HHsearch alignment for GI: 254780916 and conserved domain: COG3604

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms].
Probab=100.00  E-value=0  Score=705.65  Aligned_cols=330  Identities=31%  Similarity=0.475  Sum_probs=287.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHCCC
Q ss_conf             11111112222222222222222344320488732777436799999984267543321012346554210024331125
Q gi|254780916|r  136 HCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDV  215 (482)
Q Consensus       136 ~~~~~~LiG~S~~m~~v~~~i~~~a~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lFG~~  215 (482)
T Consensus       219 ~~~~~~iIG~S~am~~ll~~i~~VA~Sd~tVLi~GETGtGKElvAraIH~~S~R~~kPfV~~NCAAlPesLlESELFGHe  298 (550)
T COG3604         219 VLEVGGIIGRSPAMRQLLKEIEVVAKSDSTVLIRGETGTGKELVARAIHQLSPRRDKPFVKLNCAALPESLLESELFGHE  298 (550)
T ss_pred             HCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCHHHHHHHHHCCC
T ss_conf             02445623069999999999998726898079845888538999999987375557986663122253788888874533


Q ss_pred             C-CCCCCCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCHHHH
Q ss_conf             5-553221110012344667147516642001889998888776420011235532123431565214332111111233
Q gi|254780916|r  216 D-LQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVF  294 (482)
Q Consensus       216 ~-~~~~~~~~~~g~~~~a~~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~~L~~~~~~g~f  294 (482)
T Consensus       299 KGAFTGA~~~r~GrFElAdGGTLFLDEIGelPL~lQaKLLRvLQegEieRvG~~r~ikVDVRiIAATNRDL~~~V~~G~F  378 (550)
T COG3604         299 KGAFTGAINTRRGRFELADGGTLFLDEIGELPLALQAKLLRVLQEGEIERVGGDRTIKVDVRVIAATNRDLEEMVRDGEF  378 (550)
T ss_pred             CCCCCCCHHCCCCCEEECCCCEEECHHHCCCCHHHHHHHHHHHHHCCEEECCCCCEEEEEEEEEECCCHHHHHHHHCCCC
T ss_conf             22333510146763565579757602203678778899999986365253479963677789982135309999874951


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             37999886543344677877442222556677764101122333321111100012233898689999999999874389
Q gi|254780916|r  295 RKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKD  374 (482)
Q Consensus       295 r~dLy~rL~~~~i~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~WPGNvREL~n~i~r~~i~~~~  374 (482)
T Consensus       379 RaDLYyRLsV~Pl~lPPLRER~~DIplLA~~Fle~~~~~~gr~~l~ls~~Al~~L~~y~wPGNVRELen~veRavlla-~  457 (550)
T COG3604         379 RADLYYRLSVFPLELPPLRERPEDIPLLAGYFLEKFRRRLGRAILSLSAEALELLSSYEWPGNVRELENVVERAVLLA-G  457 (550)
T ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHC-C
T ss_conf             554532102001378983458866799999999999886397640339899999973999971999998999999970-4


Q ss_pred             CCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             81068895454212445432234322222233444321000000001123444543258999999999999999828727
Q gi|254780916|r  375 SHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQM  454 (482)
Q Consensus       375 ~~i~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~e~E~~~I~~aL~~~~Gn~  454 (482)
T Consensus       458 ~~~~~~d~-~~l~~~~~~~~~~~~--~~~-----~p~~~~~-----~~~p~--~~~l~~~~~~~eR~~I~~aL~~~~~~~  522 (550)
T COG3604         458 RLTRRGDL-CTLELSLSALLWKTL--PAP-----EPSALPE-----PALPG--EHTLREATEEFERQLIIAALEETNGNW  522 (550)
T ss_pred             CCCCCCCE-EEHHHHHHCCCCCCC--CCC-----CCCCCCC-----CCCCC--CCCHHHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             76777651-016555301212467--899-----8655677-----55776--565155577899999999999819819


Q ss_pred             HHHHHHHCCCHHHHHHHHHHHCCCCCC
Q ss_conf             899978489988999999981888144
Q gi|254780916|r  455 SEVARRLGIGRSTLYRKIREYNIEVDS  481 (482)
Q Consensus       455 ~~aA~~LGIsR~tL~rKlk~~gi~~d~  481 (482)
T Consensus       523 a~AAr~LGl~~~~L~~~~kRlGI~~~~  549 (550)
T COG3604         523 AGAARRLGLTRRTLLYRMKRLGIKVKK  549 (550)
T ss_pred             HHHHHHHCCCHHHHHHHHHHCCCCCCC
T ss_conf             999999589988999999972888578