HHsearch alignment for GI: 254780916 and conserved domain: KOG2680

>KOG2680 consensus.
Probab=91.97  E-value=0.59  Score=26.37  Aligned_cols=130  Identities=17%  Similarity=0.236  Sum_probs=77.6

Q ss_pred             CCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCC-----CHHHHHHHHHHHHHHHH
Q ss_conf             6671475166420018899988887764200112355321234315652143321111-----11233379998865433
Q gi|254780916|r  232 ANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQV-----KSHVFRKDLYYRISVFL  306 (482)
Q Consensus       232 a~~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~~L~~~~-----~~g~fr~dLy~rL~~~~  306 (482)
T Consensus       287 ivpGVLFIDEvHMLDIEcFsFlNrAlE~-d~~Pi-----------iimaTNrgit~iRGTn~~SphGiP~D~lDR~lII-  353 (454)
T KOG2680         287 IVPGVLFIDEVHMLDIECFSFLNRALEN-DMAPI-----------IIMATNRGITRIRGTNYRSPHGIPIDLLDRMLII-  353 (454)
T ss_pred             ECCCEEEEEEEHHHHHHHHHHHHHHHHH-CCCCE-----------EEEECCCCEEEEECCCCCCCCCCCHHHHHHHHEE-
T ss_conf             2255178740021115799988887650-46857-----------9997277557760577789888867776441255-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH---HHHHHHCCCCCCCHHHHH
Q ss_conf             44677877442222556677764101122333321111100012233898689999999---999874389810688954
Q gi|254780916|r  307 INISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNIL---LRAVIGLKDSHLTEDRFV  383 (482)
Q Consensus       307 i~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~WPGNvREL~n~i---~r~~i~~~~~~i~~~~~~  383 (482)
T Consensus       354 -~t~p--y~~~d~~~IL~i----Rc~EEd---v~m~~~A~d~Lt~i~~~tsLRYai~Lit~a~~~~~krk~~~v~~~di~  423 (454)
T KOG2680         354 -STQP--YTEEDIKKILRI----RCQEED---VEMNPDALDLLTKIGEATSLRYAIHLITAASLVCLKRKGKVVEVDDIE  423 (454)
T ss_pred             -ECCC--CCHHHHHHHHHH----HHHHHC---CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEHHHHH
T ss_conf             -2565--768899999875----500521---335878999999861312378999998899999987548565446789


Q ss_pred             H
Q ss_conf             5
Q gi|254780916|r  384 L  384 (482)
Q Consensus       384 ~  384 (482)
T Consensus       424 r  424 (454)
T KOG2680         424 R  424 (454)
T ss_pred             H
T ss_conf             9