Probab=95.90 E-value=0.0054 Score=36.05 Aligned_cols=32 Identities=25% Similarity=0.249 Sum_probs=22.7 Q ss_pred CCEEECCCCC----CHHHHHHHHHHHHHHHHHHHHC Q ss_conf 5101036533----2467999999845899999612 Q gi|254780915|r 397 HPYILLNYLG----KPQDVMTLAHELGHGIHFVLSS 428 (626) Q Consensus 397 ~~~I~~N~~~----~~~dv~TL~HE~GHa~H~~ls~ 428 (626) ..-|+.|+.. .-+|..+|+||||||+|.+... T Consensus 113 ~k~Iv~~~~~eG~~i~~D~~~LLHEFAHalD~~~g~ 148 (223) T d1j7na2 113 SRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGY 148 (223) T ss_dssp TTEEEEESSSCCSSCSSHHHHHHHHHHHHHHHHHHH T ss_pred CCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHH T ss_conf 676887536545515688750353888899998600
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Anthrax toxin lethal factor, N- and C-terminal domains
domain: Anthrax toxin lethal factor, N- and C-terminal domains
species: Bacillus anthracis [TaxId: 1392]