDKVRPDQAERVNKLSQELRDAISSNN 559


>gi|255326227|ref|ZP_05367313.1| cell division protein FtsW [Rothia mucilaginosa ATCC 25296]
 gi|255296681|gb|EET76012.1| cell division protein FtsW [Rothia mucilaginosa ATCC 25296]
          Length = 726

 Score = 36.0 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 4/96 (4%)

Query: 62  AEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDA 121
           A Q AEA K+ A +     K  P++       P  A  +P + + Q +V  K+T S   A
Sbjct: 546 ASQKAEAQKQKASQKPAPKKPAPQKPAPKKVAPQKAPAQPRTGQ-QVRVAQKSTASTRAA 604

Query: 122 EKTPNEKRQG---TTDGINNQSNATNDPSSKDKIAE 154
           +  P + R     T      Q  A   P+++ ++ +
Sbjct: 605 QGKPAQTRTAQPRTAQQPAAQKPAAQKPATQKRVQQ 640


>gi|123383842|ref|XP_001298881.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121879582|gb|EAX85951.1| hypothetical protein TVAG_161980 [Trichomonas vaginalis G3]
          Length = 671

 Score = 35.6 bits (80), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 100 EPESQETQQQVINK-TTTSQTDAEKTPNEKR-QGTTDGINNQSNATNDPSSKDKIAENTK 157
           +P  Q TQ Q  N+ T  +  +AEK  N++  Q T+  I N S   ++   KDK  +NT 
Sbjct: 157 KPTQQNTQNQPTNEGTKNTSQNAEKIQNDQNNQNTSGNIQNPSQNISENKDKDKTTQNTS 216

Query: 158 E 158
           E
Sbjct: 217 E 217


>gi|118487390|gb|ABK95523.1| unknown [Populus trichocarpa]
          Length = 517

 Score = 35.6 bits (80), Expect = 2.0,   Method: Composition-based stats.
 Identities = 43/154 (27%), Positives = 71/154 (46%), Gaps = 29/154 (18%)

Query: 18  MASCGQADPVAPPPPQ--TLAERGKALLDEATQ-------------KAAEKAAEAA--RK 60
           +A+C   +PVA       ++ ++GKA+    T+             K  E  AE A  + 
Sbjct: 133 VATCKTDEPVAETAVDKVSVEDKGKAVDKPVTEISEDEEKSKESEGKTDEPVAETAVDKV 192

Query: 61  AAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAAN-IEPESQETQ--QQVINKTTTS 117
           + E   +A  K   +I  KD++K KE++   + PVA N IE ES E +     +N+ T S
Sbjct: 193 SVEDKGKAVDKPVTEI-SKDEEKSKESEGKTDEPVAENAIEKESSEDKGINSAVNEATES 251

Query: 118 QTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
           + D EK   ++         ++ NA  D  ++DK
Sbjct: 252 KVDNEKPAEDE--------TDKENAGGDAENQDK 277


>gi|123392542|ref|XP_001300259.1| trichohyalin [Trichomonas vaginalis G3]
 gi|121881269|gb|EAX87329.1| trichohyalin, putative [Trichomonas vaginalis G3]
          Length = 518

 Score = 35.6 bits (80), Expect = 2.0,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 4   LKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAE 63
           +KYQ I+ S L T       AD        +  +  K L +EA +K  E+ AEA RK  E
Sbjct: 144 IKYQDIIRSDLFTMSLEELTADRT------SYDDEKKRLAEEAERKRKEQEAEAERKRIE 197

Query: 64  QAAEAAKKAAEK 75
           Q AEA +K  E+
Sbjct: 198 QEAEAERKRIEQ 209


>gi|194892587|ref|XP_001977691.1| GG18103 [Drosophila erecta]
 gi|190649340|gb|EDV46618.1| GG18103 [Drosophila erecta]
          Length = 864

 Score = 35.6 bits (80), Expect = 2.2,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 28/60 (46%)

Query: 44  DEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPES 103
           D+  Q      A+  R + +Q  E A+ + E    +DK    E +E N+ P +   EPES
Sbjct: 503 DDFMQDIKRLRAQINRNSDKQRKERAQGSKEATAEEDKDSEPEPKEENQEPGSTETEPES 562


>gi|158296578|ref|XP_316961.4| AGAP008482-PA [Anopheles gambiae str. PEST]
 gi|157014777|gb|EAA12280.5| AGAP008482-PA [Anopheles gambiae str. PEST]
          Length = 4793

 Score = 35.6 bits (80), Expect = 2.2,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 15   STTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEA-ARKAAEQAAEA-AKKA 72
            S  + +  + +  A P P+ + E  K ++ EA +K+AE   E  A K AEQ AE   +K 
Sbjct: 3660 SDVVPAVNEQEKPAEPEPEQVKEAVKEVVAEAAEKSAESTDEKPAEKPAEQPAEKPVEKP 3719

Query: 73   AEKIIHKDKKKPKENQEVNEVPVAANIE 100
             EK +    +     + V++V V A+ +
Sbjct: 3720 VEKAVEATAEVVAVEKPVDDVVVVASTD 3747


>gi|308233576|ref|ZP_07664313.1| transcription termination factor Rho [Atopobium vaginae DSM 15829]
 gi|328943971|ref|ZP_08241436.1| transcription termination factor Rho [Atopobium vaginae DSM 15829]
 gi|327491940|gb|EGF23714.1| transcription termination factor Rho [Atopobium vaginae DSM 15829]
          Length = 720

 Score = 35.6 bits (80), Expect = 2.2,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 53/118 (44%), Gaps = 20/118 (16%)

Query: 50  AAEKAAEAARKAAEQAAEA------------------AKKAAEKIIHKDKKKPKENQEVN 91
           A +KA EAA  A +Q+ E+                  + +A   + H+  +KP+  Q   
Sbjct: 80  ARQKAIEAALLAQQQSIESHDIMLKAQEVPSSVDLNISNQANVVVSHEKLQKPEMPQSQK 139

Query: 92  EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSK 149
              VA++I P+ ++TQ+Q  N++ T +         + + TT  I N+S    +  +K
Sbjct: 140 LHRVASDIVPKKEQTQEQ--NQSQTPEVAQHSAVYHEVRATTSQIENESEHQTNSEAK 195


>gi|260822607|ref|XP_002606693.1| hypothetical protein BRAFLDRAFT_72540 [Branchiostoma floridae]
 gi|229292037|gb|EEN62703.1| hypothetical protein BRAFLDRAFT_72540 [Branchiostoma floridae]
          Length = 1050

 Score = 35.6 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query: 59  RKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQ 118
           RK  E+ AEA +K  EK   + +K+ +E  ++           E +E Q+Q ++   +S 
Sbjct: 357 RKKEERQAEAKRKLEEK---EARKRKREEGKLQAQKKKRRENGEEKENQRQPVDDPGSSS 413

Query: 119 TDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAEN 155
               KT N  R G   G +  +NA N+   + ++  N
Sbjct: 414 ----KTVNNNRGGYNVG-DKTNNAFNNEEGQFRMNNN 445


>gi|322813756|gb|EFZ23455.1| trans-sialidase, putative [Trypanosoma cruzi]
          Length = 392

 Score = 35.6 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 56/134 (41%), Gaps = 17/134 (12%)

Query: 25  DPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKP 84
           DPV   PP T+A    A    +    A ++AE + +  +      + A +   +KD K  
Sbjct: 190 DPVPAAPPSTVAGGSSA----SEPAIAAQSAENSHQEDKAQLSEVETAQQSTSNKDYKSM 245

Query: 85  KENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEK--TPNEKRQGTTDGINNQSNA 142
           + + EV           ++QE Q +V+ +    +  AE   T   + +G TDG +  S +
Sbjct: 246 QRDSEV-----------QTQEPQSEVLTEVADVEGSAESYGTQQPEEEGGTDGRSGGSTS 294

Query: 143 TNDPSSKDKIAENT 156
           +   SS    A  T
Sbjct: 295 SVAASSDMDTATET 308


>gi|283458400|ref|YP_003363024.1| long-chain acyl-CoA synthetase [Rothia mucilaginosa DY-18]
 gi|283134439|dbj|BAI65204.1| long-chain acyl-CoA synthetase [Rothia mucilaginosa DY-18]
          Length = 720

 Score = 35.6 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 51/104 (49%), Gaps = 1/104 (0%)

Query: 41  ALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIE 100
           A L E   + +EK AE   +AAE+  E A   AE++    ++  ++ +E+ E       +
Sbjct: 616 ARLQEYAAEQSEKFAELREQAAERLHEYADHQAERLAELREQAAEKFEELREQTAEMMQK 675

Query: 101 PESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATN 144
           P+ +E ++    + +++   AEK P +  + T    N Q + ++
Sbjct: 676 PQEEEAEEVKKAEKSSANAPAEK-PAQTEKKTVAEQNPQKSDSD 718


>gi|291407507|ref|XP_002720065.1| PREDICTED: melanoma antigen family D, 2 [Oryctolagus cuniculus]
          Length = 610

 Score = 35.6 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 59/146 (40%), Gaps = 9/146 (6%)

Query: 9   ILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAE--KAAEAARKAAEQAA 66
           ++ +LL+ T        P A   P+ ++E  K        KA E  KA EA   AA Q +
Sbjct: 26  MMQTLLTVTQNLEVSDTPKASKAPK-VSEVVKVSKAPGGSKATEVSKAPEAQEAAATQGS 84

Query: 67  EAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQE------TQQQVINKTTTSQTD 120
             A+    +++  + K P  + +       A   P ++        +++V  K + S+T 
Sbjct: 85  STAQLTDTQVVAAESKSPAADSKTQNADPQAVTMPAAETKKVSCVAEKKVKAKASESETP 144

Query: 121 AEKTPNEKRQGTTDGINNQSNATNDP 146
           A + P E+R+        Q N    P
Sbjct: 145 ASQAPAEEREPEGAAAPTQENQDTRP 170


>gi|169833596|ref|YP_001693504.1| hypothetical protein SPH_0080 [Streptococcus pneumoniae
           Hungary19A-6]
 gi|168996098|gb|ACA36710.1| conserved hypothetical protein [Streptococcus pneumoniae
           Hungary19A-6]
          Length = 330

