HHsearch alignment for GI: 254780916 and conserved domain: COG2255

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair].
Probab=98.61  E-value=8.3e-07  Score=67.76  Aligned_cols=258  Identities=20%  Similarity=0.246  Sum_probs=140.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC---CCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             11111112222222222222222---344320488732777436799999984267543321012346554210024331
Q gi|254780916|r  136 HCALDSLIAVSPAMIQVVDLARK---AGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLF  212 (482)
Q Consensus       136 ~~~~~~LiG~S~~m~~v~~~i~~---~a~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lF  212 (482)
T Consensus        22 P~~l~efiGQ~~vk~~L~ifI~AAk~r~e~lDHvLl~GPPGlGKTTLA~IIA~E--------mgvn~k~tsGp~leK---   90 (332)
T COG2255          22 PKTLDEFIGQEKVKEQLQIFIKAAKKRGEALDHVLLFGPPGLGKTTLAHIIANE--------LGVNLKITSGPALEK---   90 (332)
T ss_pred             CCCHHHHCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHH--------HCCCEEECCCCCCCC---
T ss_conf             654888518399999999999999844987674786479987688899999998--------567737636620157---


Q ss_pred             CCCCCCCCCCCCCCCCCC-CCCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCC-C---CCCCCCC---CCEEEEECCCC
Q ss_conf             125555322111001234-46671475166420018899988887764200112-3---5532123---43156521433
Q gi|254780916|r  213 GDVDLQTKNSAQFLGKFI-EANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFF-D---SRGAIRL---DVRLIFLTEKN  284 (482)
Q Consensus       213 G~~~~~~~~~~~~~g~~~-~a~~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~-g---~~~~~~~---~~RiIa~t~~~  284 (482)
T Consensus        91 ---------~gDlaaiLt~Le~~DVLFIDEIHrl~~~vEE~LYpaMEDf~lDI~IG~gp~Arsv~ldLppFTLIGATTr~  161 (332)
T COG2255          91 ---------PGDLAAILTNLEEGDVLFIDEIHRLSPAVEEVLYPAMEDFRLDIIIGKGPAARSIRLDLPPFTLIGATTRA  161 (332)
T ss_pred             ---------HHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHHHHHHEEEEEEECCCCCCCEEECCCCCEEEEEECCCC
T ss_conf             ---------26599998639867767772553147428989646753105778972487553476379981375101346


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC--C
Q ss_conf             211111123337999886543344677877442222556-------6777641011223333211111000122338--9
Q gi|254780916|r  285 LLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLV-------HFFLQSFCTKNAIKQISISDKALSLLTKYPW--I  355 (482)
Q Consensus       285 L~~~~~~g~fr~dLy~rL~~~~i~iPpLReR~eDI~~L~-------~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~W--P  355 (482)
T Consensus       162 -------G~l--------------t~PLrdRFGi~~rlefY~~~eL~~Iv~r~a~~l~i---~i~~~~a~eIA~rSRGTP  217 (332)
T COG2255         162 -------GML--------------TNPLRDRFGIIQRLEFYTVEELEEIVKRSAKILGI---EIDEEAALEIARRSRGTP  217 (332)
T ss_pred             -------CCC--------------CCHHHHHCCCEEEEECCCHHHHHHHHHHHHHHHCC---CCCHHHHHHHHHHCCCCC
T ss_conf             -------645--------------63368862860454058889999999988887387---768579999998636993


Q ss_pred             C-CHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCHHHH
Q ss_conf             8-689999999999874389810688954542124454322343222222334443210000000011234445432589
Q gi|254780916|r  356 D-NVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRR  434 (482)
Q Consensus       356 G-NvREL~n~i~r~~i~~~~~~i~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  434 (482)
T Consensus       218 RIAnRLLrRVRDfa~V-~~~~~I~~~ia~~aL~~L~---------------------------------------Vd~~G  257 (332)
T COG2255         218 RIANRLLRRVRDFAQV-KGDGDIDRDIADKALKMLD---------------------------------------VDELG  257 (332)
T ss_pred             HHHHHHHHHHHHHHHH-HCCCCCCHHHHHHHHHHHC---------------------------------------CCCCC
T ss_conf             8999999999999998-1688204899999998729---------------------------------------64025


Q ss_pred             HHHHHHHHHHHHHHHHCCC---HHHHHHHHCCCHHHHHHHHHHHCC
Q ss_conf             9999999999999982872---789997848998899999998188
Q gi|254780916|r  435 LSDIEKEIIGLAMKLYRAQ---MSEVARRLGIGRSTLYRKIREYNI  477 (482)
Q Consensus       435 l~e~E~~~I~~aL~~~~Gn---~~~aA~~LGIsR~tL~rKlk~~gi  477 (482)
T Consensus       258 Ld~~D~k~L~~li~~f~GgPVGl~tia~~lge~~~TiEdv~EPyLi  303 (332)
T COG2255         258 LDEIDRKYLRALIEQFGGGPVGLDTIAAALGEDRDTIEDVIEPYLI  303 (332)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             5689999999999973799823999999965767778888748998