RPSBLAST alignment for GI: 254780913 and conserved domain: cd04458

>gnl|CDD|88424 cd04458, CSP_CDS, Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea. CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box protein. CSP expression is up-regulated by an abrupt drop in growth temperature. CSP's are also expressed under normal condition at lower level. The function of cold-shock proteins is not fully understood. They preferentially bind poly-pyrimidine region of single-stranded RNA and DNA. CSP's are thought to bind mRNA and regulate ribosomal translation, mRNA degradation, and the rate of transcription termination. The human Y-box protein, which contains a CSD, regulates transcription and translation of genes that contain the Y-box sequence in their promoters. This specific ssDNA-binding properties of CSD are required for the binding of Y-box protein to the promoter's Y-box sequence, thereby regulating transcription.. Length = 65
 Score = 71.0 bits (174), Expect = 7e-14
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 5/69 (7%)

Query: 4  RGSIKWYNPDKGYGFITPEGSTESGDDVFLHRSAVASAGLFNLTEGQLVTYDYVQNDANG 63
           G++KW++ +KG+GFITP+   + G+DVF+H SA+   G  +L EG  V ++  + D   
Sbjct: 2  TGTVKWFDDEKGFGFITPD---DGGEDVFVHISALEGDGFRSLEEGDRVEFELEEGD--K 56

Query: 64 KYSAENLKL 72
             A N++L
Sbjct: 57 GPQAVNVRL 65