HHsearch alignment for GI: 254780916 and conserved domain: PRK03992

>PRK03992 proteasome-activating nucleotidase; Provisional.
Probab=98.82  E-value=2e-08  Score=79.12  Aligned_cols=217  Identities=18%  Similarity=0.225  Sum_probs=127.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC----------CC-CCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             22111111112222222222222222----------34-43204887327774367999999842675433210123465
Q gi|254780916|r  133 ENEHCALDSLIAVSPAMIQVVDLARK----------AG-DCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGM  201 (482)
Q Consensus       133 ~~~~~~~~~LiG~S~~m~~v~~~i~~----------~a-~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~  201 (482)
T Consensus       125 e~P~v~~~dIGGl~~~k~el~E~velPl~~pe~f~~~Gi~pPkGvLLyGPPGtGKTllAkAvA~e~---~~~fi~v~~s~  201 (390)
T PRK03992        125 ESPDVTYEDIGGLDEQIREVREAVELPLKNPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHET---NATFIRVVGSE  201 (390)
T ss_pred             CCCCCCHHHHCCHHHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEEHHH
T ss_conf             799998466149899999999999998659899997699999727868989997899999999874---88879966799


Q ss_pred             CCCCCCHHHHHCCCCCCCCCCCCCCCCCCCC---CCCEEEECCCCHHHH-----------HHHHHHHHHHHHHHCCCCCC
Q ss_conf             5421002433112555532211100123446---671475166420018-----------89998888776420011235
Q gi|254780916|r  202 IDQDKIEKFLFGDVDLQTKNSAQFLGKFIEA---NGGTIVLEEPDALPL-----------AVQGRIYNFIETGKIEFFDS  267 (482)
Q Consensus       202 ~~~~~~e~~lFG~~~~~~~~~~~~~g~~~~a---~~Gtl~l~ei~~L~~-----------~~Q~~Ll~~l~~~~~~~~g~  267 (482)
T Consensus       202 l~s-----k~vGes------ek~vr~lF~~Ar~~aP~IiFiDEiDai~~~R~~~~~~g~~ev~r~l~qLL~em-----DG  265 (390)
T PRK03992        202 LVQ-----KFIGEG------ARLVRELFELAREKAPSIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLAEM-----DG  265 (390)
T ss_pred             HHH-----CCCCHH------HHHHHHHHHHHHHHCCCEEEHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHC-----CC
T ss_conf             752-----454179------99999999999970990897143256633567788862088999999999974-----48


Q ss_pred             CCCCCCCCEEEEECCCC--CC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             53212343156521433--21-1111123337999886543344677877442222556677764101122333321111
Q gi|254780916|r  268 RGAIRLDVRLIFLTEKN--LL-PQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDK  344 (482)
Q Consensus       268 ~~~~~~~~RiIa~t~~~--L~-~~~~~g~fr~dLy~rL~~~~i~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls~~  344 (482)
T Consensus       266 ~~-~~~~V~VIaATNrpd~LDpAllRpGRFDr-------~I~iplPd~~~R~~-I---lki~~~~----~~l~-~dvdl~  328 (390)
T PRK03992        266 FD-PRGNVKIIAATNRPDILDPALLRPGRFDR-------IIEVPLPDEEGRLE-I---LKIHTRK----MNLA-DDVDLE  328 (390)
T ss_pred             CC-CCCCEEEEEECCCCHHCCHHHHCCCCCCE-------EEEECCCCHHHHHH-H---HHHHHCC----CCCC-CCCCHH
T ss_conf             77-77882799606981005977754776523-------88708949999999-9---9998479----9999-888999


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHC---CCCCCCHHHHHHHHCC
Q ss_conf             1000122338986899999999998743---8981068895454212
Q gi|254780916|r  345 ALSLLTKYPWIDNVQELKNILLRAVIGL---KDSHLTEDRFVLLLSR  388 (482)
Q Consensus       345 a~~~L~~y~WPGNvREL~n~i~r~~i~~---~~~~i~~~~~~~~l~~  388 (482)
T Consensus       329 ~lA~~T~-G~--SGADI~~lc~EA~m~Air~~r~~i~~~Df~~Ai~k  372 (390)
T PRK03992        329 ELAELTE-GA--SGADLKAICTEAGMFAIRDDRTEVTMEDFLKAIEK  372 (390)
T ss_pred             HHHHHCC-CC--CHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             9997687-99--89999999999999999858986089999999999