BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780909|ref|YP_003065322.1| hypothetical protein CLIBASIA_04040 [Candidatus Liberibacter asiaticus str. psy62] (159 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780909|ref|YP_003065322.1| hypothetical protein CLIBASIA_04040 [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 313 bits (801), Expect = 1e-87, Method: Compositional matrix adjust. Identities = 159/159 (100%), Positives = 159/159 (100%) Query: 1 MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARK 60 MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARK Sbjct: 1 MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARK 60 Query: 61 AAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD 120 AAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD Sbjct: 61 AAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTD 120 Query: 121 AEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159 AEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED Sbjct: 121 AEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAENTKED 159 >gi|254780918|ref|YP_003065331.1| glycosyl transferase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 623 Score = 23.9 bits (50), Expect = 1.5, Method: Composition-based stats. Identities = 12/22 (54%), Positives = 13/22 (59%) Query: 134 DGINNQSNATNDPSSKDKIAEN 155 D INN NA S +DKI EN Sbjct: 172 DAINNNPNAEIIYSDEDKINEN 193 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.299 0.115 0.295 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,449 Number of Sequences: 1233 Number of extensions: 2488 Number of successful extensions: 15 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 159 length of database: 328,796 effective HSP length: 67 effective length of query: 92 effective length of database: 246,185 effective search space: 22649020 effective search space used: 22649020 T: 11 A: 40 X1: 17 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.7 bits) S2: 35 (18.1 bits)