HHsearch alignment for GI: 254780916 and conserved domain: PHA02244

>PHA02244 ATPase-like protein.
Probab=98.02  E-value=1.1e-05  Score=59.72  Aligned_cols=130  Identities=26%  Similarity=0.305  Sum_probs=88.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCC
Q ss_conf             22222222222222223443204887327774367999999842675433210123465542100243311255553221
Q gi|254780916|r  143 IAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNS  222 (482)
Q Consensus       143 iG~S~~m~~v~~~i~~~a~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lFG~~~~~~~~~  222 (482)
T Consensus        99 iasnpt~hy~~~~i~~~v~~nipV~L~G~AGsGKt~~A~qIA~aL---dl~FYf~gA--I---~~ef~L~Gf~DA-nG~y  169 (383)
T PHA02244         99 IASNPTFHYETADIAKIVNANIPVFLKGGAGSGKNHIAEQIAEAL---DLDFYFMNA--I---MDEFELKGFIDA-NGKF  169 (383)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHH---CCCCEECHH--H---HHHHHCCCEECC-CCCE
T ss_conf             147863234587899987359856997588886348999999985---888244132--3---013430125648-9967


Q ss_pred             CC--CCCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCC
Q ss_conf             11--00123446671475166420018899988887764200112355321234315652143
Q gi|254780916|r  223 AQ--FLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEK  283 (482)
Q Consensus       223 ~~--~~g~~~~a~~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~  283 (482)
T Consensus       170 h~T~f~kaFk--~GGLfLlDEiDASnP~aL~~lNaALAN~fm~FPdG~V~~HedFr~IAagNT  230 (383)
T PHA02244        170 HETPFYEAFK--KGGLFFIDEIDASIPEALIIINSAIANKFFDFADERVTAHEDFRVISAGNT  230 (383)
T ss_pred             ECCHHHHHHH--CCCEEEEEHHCCCCHHHHHHHHHHHHCCCCCCCCCHHHCCCCEEEEEECCC
T ss_conf             2638999986--188799732004487999999899864763476421100576389972465