 Score = 35.6 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 6/80 (7%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAK-KAAEKIIHKDKKKPKEN-----QEV 90
           E GK+L+D       ++ AE ARK  ++A E AK +  E+I    KK    N      E 
Sbjct: 208 EDGKSLVDILKMMKTDRDAEIARKEQKEAQEKAKAERLEEIAQSAKKNANANIKAYDAET 267

Query: 91  NEVPVAANIEPESQETQQQV 110
            E+     I PE Q   ++V
Sbjct: 268 GEILEQGTITPEPQNNAREV 287


>gi|89092251|ref|ZP_01165205.1| ATP synthase F0, B subunit [Oceanospirillum sp. MED92]
 gi|89083339|gb|EAR62557.1| ATP synthase F0, B subunit [Oceanospirillum sp. MED92]
          Length = 156

 Score = 35.6 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 45/95 (47%), Gaps = 14/95 (14%)

Query: 27  VAPPPPQTLAERGKAL---LDEAT------QKAAEKAAEAARKAAEQAA---EAAKKAAE 74
           V PP    LAER K +   LD A       Q A EKA E  RK  E+AA   E A K A 
Sbjct: 25  VWPPITAALAERKKKIAEGLDAADRAERDLQLAQEKATENMRKGKEEAAAIIEQANKRAN 84

Query: 75  KIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQ 109
           +II  D+ K K  +E N V  A   E E +  Q +
Sbjct: 85  QII--DEAKEKALEEANRVKAAKEAELEQEVNQAR 117


>gi|313669156|ref|YP_004049440.1| ATP synthase B chain [Neisseria lactamica ST-640]
 gi|313006618|emb|CBN88084.1| ATP synthase B chain [Neisseria lactamica 020-06]
          Length = 156

 Score = 35.3 bits (79), Expect = 2.6,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE  AE   +  E  A A K+AA KI+ + K++  +         
Sbjct: 47  AERGKSDFEQAEKKVAELMAEGRNQVTEMVANAEKRAA-KIVEEAKEQASQEAARIVAQA 105

Query: 96  AANIEPESQETQQ 108
            A++E E    ++
Sbjct: 106 KADVEQEVNRARE 118


>gi|238760241|ref|ZP_04621386.1| Translation initiation factor IF-2 [Yersinia aldovae ATCC 35236]
 gi|238701564|gb|EEP94136.1| Translation initiation factor IF-2 [Yersinia aldovae ATCC 35236]
          Length = 892

 Score = 35.3 bits (79), Expect = 2.8,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 10/95 (10%)

Query: 42  LLDEATQKAAEKAA--EAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANI 99
           + +E  ++AAE+ A  EAA KA  QAAE  K   ++    +K KP +  +      AA +
Sbjct: 126 IAEEKAKRAAEEQAKREAAEKAKRQAAEKEKVTNQQT--DEKNKPAQTDKARREAEAAEL 183

Query: 100 EPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTD 134
           +   +E  ++ +      + DA++   E R+   D
Sbjct: 184 KRSVEEETRRKV------EEDAKRVAEEARKMAAD 212


>gi|149004234|ref|ZP_01829021.1| immunoglobulin A1 protease [Streptococcus pneumoniae SP14-BS69]
 gi|147757784|gb|EDK64797.1| immunoglobulin A1 protease [Streptococcus pneumoniae SP14-BS69]
          Length = 814

 Score = 35.3 bits (79), Expect = 2.8,   Method: Composition-based stats.
 Identities = 34/160 (21%), Positives = 65/160 (40%), Gaps = 26/160 (16%)

Query: 22  GQADPVAPPP----------PQTLAERGKALLDEATQKAAEKAAE-------------AA 58
           G+ + VAP P          P+T  E+ K    E T++   K  E              +
Sbjct: 156 GEPEQVAPLPEYKGNIEQVKPETPVEKTKEQSPEKTEEVPVKPTEETPVNPNEGTTEGTS 215

Query: 59  RKAAE---QAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTT 115
            + AE   Q AE  +  + KI +++  +       ++ PV  + +PE   T  +  N   
Sbjct: 216 IQGAENPVQPAEETQTNSGKIANENTGEVSNKPSDSKPPVEESNQPEKNGTATKPENSGN 275

Query: 116 TSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAEN 155
           T+  + +  P      +T+ ++ +SN +N   +++   EN
Sbjct: 276 TTSENGQTEPEPSNGNSTEDVSTKSNTSNSNGNEEIKQEN 315


>gi|268574402|ref|XP_002642178.1| C. briggsae CBR-UBXN-4 protein [Caenorhabditis briggsae]
 gi|187025180|emb|CAP35647.1| CBR-UBXN-4 protein [Caenorhabditis briggsae AF16]
          Length = 456

 Score = 35.3 bits (79), Expect = 2.8,   Method: Composition-based stats.
 Identities = 37/145 (25%), Positives = 67/145 (46%), Gaps = 32/145 (22%)

Query: 18  MASCGQADPVAPPPPQT---------LAE---RGKALLDEATQKAAEKAAEAARKAAEQA 65
           +AS      VA  PP T         LAE   R KALL++   K AEK  E+ ++  E+ 
Sbjct: 133 LASAPAPVSVAIQPPNTSTSQEMTSELAEKVARAKALLEQKKLKDAEKKRESDKQMKEEL 192

Query: 66  AEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTP 125
            +A          ++ K+ ++++ + E    A  + + ++ + +   +   +Q  A++  
Sbjct: 193 TKA----------REAKQDRDDKALME----AAKQRKKEKMETEKEKERILAQIKADRED 238

Query: 126 NEKRQGTTDGINNQSNATNDPSSKD 150
           ++KR G T      SN++ND S  D
Sbjct: 239 SKKRFGKT------SNSSNDASKAD 257


>gi|195129924|ref|XP_002009404.1| GI15252 [Drosophila mojavensis]
 gi|193907854|gb|EDW06721.1| GI15252 [Drosophila mojavensis]
          Length = 1160

 Score = 35.3 bits (79), Expect = 2.8,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 34/73 (46%)

Query: 48  QKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQ 107
           Q   E  AEA  +A +QA E A+   E +         + Q    VPV   ++ E+ E+Q
Sbjct: 199 QAQLEAMAEATTEAVQQANEEAQADDELVAEDSTPAATDEQNSPAVPVEQQVDSEAAESQ 258

Query: 108 QQVINKTTTSQTD 120
            +++ +   SQ +
Sbjct: 259 PEIVEQQEDSQPE 271


>gi|29829307|ref|NP_823941.1| ABC transporter ATP-binding protein [Streptomyces avermitilis
           MA-4680]
 gi|29606414|dbj|BAC70476.1| putative peptide ABC transporter ATP-binding protein [Streptomyces
           avermitilis MA-4680]
          Length = 508

 Score = 35.3 bits (79), Expect = 2.9,   Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 5/53 (9%)

Query: 32  PQTLAERGKALLDEAT-QKAAEKAAE--AARKAAEQAAE--AAKKAAEKIIHK 79
           PQT A+     + E T +K AEKA E   A KAAE+A E   A+KAAEK + K
Sbjct: 378 PQTPAKTADVAVAEKTAEKTAEKAVEETVAEKAAEKAVEETVAEKAAEKAVEK 430


>gi|330505860|ref|YP_004382729.1| ATP synthase F0 subunit B [Pseudomonas mendocina NK-01]
 gi|328920146|gb|AEB60977.1| ATP synthase F0, B subunit [Pseudomonas mendocina NK-01]
          Length = 156

 Score = 35.3 bits (79), Expect = 2.9,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 27  VAPPPPQTLAERGKALLD--EATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKP 84
           V PP    L ER K + D  +A  +AA     A  K A+Q  EA  +AAE I   +K+  
Sbjct: 25  VWPPVITALQERQKKIADGLDAANRAARDLELAHEKVAQQLREAKGQAAEIIEQANKRAA 84

Query: 85  KENQEVNEVPVAANIEPESQETQQQ 109
              Q V+E    A +E +  + Q Q
Sbjct: 85  ---QIVDEARDQARVEADRVKAQAQ 106


>gi|313213554|emb|CBY40498.1| unnamed protein product [Oikopleura dioica]
          Length = 416

 Score = 35.3 bits (79), Expect = 3.0,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 10/119 (8%)

Query: 42  LLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEP 101
           + +EA + A +KAAE       +  E A+K AEK   +++K     +  NE      +E 
Sbjct: 150 MFEEANRDAIKKAAEEEELLKMKEREEAEKLAEKAKQEEQKSAAVQETRNE-----EVEQ 204

Query: 102 ESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK--IAENTKE 158
           E +  Q Q +    ++  +  + P+  +   T+G++   +     SSK +  I+E+TKE
Sbjct: 205 EREIVQSQSVPSEVSNVQNGNELPDSVK---TNGMSQSEDLNQSISSKHESSISESTKE 260


>gi|301622978|ref|XP_002940801.1| PREDICTED: hypothetical protein LOC100488578 [Xenopus (Silurana)
           tropicalis]
          Length = 369

 Score = 35.3 bits (79), Expect = 3.0,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 28/50 (56%)

Query: 22  GQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKK 71
            +AD  A       A++   +  +A +K AE  AEAARK AE  AEAA+K
Sbjct: 114 ARADAEAAKVQAAFAQKKVEMGAKAARKKAEMEAEAARKKAEMEAEAARK 163


>gi|194758587|ref|XP_001961543.1| GF15021 [Drosophila ananassae]
 gi|190615240|gb|EDV30764.1| GF15021 [Drosophila ananassae]
          Length = 5182

 Score = 35.3 bits (79), Expect = 3.0,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 10/100 (10%)

Query: 22  GQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDK 81
           G+A+  A P  Q LA RG++      Q AA     +   A E  + A   +A+  + + +
Sbjct: 27  GRANEEARPTMQLLAPRGRSYATTYEQYAAFPRRRSPSMAGEMQSRAVDTSADFDVLEGQ 86

Query: 82  ----------KKPKENQEVNEVPVAANIEPESQETQQQVI 111
                      KPK     NE P   +++P + E +  V+
Sbjct: 87  PRGTTVGFIPTKPKFTYRFNEPPEEFSLDPVTGEVKTNVV 126


