HHsearch alignment for GI: 254780916 and conserved domain: COG1493

>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms].
Probab=94.60  E-value=0.1  Score=31.73  Aligned_cols=103  Identities=14%  Similarity=0.136  Sum_probs=55.2

Q ss_pred             CCCCCHHHHHHHHHHHCCCCCEEEEE-CCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             46988899999999857898399992-68999999988850574322222222222222222222222222222111111
Q gi|254780916|r   62 NCEDDKENILKNIVDKIPIVPIIVQT-TQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALD  140 (482)
Q Consensus        62 mP~~dGlell~~i~~~~p~ipvIiiT-~~~~~~~~~~a~~~g~~d~l~KP~~~~~L~~~i~~al~~~~~~~~~~~~~~~~  140 (482)
T Consensus        65 ~~~~~r~~~i~~~~--~~~~P~iI~sk~~~~p~~l~~~a~~~~~pil~s~~~ts~l~~~l~~yL~~~lA~~-~~vHGvl~  141 (308)
T COG1493          65 LSSEERKKRIGKLF--SLDTPALIVSKGLPIPEELLDAAKKYNIPILTSKLSTSELSFTLTNYLSRPLAER-VNVHGVLL  141 (308)
T ss_pred             CCHHHHHHHHHHHH--CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHHHCCCC-EEEEEEEE
T ss_conf             58455899999974--7699779997899997899999887099669853318999999999861310520-25546899


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHC
Q ss_conf             1122222222222222223443204887327774367999999842
Q gi|254780916|r  141 SLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHES  186 (482)
Q Consensus       141 ~LiG~S~~m~~v~~~i~~~a~~~~~vli~Ge~GtGK~~~A~~iH~~  186 (482)
T Consensus       142 ~I~G-------------------vGVLItG~SG~GKSElALeLi~r  168 (308)
T COG1493         142 DIFG-------------------VGVLITGPSGAGKSELALELIKR  168 (308)
T ss_pred             EEEE-------------------EEEEEECCCCCCHHHHHHHHHHH
T ss_conf             9942-------------------58999878988776899999984