RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780914|ref|YP_003065327.1| hypothetical protein CLIBASIA_04065 [Candidatus Liberibacter asiaticus str. psy62] (408 letters) >d1regx_ d.58.27.1 (X:) Translational regulator protein regA {Bacteriophage T4 [TaxId: 10665]} Length = 122 Score = 27.8 bits (62), Expect = 1.9 Identities = 12/48 (25%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Query: 309 LAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPD 356 L + L+R + K + + Q CH + K+ G I F D Sbjct: 13 LKVKETLTRMGIANNKDKVLYQSCHILQKK---GLYYIVHFKEMLRMD 57 >d2qdyb1 b.34.4.4 (B:1-211) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]} Length = 211 Score = 27.2 bits (60), Expect = 2.7 Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 166 GLMIMPFAWDGYWLASRGKVADSKVHPPKYLEYSHYYQQYLNRNTLV--KNFLSQ 218 LM A G + + ++ P Y+ +Y + + TL+ K L+Q Sbjct: 38 SLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQ 92 >d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Length = 120 Score = 26.2 bits (57), Expect = 5.1 Identities = 13/72 (18%), Positives = 24/72 (33%) Query: 174 WDGYWLASRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSS 233 + S GK + + Y Q++ ++ TL + S Y + S+ Sbjct: 33 LLNWVKQSHGKNLEWIGLVHPHNGAITYNQKFKDKATLTVDRSSTTAYIELVRLTSNDSA 92 Query: 234 ILYWAVGTLTYS 245 + Y A Y Sbjct: 93 VYYCAREDFRYH 104 >d2j8cm1 f.26.1.1 (M:1-303) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} Length = 303 Score = 25.4 bits (56), Expect = 9.2 Identities = 12/54 (22%), Positives = 18/54 (33%), Gaps = 8/54 (14%) Query: 218 QIPYKNFCMAPYHYSSI--LYWAV------GTLTYSVDNKTTTREYYKDPYYAT 263 + + N P+H SI LY + G +V RE + T Sbjct: 190 SLVHGNLFYNPFHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGT 243 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.321 0.134 0.402 Gapped Lambda K H 0.267 0.0586 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,526,285 Number of extensions: 70103 Number of successful extensions: 208 Number of sequences better than 10.0: 1 Number of HSP's gapped: 208 Number of HSP's successfully gapped: 11 Length of query: 408 Length of database: 2,407,596 Length adjustment: 87 Effective length of query: 321 Effective length of database: 1,213,086 Effective search space: 389400606 Effective search space used: 389400606 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.9 bits)