>gi|195026151|ref|XP_001986193.1| GH21224 [Drosophila grimshawi]
 gi|193902193|gb|EDW01060.1| GH21224 [Drosophila grimshawi]
          Length = 642

 Score = 35.3 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 6/107 (5%)

Query: 24  ADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAA--EQAAEAAKKAAEKIIHKDK 81
           AD     PP + AER      +  Q+AA+   +   KAA   QAA ++ KA  K+     
Sbjct: 217 ADQEKKKPPLSKAERRAV---QEAQRAAKAQGQTKTKAAPITQAAASSAKATPKVSATPV 273

Query: 82  KKPKENQEV-NEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNE 127
           K+PK + E   + PV  +     +E + ++ N   ++  DA    N+
Sbjct: 274 KEPKRDSESPAKSPVKLSTLKAERECKMKLFNHLASADKDASLFVND 320


>gi|195121632|ref|XP_002005324.1| GI20420 [Drosophila mojavensis]
 gi|193910392|gb|EDW09259.1| GI20420 [Drosophila mojavensis]
          Length = 4529

 Score = 35.3 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 43   LDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
            LD   +K AE+ AE   +  E +  AA+K +E+ +  + KKP+  +   E   A  ++ E
Sbjct: 4092 LDAKQKKQAEQEAEKKSQLGEISEVAAEKVSEEKV-PESKKPEVKEAETESQKAKTLQKE 4150

Query: 103  SQETQQQVINKTTTSQTDAEKTPNE 127
            S E Q+  + +   +Q DAEK   +
Sbjct: 4151 SVEEQKLNVKQKKQAQKDAEKKAQQ 4175


>gi|194894415|ref|XP_001978061.1| GG19385 [Drosophila erecta]
 gi|190649710|gb|EDV46988.1| GG19385 [Drosophila erecta]
          Length = 673

 Score = 35.3 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 23 QADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKK 82
          +AD V PP P    +  + L     Q  A K     RK AE+ A+ A+KA E+    +++
Sbjct: 36 KADDVRPPKPTNSKKEKRRL---KKQNTALKNQRICRKQAEKEAKRAQKAKERAELSNRE 92

Query: 83 KPKENQ 88
           P  NQ
Sbjct: 93 NPMANQ 98


>gi|71656791|ref|XP_816937.1| kinesin [Trypanosoma cruzi strain CL Brener]
 gi|70882098|gb|EAN95086.1| kinesin, putative [Trypanosoma cruzi]
          Length = 1669

 Score = 35.3 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 41/85 (48%)

Query: 35   LAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVP 94
             +ER  A L ++  K  +K A     A  +  +A     E+I+H ++K  ++ +EV  V 
Sbjct: 942  FSERYAATLHKSHSKLWDKIARVEHDAETRIGDARSLLEEEIVHFNEKLQQKEEEVRRVK 1001

Query: 95   VAANIEPESQETQQQVINKTTTSQT 119
                +E  +Q+  +++  +T   QT
Sbjct: 1002 ELHEVEMRAQQAAKRLEMETWNCQT 1026


>gi|257063909|ref|YP_003143581.1| putative collagen-binding protein [Slackia heliotrinireducens DSM
           20476]
 gi|256791562|gb|ACV22232.1| putative collagen-binding protein [Slackia heliotrinireducens DSM
           20476]
          Length = 1562

 Score = 35.3 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 55/136 (40%), Gaps = 6/136 (4%)

Query: 19  ASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKA-AEQAAEAAKKAAEKII 77
           A  G  D V     QT+A    AL D   + A E   EA+  A  E  A   + +A+   
Sbjct: 32  AEDGDVDAVGAAEEQTVA----ALADGEAESAEEPQVEASDPAVGEDPATEQEPSAQTEG 87

Query: 78  HKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGIN 137
            +  + P+  QE  +   A  +EP+  +  Q +    T ++       + + Q +TD  N
Sbjct: 88  FETVQAPRA-QEATDTAAAEAVEPQPDQEVQPLAEPETEAEATRANAGDVRSQTSTDLEN 146

Query: 138 NQSNATNDPSSKDKIA 153
              N T D  + D  A
Sbjct: 147 FLVNVTIDAPTDDNGA 162


>gi|303277061|ref|XP_003057824.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226460481|gb|EEH57775.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 3352

 Score = 34.9 bits (78), Expect = 3.4,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 49/120 (40%), Gaps = 14/120 (11%)

Query: 29   PPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQ 88
            P P    A+   A+   A+  A E+   A +++A++AAEA K+ AE ++  ++   K  +
Sbjct: 2741 PSPTVATAKVVSAMKSAASDGAVERVTAALKESADRAAEAEKQLAEVVLSGEQSDAKYEK 2800

Query: 89   --------------EVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTD 134
                          EVN++    +   E     ++    + T     EK  +E  Q   D
Sbjct: 2801 RIASLKRKVVDLTNEVNDLNAELHASKEKVSLAEKREKSSRTKLAATEKKLSESTQAAID 2860


>gi|238023069|ref|ZP_04603495.1| hypothetical protein GCWU000324_02993 [Kingella oralis ATCC 51147]
 gi|237865452|gb|EEP66592.1| hypothetical protein GCWU000324_02993 [Kingella oralis ATCC 51147]
          Length = 166

 Score = 34.9 bits (78), Expect = 3.5,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 9/78 (11%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE   E   + +E  A A K+AA+ +         E+ +   +  
Sbjct: 57  AERGKSDFEQAEKKVAELLTEGRNQVSEIVANAEKRAAQIV---------EDAKAQAITE 107

Query: 96  AANIEPESQETQQQVINK 113
           AA+I  +++   +Q IN+
Sbjct: 108 AASITEQAKTNAEQEINR 125


>gi|210610370|ref|ZP_03288375.1| hypothetical protein CLONEX_00565 [Clostridium nexile DSM 1787]
 gi|210152520|gb|EEA83526.1| hypothetical protein CLONEX_00565 [Clostridium nexile DSM 1787]
          Length = 280

 Score = 34.9 bits (78), Expect = 3.5,   Method: Composition-based stats.
 Identities = 42/159 (26%), Positives = 62/159 (38%), Gaps = 34/159 (21%)

Query: 5   KYQIILLS-LLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAE--KAAEAARKA 61
           K  IILLS +L  +MA+C                 GK   D  T+K  E  K  E    A
Sbjct: 21  KISIILLSAVLVFSMAACNG---------------GKEKADNQTEKQMESVKPTEEVAMA 65

Query: 62  AEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDA 121
            E   E   +A  +   KD  + K+++E  +           +E  Q   N+T + Q + 
Sbjct: 66  TEAVTEVTTEAGSEETEKDIAEVKDSEEKTD-----------KEDNQSADNETASKQKEK 114

Query: 122 EKTPNEKRQ-----GTTDGINNQSNATNDPSSKDKIAEN 155
            +  +E  Q     G  +   NQSNA N   + D   +N
Sbjct: 115 SEQDDEPEQKAPASGNKEAGGNQSNAGNGGQTTDSPKDN 153


>gi|261345161|ref|ZP_05972805.1| translation initiation factor IF-2 [Providencia rustigianii DSM
           4541]
 gi|282566852|gb|EFB72387.1| translation initiation factor IF-2 [Providencia rustigianii DSM
           4541]
          Length = 906

 Score = 34.9 bits (78), Expect = 3.5,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 3/91 (3%)

Query: 42  LLDEATQKAAEKAAEA-ARKAAEQAA--EAAKKAAEKIIHKDKKKPKENQEVNEVPVAAN 98
           L   A + AA++ AEA A++ AE+ A  EAA KA  +   ++K K  EN +       +N
Sbjct: 123 LAKRAAEDAAKREAEANAKREAEEKAKREAADKATREAAEREKVKQSENHQKPGKTNESN 182

Query: 99  IEPESQETQQQVINKTTTSQTDAEKTPNEKR 129
            E + +E +   + +    +T  +     +R
Sbjct: 183 AEKQRREAEAAELKRKAEEETQRKVEAEARR 213


>gi|237743417|ref|ZP_04573898.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|229433196|gb|EEO43408.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
          Length = 93

 Score = 34.9 bits (78), Expect = 3.5,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 9/96 (9%)

Query: 10  LLSLLSTTMASCGQADPVAPPPPQT--LAERGKAL--LDE-ATQKAAEKAAEAARKAAEQ 64
           +L LLS ++ +CG+  P      +   L E  +A   LDE A +K  +K  E A+K  E 
Sbjct: 1   MLILLSLSLVACGEKFPYTSKSEKVKLLKEYQEAYNKLDESADEKETDKVFEKAQKIFEI 60

Query: 65  AAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIE 100
             E  K++ +     D+K  KE +E N++ +  NIE
Sbjct: 61  TKELEKRSWDG----DEKASKEIEEWNKLVIEMNIE 92


>gi|307328251|ref|ZP_07607429.1| thymidylate kinase [Streptomyces violaceusniger Tu 4113]
 gi|306886085|gb|EFN17093.1| thymidylate kinase [Streptomyces violaceusniger Tu 4113]
          Length = 1100

 Score = 34.9 bits (78), Expect = 3.6,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 48  QKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKP-KENQEVNEVPVAANIEPESQET 106
           Q+ AE+ AEAAR+ AE A   A++  ++I  +D+ +   E +   E    A    E++  
Sbjct: 775 QREAERQAEAARQRAEDARRRAEEDRKRIEAEDRARAVDEERRRLEAEAEAVRRAEAEAR 834

Query: 107 QQQVINKTTTSQTDAEK 123
           +Q+   K   +   AE+
Sbjct: 835 RQEEQRKAEEALLRAEQ 851


>gi|149175469|ref|ZP_01854090.1| hypothetical protein PM8797T_18434 [Planctomyces maris DSM 8797]
 gi|148845737|gb|EDL60079.1| hypothetical protein PM8797T_18434 [Planctomyces maris DSM 8797]
          Length = 1354

 Score = 34.9 bits (78), Expect = 3.6,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 51/118 (43%)

Query: 32   PQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVN 91
            P +   R    L E + KA + A       A QAA  A K A++I+   +++ KEN E +
Sbjct: 934  PDSEPTRRATQLAEESIKAQQAADAGRLHEASQAANRASKKADEIMQAHQEQNKENTERD 993

