RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780913|ref|YP_003065326.1| cold shock protein [Candidatus Liberibacter asiaticus str. psy62] (78 letters) >d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} Length = 66 Score = 70.9 bits (174), Expect = 3e-14 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 6/70 (8%) Query: 4 RGSIKWYNPDKGYGFITPEGSTESGDDVFLHRSAVASAGLFNLTEGQLVTYDYVQNDANG 63 RG +KW++ KGYGFIT + G DVF+H SA+ G L EGQ+V ++ + Sbjct: 2 RGKVKWFDSKKGYGFITKDE----GGDVFVHWSAIEMEGFKTLKEGQVVEFEIQEGK--K 55 Query: 64 KYSAENLKLV 73 A ++K+V Sbjct: 56 GPQAAHVKVV 65 >d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} Length = 69 Score = 70.5 bits (173), Expect = 3e-14 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 5/68 (7%) Query: 4 RGSIKWYNPDKGYGFITPEGSTESGDDVFLHRSAVASAGLFNLTEGQLVTYDYVQNDANG 63 G +KW+N DKG+GFITP+ DVF+H SA+ + G +L EGQ V++ Sbjct: 5 TGIVKWFNADKGFGFITPDD---GSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGA--K 59 Query: 64 KYSAENLK 71 +A N+ Sbjct: 60 GPAAGNVT 67 >d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} Length = 66 Score = 70.2 bits (172), Expect = 5e-14 Identities = 30/69 (43%), Positives = 42/69 (60%), Gaps = 5/69 (7%) Query: 4 RGSIKWYNPDKGYGFITPEGSTESGDDVFLHRSAVASAGLFNLTEGQLVTYDYVQNDANG 63 RG +KW+N +KGYGFI EG DVF+H +A+ G L EGQ V+++ VQ + G Sbjct: 3 RGKVKWFNNEKGYGFIEVEGG----SDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGN-RG 57 Query: 64 KYSAENLKL 72 +A +KL Sbjct: 58 PQAANVVKL 66 >d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Score = 67.5 bits (165), Expect = 3e-13 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 9/71 (12%) Query: 4 RGSIKWYNPDKGYGFITPEGSTESGDDVFLHRSAVASAG----LFNLTEGQLVTYDYVQN 59 G++KW+N GYGFI ++ +DVF+H++A+ L ++ +G+ V +D V+ Sbjct: 10 LGTVKWFNVRNGYGFINRN---DTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEG 66 Query: 60 DANGKYSAENL 70 + A N+ Sbjct: 67 E--KGAEAANV 75 >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Score = 57.3 bits (138), Expect = 4e-10 Identities = 18/72 (25%), Positives = 25/72 (34%), Gaps = 6/72 (8%) Query: 3 HRGSIKWYNPDKGYGFITPEGSTESGDDVFLHRSAVASAGLFNLTEGQLVTYDYVQNDAN 62 G I+ YGFI E +F H S L +L G V ++ + Sbjct: 19 ETGVIEKLL--TSYGFIQCS---ERQARLFFHCSQYNG-NLQDLKVGDDVEFEVSSDRRT 72 Query: 63 GKYSAENLKLVP 74 GK A L + Sbjct: 73 GKPIAVKLVKIS 84 >d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 79 Score = 25.1 bits (55), Expect = 1.8 Identities = 5/29 (17%), Positives = 11/29 (37%), Gaps = 4/29 (13%) Query: 13 DKGYGFITPEGSTESGDDVFLHRSAVASA 41 +KG+GF+ + F+ + Sbjct: 27 EKGFGFLEVDA----QKSYFIPPPQMKKV 51 >d1zrua1 b.21.1.3 (A:162-264) receptor binding protein, rbp, C-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]} Length = 103 Score = 24.1 bits (52), Expect = 3.1 Identities = 6/22 (27%), Positives = 9/22 (40%) Query: 3 HRGSIKWYNPDKGYGFITPEGS 24 GSI W+ + I G+ Sbjct: 76 PNGSITWWGANIDKTPIATRGN 97 >d2f0ca1 b.21.1.3 (A:63-163) Baseplate protein (bpp), C-terminal domain {Lactococcus phage tp901-1 [TaxId: 35345]} Length = 101 Score = 22.5 bits (48), Expect = 9.7 Identities = 7/21 (33%), Positives = 9/21 (42%), Gaps = 2/21 (9%) Query: 3 HRGSIKWYNPDKGYGFITPEG 23 G +W+ P G TP G Sbjct: 76 SSGVCQWFGPTASSG--TPRG 94 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.312 0.131 0.386 Gapped Lambda K H 0.267 0.0598 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 278,323 Number of extensions: 9519 Number of successful extensions: 27 Number of sequences better than 10.0: 1 Number of HSP's gapped: 21 Number of HSP's successfully gapped: 9 Length of query: 78 Length of database: 2,407,596 Length adjustment: 45 Effective length of query: 33 Effective length of database: 1,789,746 Effective search space: 59061618 Effective search space used: 59061618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 47 (22.2 bits)