PSIBLAST alignment of GI: 254780913 and protein with PDB id: 2es2

gi|114793771|pdb|2ES2|A Chain A, Crystal Structure Analysis Of The Bacillus Subtilis Cold Shock Protein Bs-Cspb In Complex With Hexathymidine Length = 67
>gi|116667125|pdb|2F52|A Chain A, Solution Structure Of Cold Shock Protein Cspb From Bacillus Subtilis In Complex With Heptathymidine Length = 67

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 6/71 (8%)

Query: 2  VHRGSIKWYNPDKGYGFITPEGSTESGDDVFLHRSAVASAGLFNLTEGQLVTYDYVQNDA 61
          +  G +KW+N +KG+GFI  E      DDVF+H SA+   G   L EGQ V+++ V+ + 
Sbjct: 1  MLEGKVKWFNSEKGFGFIEVE----GQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNR 56

Query: 62 NGKYSAENLKL 72
               A N+  
Sbjct: 57 G--PQAANVTK 65

PSIBLAST alignment of GI: 254780913 and protein with PDB id: 2es2

gi|114793771|pdb|2ES2|A Chain A, Crystal Structure Analysis Of The Bacillus Subtilis Cold Shock Protein Bs-Cspb In Complex With Hexathymidine Length = 67>gi|116667125|pdb|2F52|A Chain A, Solution Structure Of Cold Shock Protein Cspb From Bacillus Subtilis In Complex With Heptathymidine Length = 67

gi|114793771|pdb|2ES2|A Chain A, Crystal Structure Analysis Of The Bacillus Subtilis Cold Shock Protein Bs-Cspb In Complex With Hexathymidine Length = 67
>gi|116667125|pdb|2F52|A Chain A, Solution Structure Of Cold Shock Protein Cspb From Bacillus Subtilis In Complex With Heptathymidine Length = 67