HHsearch alignment for GI: 254780916 and conserved domain: CHL00148

>CHL00148 orf27 Ycf27; Reviewed.
Probab=99.89  E-value=5.9e-23  Score=181.88  Aligned_cols=120  Identities=19%  Similarity=0.268  Sum_probs=111.5

Q ss_pred             CCCCCEEEECCCHHHHHHHHHHHHHCCCEEEEECCH--HHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             528838998699899999999999889889998937--999986089989999785469888999999998578983999
Q gi|254780916|r    8 DRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVS--DLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIV   85 (482)
Q Consensus         8 ~~~~rILIVDDd~~~~~~l~~~L~~~G~~v~~a~~~--al~~l~~~~~dlillD~~mP~~dGlell~~i~~~~p~ipvIi   85 (482)
T Consensus         4 ~~k~kILiVEDd~~l~~~l~~~L~~~G~~v~~a~~g~~a~~~~~~~~~DlviLDi~LP~~dG~~l~~~iR~~-~~~PII~   82 (240)
T CHL00148          4 SSKEKILVVDDEASIRRILETRLSIIGYEVITASDGEEALKLFHQEQPDLVILDVMMPKLDGYGVCQEIRKE-SDVPIIM   82 (240)
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEECCCCCCCCCEEEECCCCC-CCCCEEE
T ss_conf             999829999398999999999999789999998999999999974799999997999988866305414037-9954899


Q ss_pred             EECCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9268999999988850574322222222222222222222222
Q gi|254780916|r   86 QTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGV  128 (482)
Q Consensus        86 iT~~~~~~~~~~a~~~g~~d~l~KP~~~~~L~~~i~~al~~~~  128 (482)
T Consensus        83 LTa~~~~~d~v~gl~~GADDYi~KPf~~~EL~aRi~allrr~~  125 (240)
T CHL00148         83 LTALGDVSDRITGLELGADDYVVKPFSPKELEARIRSVLRRVN  125 (240)
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             8167898999999976997895278447999999999986630