Query: 92   EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSK 149
                 A      Q++Q + + + +TS++  ++     +Q         S   ++ S K
Sbjct: 994  AFLEQAERMANLQQSQAEKMEQASTSESKRQEALQNTQQALARQTQALSKELSETSRK 1051


>gi|322789721|gb|EFZ14887.1| hypothetical protein SINV_04218 [Solenopsis invicta]
          Length = 2315

 Score = 34.9 bits (78), Expect = 3.7,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 13/103 (12%)

Query: 52  EKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVI 111
           E  AE ++   E   +  +    ++  +DK K +E  E         +EP S E+   V+
Sbjct: 809 EPVAEESKCDIEIKTDTTENDILELCSRDKAKTREEIE--------KVEPSSAES---VV 857

Query: 112 NKTT--TSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKI 152
           ++ T     TD+EK  NEK +   D +N++S   +  +++D +
Sbjct: 858 SRETEVAKDTDSEKPTNEKMEAKNDALNDESLEISVSATQDSL 900


>gi|89892359|gb|ABD78954.1| Iga2 [Haemophilus influenzae]
          Length = 1887

 Score = 34.9 bits (78), Expect = 3.8,   Method: Composition-based stats.
 Identities = 41/177 (23%), Positives = 68/177 (38%), Gaps = 49/177 (27%)

Query: 27   VAPPPPQT-LAERGKALLDEATQKAAEKAAEAARKAAE---------------------- 63
            +APP PQ   AE  K    EA + A  KA EA R+AAE                      
Sbjct: 1015 IAPPSPQANQAEEAKRQQAEAEKVARRKAEEAKRQAAELLAKQKAEAEAQALAARRQAEA 1074

Query: 64   -----------------QAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQET 106
                             +AAE AK+ AE+   + K++ +     N V +A     ++QE 
Sbjct: 1075 ERKARELAEREKAEAERKAAELAKQKAEQAKAQPKRRRRRAAPQNNVAIA-----QAQEA 1129

Query: 107  QQQVINKTTTSQTDAEKTPNEK----RQGTTDGINNQSNATNDPSSKDKIAENTKED 159
            ++Q       ++  AE+   +     RQ + +    +  A  + +  +K+A    E+
Sbjct: 1130 RRQQAEAERVARLKAEEAKRQSEMLARQKSEEERKARELAEREKAEAEKVARRKAEE 1186


>gi|298711743|emb|CBJ49280.1| hypothetical protein Esi_0371_0004 [Ectocarpus siliculosus]
          Length = 1221

 Score = 34.9 bits (78), Expect = 3.8,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 37/94 (39%), Gaps = 4/94 (4%)

Query: 59  RKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQ 118
           R A E   E  + A E     D ++P   Q  +   VAA +E +    +Q        + 
Sbjct: 216 RNADEPRVEQTESAPEVAAGADAEEPDAEQTESAPEVAAGVEADEPRVEQTESAPEVAAG 275

Query: 119 TDAEKTPNEKRQG----TTDGINNQSNATNDPSS 148
            DAE+   E+ +G       G   + NA ND  S
Sbjct: 276 ADAEEPRVEQTEGDGWHVVGGSGGKVNAHNDEES 309


>gi|167522725|ref|XP_001745700.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163776049|gb|EDQ89671.1| predicted protein [Monosiga brevicollis MX1]
          Length = 490

 Score = 34.9 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 28/45 (62%)

Query: 44  DEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQ 88
           +E   KA EK  +  +KAA++ AE  +KAAEK+  K  +K  +++
Sbjct: 251 EEKRLKAEEKKRQKEQKAADKLAEKQRKAAEKLAKKQGQKKSKDK 295


>gi|72080828|ref|YP_287886.1| p76 membrane protein precursor [Mycoplasma hyopneumoniae 7448]
 gi|71913952|gb|AAZ53863.1| p76 membrane protein precursor [Mycoplasma hyopneumoniae 7448]
          Length = 1420

 Score = 34.9 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 4/100 (4%)

Query: 49  KAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQE-VNEVPVAANIEPESQETQ 107
           K   K         E+  E  +K  EK   K  +KP+E QE   E     + +   Q+T+
Sbjct: 851 KLPPKEEVLPPLEEEKKPEQDQKPQEKQEDKQNQKPQEKQEDKKEQEQQKHSQSPDQKTE 910

Query: 108 QQVINKTTTSQTDAEKTP---NEKRQGTTDGINNQSNATN 144
            Q  ++    QT +E +P   NE         N+Q+N TN
Sbjct: 911 TQTQSQEKDKQTSSETSPSNTNESSGTQNTAQNSQTNQTN 950


>gi|319426862|gb|ADV54936.1| von Willebrand factor type A [Shewanella putrefaciens 200]
          Length = 663

 Score = 34.9 bits (78), Expect = 4.0,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 57/149 (38%), Gaps = 4/149 (2%)

Query: 15  STTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE 74
           S    S  QA      P Q  +++ K+   E   K  +  A A +   +Q  +      E
Sbjct: 486 SNEQQSGSQASQEQQQPDQDKSQQNKSEQAEQGSKEQQDNANADQNLEQQKEDEQPSEQE 545

Query: 75  KIIHKDKKKPKENQE----VNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQ 130
           K+   ++    E QE     NE  + A  + +++++ +Q      T +   + TP+++  
Sbjct: 546 KLNGHNQSDSNEAQENAPVENEAKMQAQAKADTEQSAEQEKQNLGTKEAPEKNTPDKQDA 605

Query: 131 GTTDGINNQSNATNDPSSKDKIAENTKED 159
             T+ +    N+   P    +      ED
Sbjct: 606 TITESLEPPMNSEPLPPEMQRALRGVSED 634


>gi|323485870|ref|ZP_08091205.1| hypothetical protein HMPREF9474_02956 [Clostridium symbiosum
           WAL-14163]
 gi|323400858|gb|EGA93221.1| hypothetical protein HMPREF9474_02956 [Clostridium symbiosum
           WAL-14163]
          Length = 306

 Score = 34.9 bits (78), Expect = 4.0,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 24  ADPVAPPPPQTLAERGK-----ALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEK 75
           AD VAP   +  AE G      A  DE  ++A  + AEA RKA   A + AKKAAE+
Sbjct: 68  ADEVAPAGEEKSAEEGNSAQPPAAEDEEKKRAEHEVAEAQRKAEFDAKQQAKKAAEQ 124


>gi|293360101|ref|XP_243381.5| PREDICTED: retrotransposon-like 1 [Rattus norvegicus]
          Length = 1587

 Score = 34.9 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 7/79 (8%)

Query: 73  AEKIIHKDKKKPKEN--QEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQ 130
           +E  + ++K +P     +E+ E+P     EP ++  ++     T     D E+T ++  Q
Sbjct: 190 SESGLAQEKMEPPSGPLEEMQELPTDLTQEPSTRPYEE----GTNDQPEDMEETSDDSNQ 245

Query: 131 GTTDGINNQ-SNATNDPSS 148
            ++DG N++  N +N  SS
Sbjct: 246 ESSDGSNHEFDNGSNHESS 264


>gi|237838321|ref|XP_002368458.1| DNA mismatch repair protein, putative [Toxoplasma gondii ME49]
 gi|211966122|gb|EEB01318.1| DNA mismatch repair protein, putative [Toxoplasma gondii ME49]
          Length = 1607

 Score = 34.9 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 52/119 (43%), Gaps = 9/119 (7%)

Query: 39  GKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKE-----NQEVNEV 93
           GKA   E    ++EKA E   +AA   A AAK A E++  +  ++  E      Q+  + 
Sbjct: 54  GKA--PERRDASSEKATEETSQAASAGAAAAKNAKEEMPTRKVRRFSEGVFCKRQDDEDA 111

Query: 94  PVAANIEPESQE--TQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKD 150
           P  A   PE  +   Q+  +  +TT  T+ EK       G +    + S    DP S+D
Sbjct: 112 PRGAAGSPEKNKDAVQKTEMRNSTTEPTEDEKKRQRASVGDSTAARSSSGNEEDPGSED 170


>gi|256372632|ref|YP_003110456.1| hypothetical protein Afer_1872 [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256009216|gb|ACU54783.1| hypothetical protein Afer_1872 [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 816

 Score = 34.9 bits (78), Expect = 4.3,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 3/91 (3%)

Query: 43  LDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
           L E  ++ A++  + AR AAE A   A++AAE  + + + +  E   + +      +E  
Sbjct: 113 LLERARREAQRIEDEARHAAEAALGEARQAAEAYLEQVRAQASELTRMADRTAQTTVESA 172

Query: 103 SQETQQQVINKTTTSQ---TDAEKTPNEKRQ 130
            QE +  V+     ++    DAE    E+R+
Sbjct: 173 KQEGRSLVLRANEHARKLLADAEAKVAERRE 203


>gi|150951299|ref|XP_001387601.2| predicted protein [Scheffersomyces stipitis CBS 6054]
 gi|149388478|gb|EAZ63578.2| predicted protein [Pichia stipitis CBS 6054]
          Length = 479

 Score = 34.9 bits (78), Expect = 4.3,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 9/120 (7%)

Query: 39  GKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAAN 98
           GK+++D  T   +EK+     K +E+A    +K  ++   + ++K K+ QE     VAA+
Sbjct: 89  GKSVID--THIFSEKSDTLTSKLSEEAQRRKEKNRKRQERRARQKVKKQQE----EVAAD 142

Query: 99  IEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKE 158
            + ES++  +   +K    Q D+EK   + ++          + T+  +  DKIAEN ++
Sbjct: 143 SKNESEQANETPESK---DQNDSEKKKKKNKKIKQTSSPTSGSETHTDAINDKIAENVEK 199


>gi|307211745|gb|EFN87740.1| Enolase-phosphatase E1 [Harpegnathos saltator]
          Length = 1247

 Score = 34.5 bits (77), Expect = 4.4,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 64/150 (42%), Gaps = 11/150 (7%)

