HHsearch alignment for GI: 254780916 and conserved domain: CHL00081

>CHL00081 chlI Mg-protoporyphyrin IX chelatase.
Probab=99.20  E-value=3.3e-11  Score=98.81  Aligned_cols=158  Identities=18%  Similarity=0.130  Sum_probs=102.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHCCCC----CCCCCCCCCCCC---------
Q ss_conf             1111111122222222222222223443204887327774367999999842675----433210123465---------
Q gi|254780916|r  135 EHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKR----AFFPFFIVNCGM---------  201 (482)
Q Consensus       135 ~~~~~~~LiG~S~~m~~v~~~i~~~a~~~~~vli~Ge~GtGK~~~A~~iH~~s~r----~~~~fi~v~c~~---------  201 (482)
T Consensus         7 ~~fPf~aIvGQe~~k~aLl--l~av~p~iGgVLi~G~~GtgKStlvRala~lLP~i~~v~~~~f---~~~p~~p~~~~~~   81 (347)
T CHL00081          7 PVFPFTAIVGQEEMKLALL--LNVIDPKIGGVMIMGDRGTGKSTTIRALVDLLPEIEVVKNDPF---NSDPRDPDLMSDE   81 (347)
T ss_pred             CCCCHHHHCCHHHHHHHHH--HHHCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCC---CCCCCCCCCCCHH
T ss_conf             8898406538499999999--9825788786998789987499999999985787422068876---7898981002426


Q ss_pred             ----------------------CCCCCCHHHHHCCCC---CC-CCCCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             ----------------------542100243311255---55-3221110012344667147516642001889998888
Q gi|254780916|r  202 ----------------------IDQDKIEKFLFGDVD---LQ-TKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYN  255 (482)
Q Consensus       202 ----------------------~~~~~~e~~lFG~~~---~~-~~~~~~~~g~~~~a~~Gtl~l~ei~~L~~~~Q~~Ll~  255 (482)
T Consensus        82 ~~~~~~~~~~~~~~~~~~p~v~lPlgaTEDrv~GslDie~al~~G~~~f~pGlLa~A~rGiLyvDEINll~d~~v~~LLd  161 (347)
T CHL00081         82 VRERIRNGEKIPTKKIKIPMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDILLD  161 (347)
T ss_pred             HHHHHCCCCCCCCEECCCCEEECCCCCCCCEECCCHHHHHHHHCCCCCCCCCHHHHCCCCEEEEEHHHHHHHHHHHHHHH
T ss_conf             66543146667521146862536888852301140009989845871156531222038858861454323799999999


Q ss_pred             HHHHHH--CCCCCCCCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             776420--011235532123431565214332111111233379998865
Q gi|254780916|r  256 FIETGK--IEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRIS  303 (482)
Q Consensus       256 ~l~~~~--~~~~g~~~~~~~~~RiIa~t~~~L~~~~~~g~fr~dLy~rL~  303 (482)
T Consensus       162 a~a~G~~~VEReG~S~~~Pa~F~liaT--~NPe----EgeLrp~llDRF~  205 (347)
T CHL00081        162 SAASGWNTVEREGISIRHPARFVLIGS--GNPE----EGELRPQLLDRFG  205 (347)
T ss_pred             HHHCCEEEECCCCEEECCCCCEEEEEC--CCCC----CCCCCHHHHHHEE
T ss_conf             985580898046423305750068855--7865----5674888882632