HHsearch alignment for GI: 254780916 and conserved domain: KOG0730

>KOG0730 consensus.
Probab=98.68  E-value=2.6e-08  Score=78.32  Aligned_cols=175  Identities=18%  Similarity=0.222  Sum_probs=108.5

Q ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCC---CCCCEE
Q ss_conf             43204887327774367999999842675433210123465542100243311255553221110012344---667147
Q gi|254780916|r  161 DCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIE---ANGGTI  237 (482)
Q Consensus       161 ~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lFG~~~~~~~~~~~~~g~~~~---a~~Gtl  237 (482)
T Consensus       466 ~ppkGVLlyGPPGC~KT~lAkalAne~---~~nFlsvkgp----E-L~sk~vGeSEr~ir------~iF~kAR~~aP~Ii  531 (693)
T KOG0730         466 SPPKGVLLYGPPGCGKTLLAKALANEA---GMNFLSVKGP----E-LFSKYVGESERAIR------EVFRKARQVAPCII  531 (693)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEECCCH----H-HHHHHCCCHHHHHH------HHHHHHHHCCCEEE
T ss_conf             887547777899862478999986463---5872641578----9-98775182589999------99999862698377


Q ss_pred             EECCCCHHHHHH-------HHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCC---CCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             516642001889-------998888776420011235532123431565214332---1111112333799988654334
Q gi|254780916|r  238 VLEEPDALPLAV-------QGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNL---LPQVKSHVFRKDLYYRISVFLI  307 (482)
Q Consensus       238 ~l~ei~~L~~~~-------Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~~L---~~~~~~g~fr~dLy~rL~~~~i  307 (482)
T Consensus       532 FfDEiDsi~~~R~g~~~~v~~RVlsqLLtE----mDG~-e~~k~V~ViAATNRpd~ID~ALlRPGRlD~iiy-------V  599 (693)
T KOG0730         532 FFDEIDALAGSRGGSSSGVTDRVLSQLLTE----MDGL-EALKNVLVIAATNRPDMIDPALLRPGRLDRIIY-------V  599 (693)
T ss_pred             EHHHHHHHHHCCCCCCCCHHHHHHHHHHHH----CCCC-CCCCCEEEEECCCCHHHCCHHHCCCCCCCEEEE-------E
T ss_conf             446666666304787551489999999987----0041-014708999505881012697759865330575-------1


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-CCCCCCC--CCCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             4677877442222556677764101122333321111-1000122--3389868999999999987438981
Q gi|254780916|r  308 NISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDK-ALSLLTK--YPWIDNVQELKNILLRAVIGLKDSH  376 (482)
Q Consensus       308 ~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls~~-a~~~L~~--y~WPGNvREL~n~i~r~~i~~~~~~  376 (482)
T Consensus       600 plPD~~aR~~-I-------lk~~~kkmp-----~~~~vdl~~La~~T~g~S--GAel~~lCq~A~~~a~~e~  656 (693)
T KOG0730         600 PLPDLEARLE-I-------LKQCAKKMP-----FSEDVDLEELAQATEGYS--GAEIVAVCQEAALLALRES  656 (693)
T ss_pred             CCCCHHHHHH-H-------HHHHHHCCC-----CCCCCCHHHHHHHHCCCC--HHHHHHHHHHHHHHHHHHH
T ss_conf             5834788999-9-------999973399-----986556999999854677--3899999999999999875