HHsearch alignment for GI: 254780916 and conserved domain: KOG0729

>KOG0729 consensus.
Probab=97.36  E-value=0.00019  Score=51.12  Aligned_cols=213  Identities=15%  Similarity=0.199  Sum_probs=111.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----------CCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             22211111111222222222222222234-----------4320488732777436799999984267543321012346
Q gi|254780916|r  132 QENEHCALDSLIAVSPAMIQVVDLARKAG-----------DCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCG  200 (482)
Q Consensus       132 ~~~~~~~~~~LiG~S~~m~~v~~~i~~~a-----------~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~  200 (482)
T Consensus       169 EekPDvTY~DvGGCKeqIEklREVVE~PlL~PErfv~LGIdPPKGvllyGPPGtGKTL~ARAVAN---RTdAcFIRViGS  245 (435)
T KOG0729         169 EEKPDVTYSDVGGCKEQIEKLREVVELPLLHPERFVNLGIDPPKGVLLYGPPGTGKTLCARAVAN---RTDACFIRVIGS  245 (435)
T ss_pred             ECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHC---CCCCEEEEEHHH
T ss_conf             12798630345366999999999884325588888752789987337868999861089998745---667458763118


Q ss_pred             CCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCC---EEEECCCCHH-----------HHHHHHHHHHHHHH-HHCCCC
Q ss_conf             55421002433112555532211100123446671---4751664200-----------18899988887764-200112
Q gi|254780916|r  201 MIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGG---TIVLEEPDAL-----------PLAVQGRIYNFIET-GKIEFF  265 (482)
Q Consensus       201 ~~~~~~~e~~lFG~~~~~~~~~~~~~g~~~~a~~G---tl~l~ei~~L-----------~~~~Q~~Ll~~l~~-~~~~~~  265 (482)
T Consensus       246 ELVQK-----YvGE-----GARM-VRElFeMAr~KKACiiFFDEiDAiGGaRFDDg~ggDNEVQRTMLEli~QLDGFDpR  314 (435)
T KOG0729         246 ELVQK-----YVGE-----GARM-VRELFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPR  314 (435)
T ss_pred             HHHHH-----HHHH-----HHHH-HHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             99999-----8624-----6899-99999985236527998410102267203578887279999999999860377888


Q ss_pred             CCCCCCCCCCEEEEECCCC--C-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             3553212343156521433--2-111111233379998865433446778774422225566777641011223333211
Q gi|254780916|r  266 DSRGAIRLDVRLIFLTEKN--L-LPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISIS  342 (482)
Q Consensus       266 g~~~~~~~~~RiIa~t~~~--L-~~~~~~g~fr~dLy~rL~~~~i~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls  342 (482)
T Consensus       315 G-------NIKVlmATNRPdtLDpALlRPGRlDR-------KVEF~LPDlegR~--------~I~kIHaksMsve-rdIR  371 (435)
T KOG0729         315 G-------NIKVLMATNRPDTLDPALLRPGRLDR-------KVEFGLPDLEGRT--------HIFKIHAKSMSVE-RDIR  371 (435)
T ss_pred             C-------CEEEEEECCCCCCCCHHHCCCCCCCC-------CEECCCCCCCCCC--------EEEEEECCCCCCC-CCHH
T ss_conf             8-------75898634898876876628764231-------1210587623551--------2577741114423-2216


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHH---HCCCCCCCHHHHHH
Q ss_conf             1110001223389868999999999987---43898106889545
Q gi|254780916|r  343 DKALSLLTKYPWIDNVQELKNILLRAVI---GLKDSHLTEDRFVL  384 (482)
Q Consensus       343 ~~a~~~L~~y~WPGNvREL~n~i~r~~i---~~~~~~i~~~~~~~  384 (482)
T Consensus       372 ~eLlarLCpns---TGAeiRSVCtEAGMfAIraRRkvaTEKDFL~  413 (435)
T KOG0729         372 FELLARLCPNS---TGAEIRSVCTEAGMFAIRARRKVATEKDFLD  413 (435)
T ss_pred             HHHHHHHCCCC---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998658897---4257888887743788887762200888999