Query: 15   STTMASCGQADPVAPPPPQTLAERGKALLDEATQ----KAAEKAAEAARKAAEQAAEAAK 70
            ST +A   Q++ V    P    ++    +   TQ     AA+K+ E+     ++  E AK
Sbjct: 965  STDVAKDAQSEIVDKTQPAENDKKADEKVASETQVCDKNAADKSEESVTTEKDEVKEEAK 1024

Query: 71   KAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDA-EKTPNEKR 129
                    ++     E +EV ++   A    E+ ET +  + KTT ++ +A   T + KR
Sbjct: 1025 TVPGTSESEEISAKSEQEEVTKMETIATDVTENGETTEVAVEKTTVTEPEATTSTTDAKR 1084

Query: 130  QGTTDGINNQSNATNDPSSKDKIAENTKED 159
            + +      QSN      S +  AE+ K D
Sbjct: 1085 EAS------QSNEVALEKSLEVAAESEKVD 1108


>gi|134293993|ref|YP_001117729.1| hypothetical protein Bcep1808_5316 [Burkholderia vietnamiensis G4]
 gi|134137150|gb|ABO58264.1| conserved hypothetical protein [Burkholderia vietnamiensis G4]
          Length = 592

 Score = 34.5 bits (77), Expect = 4.4,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 3/101 (2%)

Query: 28  APPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPK 85
           A  P Q +AE+  A +    +KA E A+ +A KA+  A   A+KA+E   +I +    P 
Sbjct: 373 ASKPAQVVAEKAPAPVPTVAEKAPEPASTSADKASTPAPVVAEKASEPASVIAEKASTPA 432

Query: 86  ENQEVNEVPVAANIEPESQETQQQVINKTTT-SQTDAEKTP 125
                N       +  E+ E    +  KTT  + T A+K P
Sbjct: 433 PVIAENASAPVPTVADEAPEPASTIAEKTTEPAATAADKAP 473


>gi|332969723|gb|EGK08737.1| ATP synthase F0 sector subunit B [Kingella kingae ATCC 23330]
          Length = 156

 Score = 34.5 bits (77), Expect = 4.5,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AERGK+  ++A +K AE   E   + AE  A A K+AA+ I+   K +            
Sbjct: 47  AERGKSDFEQAEKKVAELLTEGRTQVAEMVANAEKRAAQ-IVEDAKVQAATEAARIAAQA 105

Query: 96  AANIEPESQETQQQVINKTTT 116
            A++E E+   ++ +  +  T
Sbjct: 106 KADVEQETNRAREALREQVAT 126


>gi|195436658|ref|XP_002066274.1| GK18181 [Drosophila willistoni]
 gi|194162359|gb|EDW77260.1| GK18181 [Drosophila willistoni]
          Length = 5689

 Score = 34.5 bits (77), Expect = 4.5,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 47/126 (37%), Gaps = 31/126 (24%)

Query: 36   AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--------------------- 74
            AE+     DE   KA    AE A    EQ  +  K  AE                     
Sbjct: 3802 AEKETTSSDEQQPKAKVVDAEEADDDQEQKMDVDKSIAENGDDKKSTDIVSTPDPDAPSD 3861

Query: 75   ------KIIHKDKKKPKENQEVNEVPV----AANIEPESQETQQQVINKTTTSQTDAEKT 124
                  K   +DK+KP E +E N++ V        E + +E   +   K TT + D E++
Sbjct: 3862 DLEEKKKSEDEDKEKPSEEEETNKMDVDDETVTAKESDKKEGSPEKDEKATTDKADVEES 3921

Query: 125  PNEKRQ 130
            P E ++
Sbjct: 3922 PEETKK 3927


>gi|149278197|ref|ZP_01884335.1| hypothetical protein PBAL39_11587 [Pedobacter sp. BAL39]
 gi|149230963|gb|EDM36344.1| hypothetical protein PBAL39_11587 [Pedobacter sp. BAL39]
          Length = 1110

 Score = 34.5 bits (77), Expect = 4.7,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 52  EKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEV-PVAANIEPESQETQQQV 110
           +KAAE  +KAA Q  + AKK  E  + +  ++ + N  V E+  +  N+   S E ++ +
Sbjct: 759 QKAAEHQKKAAGQLEQMAKKMEE--MQQQSEQMENNLNVQELRQLLENLLKTSFEQEKVM 816

Query: 111 INKTTTSQTDAEKTPNEKRQ 130
           +N    S TD + T N + Q
Sbjct: 817 LNLKRLSSTDPQYTANVQEQ 836


>gi|227832120|ref|YP_002833827.1| hypothetical protein cauri_0290 [Corynebacterium aurimucosum ATCC
           700975]
 gi|262184029|ref|ZP_06043450.1| hypothetical protein CaurA7_08558 [Corynebacterium aurimucosum ATCC
           700975]
 gi|227453136|gb|ACP31889.1| putative membrane protein [Corynebacterium aurimucosum ATCC 700975]
          Length = 279

 Score = 34.5 bits (77), Expect = 5.0,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 48/115 (41%), Gaps = 13/115 (11%)

Query: 20  SCGQADPVAPPPPQTLAE---RGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKI 76
           S  +  PV P P +   E   + +A   E   K AEK A+   +AA   AE       ++
Sbjct: 64  SIDETAPVIPAPKKESKEETPKKEAPKQEPAPKKAEKNADDKAQAATVPAEKPSDDDTRV 123

Query: 77  IHKDKKKPKENQEVNEV----------PVAANIEPESQETQQQVINKTTTSQTDA 121
           I K K KP++  +  E           P A +  P  ++ Q   ++  TT + +A
Sbjct: 124 IQKVKDKPEQKADAKEAEKPEVKTATKPEAKSAAPVDEKPQDAAVDTFTTGELEA 178


>gi|145601939|ref|XP_359462.2| hypothetical protein MGG_05315 [Magnaporthe oryzae 70-15]
 gi|145010400|gb|EDJ95056.1| hypothetical protein MGG_05315 [Magnaporthe oryzae 70-15]
          Length = 1716

 Score = 34.5 bits (77), Expect = 5.0,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 43/110 (39%), Gaps = 5/110 (4%)

Query: 26   PVA--PPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKK 83
            PVA  P P       G+ + D+A  +         R+  E     +K A  +   K    
Sbjct: 1190 PVAEMPRPLSPQKTGGRMISDQAAVRPLSPQKTGGRRLPEAPVSPSKDAQAR---KPNSP 1246

Query: 84   PKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTT 133
             +     NE PV  NI P + E Q+  ++  + SQ      P + R+G +
Sbjct: 1247 FEGASATNENPVIENIPPSAPELQRSGMHSRSWSQNKIRPLPLQPREGPS 1296


>gi|325114051|emb|CBZ49609.1| hypothetical protein NCLIV_001030 [Neospora caninum Liverpool]
          Length = 895

 Score = 34.5 bits (77), Expect = 5.1,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 4/61 (6%)

Query: 38  RGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAA 97
           R  A L E  +  AE   +A  +  E A + A   AE  +  DK  P E+QE  + P   
Sbjct: 346 RASAALSEDGETEAE--TQARTETPEDAQDGAATDAE--MRGDKHSPTESQETKDTPTTP 401

Query: 98  N 98
           N
Sbjct: 402 N 402


>gi|194705088|gb|ACF86628.1| unknown [Zea mays]
 gi|195634795|gb|ACG36866.1| BSD domain containing protein [Zea mays]
          Length = 300

 Score = 34.5 bits (77), Expect = 5.1,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 35 LAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKE 86
          L ER +A   EA +++ E +AEAA++++   +E AKK+ E I  +   K +E
Sbjct: 3  LWERARAFAGEAAKRSQELSAEAAKRSSALVSETAKKSKE-IFSETASKSRE 53


>gi|253576309|ref|ZP_04853639.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844202|gb|EES72220.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 279

 Score = 34.5 bits (77), Expect = 5.2,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 3/129 (2%)

Query: 33  QTLAERGKALLDEATQKA-AEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVN 91
           + + ++G+ L ++   +A A    EAAR+  +Q   +  +  E++  K K KP E  E  
Sbjct: 83  EAILQQGEKLREKQESEALAWAGEEAARQMKQQIERSTGRQVERVTVKLKTKPAEKSEAG 142

Query: 92  EV-PVAANIEPESQE-TQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSK 149
            + P+AA     S E    QV ++  T++ DA     E      + I    N +N   + 
Sbjct: 143 GIRPLAAEPVISSVEVVMAQVKSEEQTAKADAAGRGPEVSIAPVEKIKISVNTSNSGKTG 202

Query: 150 DKIAENTKE 158
           D   E+  +
Sbjct: 203 DAEEESEAQ 211


>gi|55981786|ref|YP_145083.1| hypothetical protein TTHA1817 [Thermus thermophilus HB8]
 gi|81363757|sp|Q5SHB3|CNPD_THET8 RecName: Full=2',3'-cyclic-nucleotide 2'-phosphodiesterase
 gi|55773199|dbj|BAD71640.1| putative hydrolase (HD domain) [Thermus thermophilus HB8]
          Length = 574

 Score = 34.5 bits (77), Expect = 5.2,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           A+  + LL EA ++ A +  EAARK A    EAA++ A+ +  + + + K  +E  E  +
Sbjct: 30  AQEARELL-EAARREAREVLEAARKEARDILEAARQEAKALRQEAEARAKAQREEVEAEL 88

Query: 96  AANIEPESQETQQQV 110
              +E    E ++++
Sbjct: 89  RRRLEAAEAEAKKRL 103


>gi|212640534|ref|YP_002317054.1| methyl-accepting chemotaxis protein [Anoxybacillus flavithermus
           WK1]
 gi|212562014|gb|ACJ35069.1| Methyl-accepting chemotaxis protein [Anoxybacillus flavithermus
           WK1]
          Length = 430

 Score = 34.5 bits (77), Expect = 5.4,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 14/100 (14%)

Query: 54  AAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAAN------------IEP 101
           AA    K   Q  +AA KAAE  I +D   PK + E+  + +A N            I+ 
Sbjct: 70  AARFITKPLSQLEQAALKAAEGEIGQDVPVPKSDDEIRSLALAFNDMLRSLRDMVQSIQQ 129

Query: 102 ESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSN 141
               T ++V+  T  S+  AE+  N  R  T D I+  ++
Sbjct: 130 NFAHTNEKVVEMTNVSRIAAEQAENIAR--TIDEISKGAD 167


