HHsearch alignment for GI: 254780916 and conserved domain: KOG0736

>KOG0736 consensus.
Probab=97.52  E-value=7.9e-05  Score=53.74  Aligned_cols=120  Identities=21%  Similarity=0.249  Sum_probs=65.3

Q ss_pred             CCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCC---CCCEEE
Q ss_conf             32048873277743679999998426754332101234655421002433112555532211100123446---671475
Q gi|254780916|r  162 CAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEA---NGGTIV  238 (482)
Q Consensus       162 ~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lFG~~~~~~~~~~~~~g~~~~a---~~Gtl~  238 (482)
T Consensus       704 kRSGILLYGPPGTGKTLlAKAVATEc---sL~FlSVKG----PELLN-MYVGqS------E~NVR~VFerAR~A~PCVIF  769 (953)
T KOG0736         704 KRSGILLYGPPGTGKTLLAKAVATEC---SLNFLSVKG----PELLN-MYVGQS------EENVREVFERARSAAPCVIF  769 (953)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHC---EEEEEEECC----HHHHH-HHHCCH------HHHHHHHHHHHHCCCCEEEE
T ss_conf             13505887799985579999987543---036785058----89988-774301------88899999985446974998


Q ss_pred             ECCCCHHHHH---------HHHHHHH-HHHHHHCCCCCCCCCCCCCCEEEEECCCC-C--CCCCCHHHHHHHHH
Q ss_conf             1664200188---------9998888-77642001123553212343156521433-2--11111123337999
Q gi|254780916|r  239 LEEPDALPLA---------VQGRIYN-FIETGKIEFFDSRGAIRLDVRLIFLTEKN-L--LPQVKSHVFRKDLY  299 (482)
Q Consensus       239 l~ei~~L~~~---------~Q~~Ll~-~l~~~~~~~~g~~~~~~~~~RiIa~t~~~-L--~~~~~~g~fr~dLy  299 (482)
T Consensus       770 FDELDSlAP~RG~sGDSGGVMDRVVSQLLAEL----Dgls~~~s~~VFViGATNRPDLLDpALLRPGRFDKLvy  839 (953)
T KOG0736         770 FDELDSLAPNRGRSGDSGGVMDRVVSQLLAEL----DGLSDSSSQDVFVIGATNRPDLLDPALLRPGRFDKLVY  839 (953)
T ss_pred             ECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH----HCCCCCCCCCEEEEECCCCCCCCCHHHCCCCCCCEEEE
T ss_conf             31212327567887886540899999999986----26667888865998258885545765538876552488