HHsearch alignment for GI: 254780916 and conserved domain: COG5271

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only].
Probab=95.79  E-value=0.021  Score=36.68  Aligned_cols=41  Identities=24%  Similarity=0.318  Sum_probs=17.3

Q ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             23443204887327774367999999842675433210123465
Q gi|254780916|r  158 KAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGM  201 (482)
Q Consensus       158 ~~a~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~  201 (482)
T Consensus      1538 RAmqv~kpilLEGsPGVGKTSlItaLAr~t---G~kliRINLSe 1578 (4600)
T COG5271        1538 RAMQVGKPILLEGSPGVGKTSLITALARKT---GKKLIRINLSE 1578 (4600)
T ss_pred             HHHHCCCCEEECCCCCCCHHHHHHHHHHHH---CCCEEEEECCC
T ss_conf             998528854622799866789999999974---57247863201