>gi|310792461|gb|EFQ27988.1| hypothetical protein GLRG_03132 [Glomerella graminicola M1.001]
          Length = 863

 Score = 34.1 bits (76), Expect = 5.7,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 11/87 (12%)

Query: 25  DPVAPPPPQTLAERGKALLDEATQKAAEKAAE----AARKAAEQAAEAAKKAA---EKII 77
           +P  PP P    +     LD  T K A K AE     A+KA E A ++  KA    +K++
Sbjct: 567 EPELPPIPDLPEQPTPPDLDRYTDKDARKQAEKEGKRAQKAYESAVKSRDKAIKERQKLV 626

Query: 78  HKDKKKPKENQEVNEVPVAANIEPESQ 104
            K +KK ++  +      A  IE E Q
Sbjct: 627 EKRRKKAEKEAQKE----AQRIEKEEQ 649


>gi|119620210|gb|EAW99804.1| adducin 2 (beta), isoform CRA_g [Homo sapiens]
          Length = 504

 Score = 34.1 bits (76), Expect = 5.7,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAE--KIIHKDKKKPKENQEVNEVP 94
           ER K  LD   + A E+    A+ A     ++  K AE    +    K  +E  +  E  
Sbjct: 351 ERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETS 410

Query: 95  VAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDK 151
            AA  EPE+ + +  V+N     QT  E       Q TT      S  T+  +SKDK
Sbjct: 411 KAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTT------SADTDVDTSKDK 461


>gi|260814936|ref|XP_002602169.1| hypothetical protein BRAFLDRAFT_97985 [Branchiostoma floridae]
 gi|229287476|gb|EEN58181.1| hypothetical protein BRAFLDRAFT_97985 [Branchiostoma floridae]
          Length = 1061

 Score = 34.1 bits (76), Expect = 5.9,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 65  AAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQV-INKTTTSQTD 120
           A E   + + K+ H    KPK +QE  E+     I PES  +  +V I+ T T+QTD
Sbjct: 758 AEEKPAEGSPKMNHTGGGKPKGSQESMEM---RPISPESASSHTKVKIDVTDTTQTD 811


>gi|169335941|ref|ZP_02863134.1| hypothetical protein ANASTE_02376 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258679|gb|EDS72645.1| hypothetical protein ANASTE_02376 [Anaerofustis stercorihominis DSM
           17244]
          Length = 218

 Score = 34.1 bits (76), Expect = 6.2,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 55/116 (47%), Gaps = 7/116 (6%)

Query: 48  QKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNE-VPVAANIEPESQET 106
           Q+ AE+  E       + A+   K  E  +++D K  K+N+EV E   +  N+E   +ET
Sbjct: 102 QEVAEEIKETEETEVIEDAQEEIKDEEANVNEDTKDAKDNEEVIEDDSLEENVETADEET 161

Query: 107 QQQVINKTTTSQTDAEKTPNEKRQG----TTDGINNQSNATNDPSSKDKIAENTKE 158
            + V+   T S+   E   + + +G    +T+ ++ + N       +DK ++N  E
Sbjct: 162 NEDVVE--TESEETKEVAADTESEGSIDESTEEMDEEDNLDKTLDKEDKSSDNDDE 215


>gi|162451658|ref|YP_001614025.1| protein kinase [Sorangium cellulosum 'So ce 56']
 gi|161162240|emb|CAN93545.1| Protein kinase [Sorangium cellulosum 'So ce 56']
          Length = 984

 Score = 34.1 bits (76), Expect = 6.2,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 10/54 (18%)

Query: 35  LAERGKALLDEATQKAAEKAAEAARKAAEQA----------AEAAKKAAEKIIH 78
           +A+ G+  + EAT K A  + EA R AAE+A          +EA ++ AE++ H
Sbjct: 850 VAQIGEIRMTEATLKTALASEEAQRSAAERARQDSEAARQDSEAQRRRAERLQH 903


>gi|24376059|ref|NP_720102.1| cell division protein FtsY [Shewanella oneidensis MR-1]
 gi|24351075|gb|AAN57546.1|AE015890_7 cell division protein FtsY [Shewanella oneidensis MR-1]
          Length = 510

 Score = 34.1 bits (76), Expect = 6.2,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 34/68 (50%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVA 96
           +  KA  +    + AE+ AE AR A +QAAEA + AAE+ + +     K   E  +V   
Sbjct: 129 QAAKAQAEVEALRLAEEQAEVARLAEQQAAEATRLAAEQALAEQLAAEKAEAEQIQVEQP 188

Query: 97  ANIEPESQ 104
              +PE Q
Sbjct: 189 LEQQPEPQ 196


>gi|115725165|ref|XP_787351.2| PREDICTED: similar to SPBPJ4664.02 [Strongylocentrotus purpuratus]
 gi|115970739|ref|XP_001186255.1| PREDICTED: similar to SPBPJ4664.02 [Strongylocentrotus purpuratus]
          Length = 7366

 Score = 34.1 bits (76), Expect = 6.4,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 57/131 (43%), Gaps = 8/131 (6%)

Query: 27   VAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKE 86
            +A  P QT  E    +LD+A+     + +   ++     A   K  A + +  D ++   
Sbjct: 6994 LAESPSQTALE----ILDQASSPRLPRVSTQVQQTPPAVAVRTKTTASQHV-SDTEQSTT 7048

Query: 87   NQEVNEVPVAANIEPESQETQQQVI---NKTTTSQTDAEKTPNEKRQGTTDGINNQSNAT 143
              E++++ +AA  E  +++   Q +     +TT    A+K    + + T + +N QS   
Sbjct: 7049 QYEISQLDIAAQYEKMTEDNATQYVFTAAHSTTQYERADKDIETQHKTTQEDVNTQSEVE 7108

Query: 144  NDPSSKDKIAE 154
            N PS    + E
Sbjct: 7109 NSPSGIQAVNE 7119


>gi|126735805|ref|ZP_01751550.1| ribonuclease E, putative [Roseobacter sp. CCS2]
 gi|126714992|gb|EBA11858.1| ribonuclease E, putative [Roseobacter sp. CCS2]
          Length = 879

 Score = 34.1 bits (76), Expect = 6.4,   Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 46/89 (51%), Gaps = 7/89 (7%)

Query: 24  ADPVA--PPPPQTLAERGKALLDEATQKAAEKAAEA-ARKAAEQAAEAAKKAAEKIIHKD 80
           AD VA   P P+   +R +    +A + AAE A E  A K AE+ AE  K A +K   + 
Sbjct: 726 ADKVAEDAPAPEAKPKRTRTRRKKA-EPAAEDAVETPAEKPAEEVAE-DKPAPKKRTRRK 783

Query: 81  KKKPKEN--QEVNEVPVAANIEPESQETQ 107
           K +PKE    EV+    AA  EP++ E +
Sbjct: 784 KAEPKEEAVAEVDAKTPAAEAEPDAIEEK 812


>gi|46199767|ref|YP_005434.1| hypothetical protein TTC1465 [Thermus thermophilus HB27]
 gi|81405491|sp|Q72HM1|CNPD_THET2 RecName: Full=2',3'-cyclic-nucleotide 2'-phosphodiesterase
 gi|46197394|gb|AAS81807.1| hydrolase (HD superfamily) [Thermus thermophilus HB27]
          Length = 574

 Score = 34.1 bits (76), Expect = 6.6,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           A+  + LL EA ++ A +  EAARK A    EAA+  A+ +  + + + K  +E  E  +
Sbjct: 30  AQEARELL-EAARREAREVLEAARKEARDILEAARHEAKALRQEAEARAKAQREEVEAEL 88

Query: 96  AANIEPESQETQQQV 110
              +E    E ++++
Sbjct: 89  RRRLEAAEAEAKKRL 103


>gi|221505747|gb|EEE31392.1| DNA mismatch repair protein, putative [Toxoplasma gondii VEG]
          Length = 1682

 Score = 34.1 bits (76), Expect = 6.8,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 51/119 (42%), Gaps = 9/119 (7%)

Query: 39  GKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKE-----NQEVNEV 93
           GKA   E    ++EKA E   +AA   A AAK A E++  +  ++  E      Q+  + 
Sbjct: 113 GKA--PERRDASSEKATEETSQAASAGAAAAKNAKEEMPTRKVRRFSEGVFCKRQDDEDA 170

Query: 94  PVAANIEPESQE--TQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKD 150
           P  A   PE  +   Q+  +   TT  T+ EK       G +    + S    DP S+D
Sbjct: 171 PRGAAGSPEKNKDAVQKTEMRNNTTEPTEDEKKRQRASVGDSTAARSSSGNEEDPGSED 229


>gi|146309624|ref|YP_001190089.1| ATP synthase F0, B subunit [Pseudomonas mendocina ymp]
 gi|226694440|sp|A4Y191|ATPF_PSEMY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145577825|gb|ABP87357.1| ATP synthase F0 subcomplex B subunit [Pseudomonas mendocina ymp]
          Length = 156

 Score = 34.1 bits (76), Expect = 6.8,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 27  VAPPPPQTLAERGKAL---LDEA------TQKAAEKAAEAARKAAEQAAEA---AKKAAE 74
           V PP  Q + ER K +   LD A       Q A E+AA+  R+  EQAAE    A K A 
Sbjct: 25  VWPPLTQAMQERQKKIAEGLDAAGRAERDLQLAQERAAQMLRETKEQAAEILDRANKTAN 84

Query: 75  KIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQV 110
            I+ + K + +   E       A I+ E    + Q+
Sbjct: 85  AIVEEAKAQARSEGEKLIAGAKAEIDLEVNRAKDQL 120


>gi|10440416|dbj|BAB15741.1| FLJ00043 protein [Homo sapiens]
          Length = 1415

 Score = 34.1 bits (76), Expect = 7.0,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 52/134 (38%), Gaps = 23/134 (17%)

Query: 22  GQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDK 81
           GQ  P AP PP+T  E                   ++R+ A+  A       +K    D 
Sbjct: 164 GQVGPEAPRPPETSPE-----------------MRSSRQPAQDTAPTPAPRLQK--GSDA 204

