HHsearch alignment for GI: 254780916 and conserved domain: KOG1808

>KOG1808 consensus.
Probab=95.74  E-value=0.0099  Score=38.93  Aligned_cols=122  Identities=16%  Similarity=0.206  Sum_probs=76.6

Q ss_pred             CCCCCCCCCCCCCCCCC-CEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHC-CCCCCCCCCC
Q ss_conf             22222222222223443-204887327774367999999842675433210123465542100243311-2555532211
Q gi|254780916|r  146 SPAMIQVVDLARKAGDC-AIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFG-DVDLQTKNSA  223 (482)
Q Consensus       146 S~~m~~v~~~i~~~a~~-~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lFG-~~~~~~~~~~  223 (482)
T Consensus       422 T~~vq~~la~~~~a~~~~~~pillqG~tssGKtsii~~la~~---~g~~~vrinnheht-d--~qeyig~y~~~~~g~l~  495 (1856)
T KOG1808         422 TPRVQKNLADLARAISSGKFPILLQGPTSSGKTSIIKELARA---TGKNIVRINNHEHT-D--LQEYIGTYVADDNGDLV  495 (1856)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHH---HCCCCEEHHCCCCC-H--HHHHHHHHEECCCCCEE
T ss_conf             689998899999999658998677547676811599999998---54673420024633-3--99998665007889725


Q ss_pred             CCCCCCCC-CCCC-EEEECCCCHHHHHHHHHHHHHHHH-HHCCCCCCCCCCCC
Q ss_conf             10012344-6671-475166420018899988887764-20011235532123
Q gi|254780916|r  224 QFLGKFIE-ANGG-TIVLEEPDALPLAVQGRIYNFIET-GKIEFFDSRGAIRL  273 (482)
Q Consensus       224 ~~~g~~~~-a~~G-tl~l~ei~~L~~~~Q~~Ll~~l~~-~~~~~~g~~~~~~~  273 (482)
T Consensus       496 freg~LV~Alr~G~~~vlD~lnla~~dvL~aLnrllddnRel~ipe~~rlv~~  548 (1856)
T KOG1808         496 FREGVLVQALRNGDWIVLDELNLAPHDVLEALNRLLDDNRELFIPETQRLVKA  548 (1856)
T ss_pred             EEHHHHHHHHHHCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEECC
T ss_conf             53468999987087798402012406789999840454041256344323224