HHsearch alignment for GI: 254780916 and conserved domain: COG1241

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair].
Probab=98.51  E-value=4.8e-06  Score=62.38  Aligned_cols=215  Identities=15%  Similarity=0.156  Sum_probs=127.8

Q ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCC---CCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             4320488732777436799999984267543321012346---5542100243311255553221110012344667147
Q gi|254780916|r  161 DCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCG---MIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTI  237 (482)
Q Consensus       161 ~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~---~~~~~~~e~~lFG~~~~~~~~~~~~~g~~~~a~~Gtl  237 (482)
T Consensus       317 RGDInILLvGDPgtaKSqlLk~v~~~aPr~--vytsgkgss~~GLTAav~-------rd~~tge~~LeaGALVlAD~Gv~  387 (682)
T COG1241         317 RGDIHILLVGDPGTAKSQLLKYVAKLAPRG--VYTSGKGSSAAGLTAAVV-------RDKVTGEWVLEAGALVLADGGVC  387 (682)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHCCCE--EEECCCCCCCCCCEEEEE-------ECCCCCEEEEECCEEEEECCCEE
T ss_conf             242269981798251999999988648840--797264125457306999-------70677607886777999249779


Q ss_pred             EECCCCHHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCCCEEEEECCCC-----CCCCCCHH-HHHHHHHHHHHHH----
Q ss_conf             5166420018899988887764200112355--3212343156521433-----21111112-3337999886543----
Q gi|254780916|r  238 VLEEPDALPLAVQGRIYNFIETGKIEFFDSR--GAIRLDVRLIFLTEKN-----LLPQVKSH-VFRKDLYYRISVF----  305 (482)
Q Consensus       238 ~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~--~~~~~~~RiIa~t~~~-----L~~~~~~g-~fr~dLy~rL~~~----  305 (482)
T Consensus       388 cIDEfdKm~~~dr~aihEaMEQQtIsIaKAGI~atLnARcsvLAAaNP~~Gryd~~~~~~enI~l~~~lLSRFDLifvl~  467 (682)
T COG1241         388 CIDEFDKMNEEDRVAIHEAMEQQTISIAKAGITATLNARCSVLAAANPKFGRYDPKKTVAENINLPAPLLSRFDLIFVLK  467 (682)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHCEEEECCCCEEEECCHHHHHHHHHCCCCCCCCCCCCHHHHCCCCHHHHHHCCEEEEEC
T ss_conf             99705677767899999998752751205542541114444566518877767999997885589835775177547705


Q ss_pred             -----------HHHHHHHHHHH--HH-------------HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC------
Q ss_conf             -----------34467787744--22-------------22556677764101122333321111100012233------
Q gi|254780916|r  306 -----------LINISTLRSRS--ED-------------IPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYP------  353 (482)
Q Consensus       306 -----------~i~iPpLReR~--eD-------------I~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~------  353 (482)
T Consensus       468 D~~d~~~D~~ia~hil~~h~~~~~~~~~~~~~~~~~~~~~~~~lrkYI~Y-AR~~--v~P~lt~ea~e~l~~~Yv~~Rk~  544 (682)
T COG1241         468 DDPDEEKDEEIAEHILDKHRGEEPEETISLDGVDEVEERDFELLRKYISY-ARKN--VTPVLTEEAREELEDYYVEMRKK  544 (682)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-HHCC--CCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             78885335999999999863456532233332222234658999999998-7505--89612899999999999876520


Q ss_pred             ---------CCCCHHHHHHHHHHHHHHC---CCCCCCHHHHHHHHC
Q ss_conf             ---------8986899999999998743---898106889545421
Q gi|254780916|r  354 ---------WIDNVQELKNILLRAVIGL---KDSHLTEDRFVLLLS  387 (482)
Q Consensus       354 ---------WPGNvREL~n~i~r~~i~~---~~~~i~~~~~~~~l~  387 (482)
T Consensus       545 ~~~~~~~~~~piT~RqLEsiiRLaeA~Ak~rLS~~V~~eD~~eAi~  590 (682)
T COG1241         545 SALVEEKRTIPITARQLESIIRLAEAHAKMRLSDVVEEEDVDEAIR  590 (682)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             1223456754561999999999999988654447778899999999