Query: 82  KKPKENQEVNEVPVAANIEP----ESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGIN 137
            +P   Q  +EVP A+   P     ++ETQ Q   +  T    A   P+ + +G+ D   
Sbjct: 205 LRPPVPQGEDEVPKASGAPPAGLGSARETQAQACPQEGTEAHGARLGPSIEDKGSGDPFG 264

Query: 138 NQSNATNDPSSKDK 151
            Q     +  ++D+
Sbjct: 265 RQRLKAEEMDTEDR 278


>gi|326434950|gb|EGD80520.1| hypothetical protein PTSG_01111 [Salpingoeca sp. ATCC 50818]
          Length = 1133

 Score = 34.1 bits (76), Expect = 7.1,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 59/117 (50%), Gaps = 13/117 (11%)

Query: 24  ADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAE--------AAKKAAEK 75
           ++P+  PPP  +  RG+  +    Q+  ++AA+A +     AA+        A+ K  E+
Sbjct: 208 SNPLMQPPPH-ICSRGRVHIINFLQQEKQRAAKATQDLQASAAQARDVDVEDASAKEQER 266

Query: 76  IIHKDKKKPKENQEVNEVPVAANIEPESQETQ--QQVINKTTTSQTDAEKTPNEKRQ 130
           I  ++K+  +E Q + +  + A +E + QE Q  Q+ + +   +Q +A K    ++Q
Sbjct: 267 INEREKQMAEEAQRLQQ--MRAQLEQKEQELQAAQERLLQQEKAQQEAAKEMKLRQQ 321


>gi|325109295|ref|YP_004270363.1| hypothetical protein Plabr_2741 [Planctomyces brasiliensis DSM
          5305]
 gi|324969563|gb|ADY60341.1| hypothetical protein Plabr_2741 [Planctomyces brasiliensis DSM
          5305]
          Length = 228

 Score = 34.1 bits (76), Expect = 7.4,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 22 GQADPVAPPPPQTLAERGKALLDEAT----QKAAEKAAEAARKAAEQAAEAAKKAAEKII 77
          G   P A  PP    E      ++       K  E AAE A+K A++A E   + +EK+ 
Sbjct: 25 GSTAPPATDPPAETTEETVETTEKEAETDLNKTLEDAAETAQKTAKEAGEYVSEQSEKV- 83

Query: 78 HKDKKKPKENQEVNEV 93
             +++  E++E  EV
Sbjct: 84 ---RQQLDESEEAKEV 96


>gi|303312453|ref|XP_003066238.1| Transcription initiation factor IIE, alpha subunit, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240105900|gb|EER24093.1| Transcription initiation factor IIE, alpha subunit, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|320033683|gb|EFW15630.1| transcription factor TFIIE complex alpha subunit [Coccidioides
           posadasii str. Silveira]
          Length = 436

 Score = 33.7 bits (75), Expect = 7.4,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 41  ALLDEATQKAAEKAAEAARKAAEQAAEAAKK-AAEKIIHKDKKKPKENQEVNEVPVA--A 97
           +L   A + A E+A EAARKAA +   A      +  +  D + P+   E N V +    
Sbjct: 242 SLTSTAEKSAEEQAREAARKAALEKQNALPIWHTQSTVSTDVRLPQVKTEPNGVSIKPEV 301

Query: 98  NIEPESQETQQQVINKTTTS 117
           +I+PE +E Q+  I+    S
Sbjct: 302 DIKPEVKEEQKPDIDSLDDS 321


>gi|195397989|ref|XP_002057610.1| GJ18227 [Drosophila virilis]
 gi|194141264|gb|EDW57683.1| GJ18227 [Drosophila virilis]
          Length = 653

 Score = 33.7 bits (75), Expect = 7.5,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 51  AEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQV 110
           + K   A  K     A A K+ AE          +++ E NE+PV A++EPE+   ++ V
Sbjct: 285 SNKKETAVPKEEPNVATARKEGAEN--------AEKSTESNEIPVKASVEPETTNAEEPV 336

Query: 111 IN-KTTTSQTDAEKTPNEKRQGTTDGINNQSNA 142
              ++   Q   ++ P      TT  IN +S A
Sbjct: 337 AAPRSPKEQPKTQEIPTVNSTPTTPVINLESLA 369


>gi|194291170|ref|YP_002007077.1| F0F1 ATP synthase subunit b [Cupriavidus taiwanensis LMG 19424]
 gi|226741426|sp|B3R7L9|ATPF_CUPTR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|193225005|emb|CAQ71016.1| membrane-bound ATP synthase, F0 sector, subunit b [Cupriavidus
           taiwanensis LMG 19424]
          Length = 156

 Score = 33.7 bits (75), Expect = 7.6,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AE+GKA L+ A ++  +  AEA  + A++ A+A K+A    +  D+ K     E   +  
Sbjct: 47  AEKGKAELELANKRVDQAMAEARTEGAQRVADAEKRAQ---LTADEIKQNAQAEAARIIA 103

Query: 96  AANIEPESQETQQQ 109
            A  E E Q T+ +
Sbjct: 104 QAKAEAEQQATRAR 117


>gi|319783580|ref|YP_004143056.1| hypothetical protein Mesci_3890 [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317169468|gb|ADV13006.1| hypothetical protein Mesci_3890 [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 276

 Score = 33.7 bits (75), Expect = 7.8,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 34/63 (53%)

Query: 11 LSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAK 70
          L+ + +  A CG  +P    P +   ++ +  LD+A Q AA+  ++A R AA   ++A +
Sbjct: 22 LAPVPSAFAKCGIVEPCQLNPIKKQVDKARKQLDKAGQAAAKATSKAKRDAARATSKAKR 81

Query: 71 KAA 73
           AA
Sbjct: 82 DAA 84


>gi|118364702|ref|XP_001015572.1| Nuclear movement protein [Tetrahymena thermophila]
 gi|89297339|gb|EAR95327.1| Nuclear movement protein [Tetrahymena thermophila SB210]
          Length = 1380

 Score = 33.7 bits (75), Expect = 7.8,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 10/61 (16%)

Query: 90   VNEVPVAANIE--PESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPS 147
            + E  V+  +E   E+Q +Q++ +N   TSQT   +T N+++Q     I NQ      PS
Sbjct: 1144 IGEQAVSPQVEKPSENQTSQKKEVN---TSQTAKVQTENQEKQ-----IQNQKETNQKPS 1195

Query: 148  S 148
            S
Sbjct: 1196 S 1196


>gi|172040474|ref|YP_001800188.1| signal recognition particle receptor [Corynebacterium urealyticum
           DSM 7109]
 gi|171851778|emb|CAQ04754.1| signal recognition particle receptor [Corynebacterium urealyticum
           DSM 7109]
          Length = 554

 Score = 33.7 bits (75), Expect = 7.8,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 2/90 (2%)

Query: 45  EATQKAAEKAAEAARKAAEQAAEA--AKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
           EA  +A+EK A A  +  + AAE   A + +     ++K           VP A   EP+
Sbjct: 100 EAPAEASEKPAPAKAEPEQPAAEKADADETSPAAAEEEKPAEPAAPAELAVPAAEQGEPD 159

Query: 103 SQETQQQVINKTTTSQTDAEKTPNEKRQGT 132
           +++  +    +   S+   E  P EKR+ T
Sbjct: 160 AEKAAEDPQGEQAGSEKPVEAEPAEKRETT 189


>gi|6967028|emb|CAB72435.1| MUP1 protein [Kluyveromyces lactis]
          Length = 354

 Score = 33.7 bits (75), Expect = 7.8,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 47/116 (40%), Gaps = 9/116 (7%)

Query: 41  ALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHK---------DKKKPKENQEVN 91
           A L EA     ++A   +R++ EQ    A+KAA     K          KK+P +    +
Sbjct: 69  ASLHEAPAIVLQEAKPVSRESIEQEGAPAEKAASGNSSKLSMRLKKVFGKKEPSQPPVDS 128

Query: 92  EVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPS 147
           E+   A+ E  +        N    ++T+++  P  KR   +DG   Q      PS
Sbjct: 129 ELSPPASSEAAANHDANDTTNTLNRNRTNSDTDPEPKRNLYSDGSQIQGTPLTSPS 184


>gi|195126729|ref|XP_002007823.1| GI12168 [Drosophila mojavensis]
 gi|193919432|gb|EDW18299.1| GI12168 [Drosophila mojavensis]
          Length = 2925

 Score = 33.7 bits (75), Expect = 7.9,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 6/99 (6%)

Query: 27  VAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKE 86
           V P P   + ERGK  L + T +   K+ EAA    E+    A +   + +  ++ K K 
Sbjct: 719 VEPQPQPVMWERGKKKLQQPTAQEIPKSHEAAVDTLEEEIPPAVQPEPQPVMWERGKKKP 778

Query: 87  NQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTP 125
            Q     P A  I P++QE     + + T    + E  P
Sbjct: 779 QQ-----PKAQEI-PKTQEVAVDTLQEETAPTVEPEPQP 811


>gi|85081606|ref|XP_956753.1| hypothetical protein NCU01476 [Neurospora crassa OR74A]
 gi|28917829|gb|EAA27517.1| predicted protein [Neurospora crassa OR74A]
 gi|38566842|emb|CAE76148.1| hypothetical protein [Neurospora crassa]
          Length = 811

 Score = 33.7 bits (75), Expect = 7.9,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 43  LDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPE 102
           L   + K A K AE   K A +  EAA K  +KI+ K++ K  E  E  +  +A +I+ E
Sbjct: 577 LSSISDKDARKKAEKDAKQARKEYEAAVKNRDKIL-KERLKIVEKHEKAQAKLARDIQKE 635

Query: 103 SQETQQ 108
            ++ ++
Sbjct: 636 QEKLRK 641


>gi|291536724|emb|CBL09836.1| hypothetical protein ROI_29420 [Roseburia intestinalis M50/1]
          Length = 262

 Score = 33.7 bits (75), Expect = 8.4,   Method: Composition-based stats.
 Identities = 41/154 (26%), Positives = 62/154 (40%), Gaps = 24/154 (15%)

Query: 5   KYQIILLS-LLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAE--KAAEAARKA 61
           K  IILLS +L  +MA+C                 GK   D  T+K  E  K  + A  A
Sbjct: 3   KISIILLSAVLVFSMAACNG---------------GKEKADNQTEKQTESVKPTKEAEMA 47

