HHsearch alignment for GI: 254780916 and conserved domain: KOG1942

>KOG1942 consensus.
Probab=91.23  E-value=0.41  Score=27.50  Aligned_cols=109  Identities=18%  Similarity=0.284  Sum_probs=73.3

Q ss_pred             CCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCC------CCCCCHHHHHHHHHHHHHHH
Q ss_conf             667147516642001889998888776420011235532123431565214332------11111123337999886543
Q gi|254780916|r  232 ANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNL------LPQVKSHVFRKDLYYRISVF  305 (482)
Q Consensus       232 a~~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~~L------~~~~~~g~fr~dLy~rL~~~  305 (482)
T Consensus       295 lvPGVLFIDEVhMLDiEcFTyL~kalES~i-a-----------PivifAsNrG~~~irGt~d~~sPhGip~dllDRl~I-  361 (456)
T KOG1942         295 LVPGVLFIDEVHMLDIECFTYLHKALESPI-A-----------PIVIFASNRGMCTIRGTEDILSPHGIPPDLLDRLLI-  361 (456)
T ss_pred             HCCCCEEEEEHHHHHHHHHHHHHHHHCCCC-C-----------CEEEEECCCCCEEECCCCCCCCCCCCCHHHHHHEEE-
T ss_conf             367626863013242699999999862778-7-----------569996277610221776787878899778612667-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             3446778774422225566777641011223333211111000122338986899999999
Q gi|254780916|r  306 LINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILL  366 (482)
Q Consensus       306 ~i~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~WPGNvREL~n~i~  366 (482)
T Consensus       362 ---irt~~y~~~e~r~Ii~~----Ra~~E~---l~~~e~a~~~l~~~g---t~tsLRy~vq  409 (456)
T KOG1942         362 ---IRTLPYDEEEIRQIIKI----RAQVEG---LQVEEEALDLLAEIG---TSTSLRYAVQ  409 (456)
T ss_pred             ---EEECCCCHHHHHHHHHH----HHHHHC---CEECHHHHHHHHHHC---CCHHHHHHHH
T ss_conf             ---86036998999999999----876514---232288999987605---4145788988