Query: 62  AEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDA 121
            E   E   +A  +   KD  + K+++E  +     + + E+   Q+Q   +    +  A
Sbjct: 48  TEAVTEVTTEAGSEETDKDIAEVKDSEEKIDKEDNRSADNETDSKQEQKPKQNDEPEQKA 107

Query: 122 EKTPNEKRQGTTDGINNQSNATNDPSSKDKIAEN 155
               NE+  G      NQSNA N   + D   +N
Sbjct: 108 PVNDNEEAGG------NQSNAGNGGQTTDSPKDN 135


>gi|255727280|ref|XP_002548566.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240134490|gb|EER34045.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 1078

 Score = 33.7 bits (75), Expect = 8.5,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 57/133 (42%), Gaps = 18/133 (13%)

Query: 29   PPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAE--AAKKAAEK--IIHKDKKKP 84
            P   Q  AE+ KA   +A Q  AE+      KA +   E  + KK  E+  ++ +  K+P
Sbjct: 940  PKAEQPKAEQPKAEQPKAEQPKAEQPKVEQPKAEQPKVEPVSQKKVVEEAPVVQEKSKEP 999

Query: 85   KENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATN 144
                   + P+   ++P S E  QQ    +TTS+++ ++  +          N QS+   
Sbjct: 1000 IPEPSTVQTPIIEQVKPSSVEQPQQ----STTSKSEVQQESS----------NTQSSVET 1045

Query: 145  DPSSKDKIAENTK 157
              SS  KI    K
Sbjct: 1046 PASSTSKIVRTKK 1058


>gi|126336395|ref|XP_001375402.1| PREDICTED: similar to CaM-like protein kinase [Monodelphis
           domestica]
          Length = 892

 Score = 33.7 bits (75), Expect = 8.5,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 30  PPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQE 89
           P  + +AE+ +  + E      E+AAE  RK+  +  EAA+K  E I   ++   K  + 
Sbjct: 146 PEVEEVAEKRRKSIPEV-----EEAAEKRRKSIPEVEEAAEKRRESIPEVEEAAEKRRES 200

Query: 90  VNEVPVAANIEPES 103
           + EV  AA    ES
Sbjct: 201 IPEVEEAAEKRRES 214


>gi|253991502|ref|YP_003042858.1| translation initiation factor IF-2 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638380|emb|CAR67002.1| translation initiation factor if-2 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782952|emb|CAQ86117.1| translation initiation factor if-2 [Photorhabdus asymbiotica]
          Length = 910

 Score = 33.7 bits (75), Expect = 8.6,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 44  DEATQKAAEKAA-EAARKAAEQAAEAAKKAAEKIIHKDK----KKPKENQEVNEVPVAAN 98
           D+A ++A EKA  EAA KA  QAAE  K   +   H+ K     K  +N++      AA+
Sbjct: 141 DQAKREAEEKAKREAAEKAKRQAAENEKVTNQHTEHRQKPAQTDKTVQNEKARREAEAAD 200

Query: 99  IEPESQETQQQ 109
           ++ +++E  ++
Sbjct: 201 LKRKAEEEMRR 211


>gi|118383325|ref|XP_001024817.1| hypothetical protein TTHERM_00238920 [Tetrahymena thermophila]
 gi|89306584|gb|EAS04572.1| hypothetical protein TTHERM_00238920 [Tetrahymena thermophila
           SB210]
          Length = 513

 Score = 33.7 bits (75), Expect = 8.8,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 51/115 (44%), Gaps = 7/115 (6%)

Query: 42  LLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEP 101
           L D++  +    + EA +   E+  E      EK    ++++ K  QE  + P     E 
Sbjct: 303 LGDDSQIQRPTPSQEAEQSTQEKEEENQITEQEK----NEQQVKAGQEGQQTPTQKEEEN 358

Query: 102 ESQETQQQVIN--KTTTSQTDAEKTPNEKRQGTTDGINNQS-NATNDPSSKDKIA 153
           + Q+ +    +   + + Q D +K PNE+ Q  T   NN +  A N+   K+ IA
Sbjct: 359 QQQQAETPQQDSQNSQSGQADTQKNPNEQAQVNTTAANNSTVTANNNKKEKESIA 413


>gi|152985533|ref|YP_001351671.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa PA7]
 gi|226694439|sp|A6VF36|ATPF_PSEA7 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|150960691|gb|ABR82716.1| ATP synthase F0, B subunit [Pseudomonas aeruginosa PA7]
          Length = 156

 Score = 33.7 bits (75), Expect = 8.9,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 13/110 (11%)

Query: 27  VAPPPPQTLAERGKALLD--EATQKAA-------EKAAEAARKAAEQAA---EAAKKAAE 74
           V PP    L ER K + D  +A  +AA       EKA +  R+A  QAA   E AKK A 
Sbjct: 25  VWPPVIAALQERQKKIADGLDAANRAARDLELAHEKAGQQLREAKAQAAEIVEQAKKRAN 84

Query: 75  KIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKT-TTSQTDAEK 123
           +I+ + + + +   E  +    A IE E    +  +  +  T + T AEK
Sbjct: 85  QIVDEARDQARAEGERLKAQAQAEIEQELNSVKDALRAQVGTLAVTGAEK 134


>gi|170727372|ref|YP_001761398.1| TPR repeat-containing protein [Shewanella woodyi ATCC 51908]
 gi|169812719|gb|ACA87303.1| Tetratricopeptide TPR_2 repeat protein [Shewanella woodyi ATCC
           51908]
          Length = 650

 Score = 33.7 bits (75), Expect = 9.1,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 51/106 (48%), Gaps = 3/106 (2%)

Query: 55  AEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKT 114
           +E   +  +Q  ++ +  +E+   +++K+  +N E +      + +  S+++  Q   + 
Sbjct: 468 SEQGEEGDQQDKQSDQSDSEQGKDQEQKQQGQNGEQDNQEQQGDQQQNSEQSDSQHNEQQ 527

Query: 115 TTSQTDAE--KTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKE 158
           ++   DA+    PNE++Q   D   NQ   +ND  +  K  E +KE
Sbjct: 528 SSKDNDAQMQADPNEQQQTADDNDKNQQAQSNDEKAAAK-DEESKE 572


>gi|113869577|ref|YP_728066.1| F0F1 ATP synthase subunit B [Ralstonia eutropha H16]
 gi|123133498|sp|Q0K5M3|ATPF_RALEH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|113528353|emb|CAJ94698.1| Membrane-bound ATP synthase, F0 sector,subunitb [Ralstonia eutropha
           H16]
          Length = 156

 Score = 33.7 bits (75), Expect = 9.3,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AE+GKA L+ A ++  +  AEA  + A++ A+A K+A    +  D+ K     E   +  
Sbjct: 47  AEKGKAELELANKRVDQAMAEARTEGAQRVADAEKRAQ---LTADEIKQNAQAEAARIIA 103

Query: 96  AANIEPESQETQQQ 109
            A  E E Q T+ +
Sbjct: 104 QAKAEAEQQVTRAR 117


>gi|94312429|ref|YP_585639.1| F0F1 ATP synthase subunit B [Cupriavidus metallidurans CH34]
 gi|226694447|sp|Q1LHK6|ATPF_RALME RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|93356281|gb|ABF10370.1| F0 sector of membrane-bound ATP synthase, subunit b [Cupriavidus
           metallidurans CH34]
          Length = 156

 Score = 33.7 bits (75), Expect = 9.3,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 36  AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95
           AE+GKA L+ A ++  +  AEA  + A++ A+A K+A    +  D+ K     E   +  
Sbjct: 47  AEKGKAELELANKRVDQAMAEARTEGAQRVADAEKRAQ---LTADEIKQNAQAEAARIIA 103

Query: 96  AANIEPESQETQQQ 109
            A  E E Q T+ +
Sbjct: 104 QAKAEAEQQVTRAR 117


>gi|134083101|emb|CAL00469.1| unnamed protein product [Aspergillus niger]
          Length = 653

 Score = 33.7 bits (75), Expect = 9.6,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 12/122 (9%)

Query: 37  ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVA 96
           E+ ++  +EA +K AEK  E  +K  E+ A A  + A+K   +DK+KP E +E  E  V 
Sbjct: 269 EKPESKPEEAPEKPAEK--EEPQKTDEEPAAAPSEPADKA--EDKQKPNEPEEKPEQNVE 324

Query: 97  ANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENT 156
              +PE +  +++     T  +  +E+ P     G   G+            ++K+A N 
Sbjct: 325 Q--KPEEKSEEKRDAEPDTKPEEKSEEKPAPAADGAETGVKTSQ------EREEKVASNV 376

Query: 157 KE 158
            E
Sbjct: 377 LE 378


>gi|323526182|ref|YP_004228335.1| NLP/P60 protein [Burkholderia sp. CCGE1001]
 gi|323383184|gb|ADX55275.1| NLP/P60 protein [Burkholderia sp. CCGE1001]
          Length = 412

 Score = 33.3 bits (74), Expect = 9.9,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 5/64 (7%)

Query: 16  TTMASCGQADPVAPPPP-----QTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAK 70
           T  A   QADP  PPPP     Q  A    A+       A   + ++   AA QAA  A+
Sbjct: 266 TPAARAPQADPFEPPPPGMSAAQLQARAAGAVSPTPMVAARSNSYDSGASAAPQAASTAR 325

Query: 71  KAAE 74
            A +
Sbjct: 326 VAPQ 329


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.299    0.115    0.295 

Lambda     K      H
   0.267   0.0371    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,020,432,428
Number of Sequences: 14124377
Number of extensions: 27662361
Number of successful extensions: 256908
Number of sequences better than 10.0: 4489
Number of HSP's better than 10.0 without gapping: 944
Number of HSP's successfully gapped in prelim test: 3545
Number of HSP's that attempted gapping in prelim test: 234609
Number of HSP's gapped (non-prelim): 18794
length of query: 159
length of database: 4,842,793,630
effective HSP length: 121
effective length of query: 38
effective length of database: 3,133,744,013
effective search space: 119082272494
effective search space used: 119082272494
T: 11
A: 40
X1: 16 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.7 bits)
S2: 75 (33.6 bits)